str(list_id)
#> List of 2
-#> $ shortId : chr "0e03fb919e10e6bd6cb5b44c59338684"
-#> $ userListId: int 86963048
+#> $ shortId : chr "ac4e54ca49e721981e2aa81ee1c0df82"
+#> $ userListId: int 87054434
Finally, we are ready to submit the enrichment analysis request to
Enrichr. Same as explained above for the wrapper function
rba_enrichr()
, we can supply the “gene_set_library”
diff --git a/articles/rbioapi_jaspar.html b/articles/rbioapi_jaspar.html
index 61479de..20599df 100644
--- a/articles/rbioapi_jaspar.html
+++ b/articles/rbioapi_jaspar.html
@@ -87,7 +87,7 @@
Moosa
Rezwani
- 2025-01-01
+ 2025-01-06
Source: vignettes/rbioapi_jaspar.Rmd
rbioapi_jaspar.Rmd
diff --git a/articles/rbioapi_mieaa.html b/articles/rbioapi_mieaa.html
index 7f61692..b6106e5 100644
--- a/articles/rbioapi_mieaa.html
+++ b/articles/rbioapi_mieaa.html
@@ -91,7 +91,7 @@
Moosa
Rezwani
- 2025-01-01
+ 2025-01-06
Source: vignettes/rbioapi_mieaa.Rmd
rbioapi_mieaa.Rmd
@@ -161,11 +161,11 @@ Approach 1: Using the Wrapper fun
#> Submitting ORA enrichment request for 17 miRNA IDs of species Homo sapiens to miEAA servers.
#>
#> -- Step 2/3: Checking for Submitted enrichment analysis's status every 5 seconds.
-#> Your submitted job ID is: a3ca5443-1abb-4fe4-9cca-ccd4c126a771
-#> .......
+#> Your submitted job ID is: ec6d5db3-184a-4af2-9c6f-ea6b6e9dedaf
+#> ........
#>
#> -- Step 3/3: Retrieving the results.
-#> Retrieving results of submitted enrichment request with ID: a3ca5443-1abb-4fe4-9cca-ccd4c126a771
+#> Retrieving results of submitted enrichment request with ID: ec6d5db3-184a-4af2-9c6f-ea6b6e9dedaf
## 2b Or, We can limit the enrichment to certain datasets (enrichment categories)
mieaa_kegg <- rba_mieaa_enrich(test_set = mirs,
mirna_type = "mature",
@@ -177,11 +177,11 @@ Approach 1: Using the Wrapper fun
#> Submitting ORA enrichment request for 17 miRNA IDs of species Homo sapiens to miEAA servers.
#>
#> -- Step 2/3: Checking for Submitted enrichment analysis's status every 5 seconds.
-#> Your submitted job ID is: 7a407342-69b6-45b3-8588-adcb203e852d
+#> Your submitted job ID is: 46a665b6-1561-42b8-8e28-225b744d0f06
#> .
#>
#> -- Step 3/3: Retrieving the results.
-#> Retrieving results of submitted enrichment request with ID: 7a407342-69b6-45b3-8588-adcb203e852d
+#> Retrieving results of submitted enrichment request with ID: 46a665b6-1561-42b8-8e28-225b744d0f06
diff --git a/articles/rbioapi_panther.html b/articles/rbioapi_panther.html
index 9296696..6a9c04f 100644
--- a/articles/rbioapi_panther.html
+++ b/articles/rbioapi_panther.html
@@ -91,7 +91,7 @@
Moosa
Rezwani
- 2025-01-01
+ 2025-01-06
Source: vignettes/rbioapi_panther.Rmd
rbioapi_panther.Rmd
diff --git a/articles/rbioapi_reactome.html b/articles/rbioapi_reactome.html
index db855ec..8c2a505 100644
--- a/articles/rbioapi_reactome.html
+++ b/articles/rbioapi_reactome.html
@@ -91,7 +91,7 @@
Moosa
Rezwani
- 2025-01-01
+ 2025-01-06
Source: vignettes/rbioapi_reactome.Rmd
rbioapi_reactome.Rmd
diff --git a/articles/rbioapi_string.html b/articles/rbioapi_string.html
index 9d54b77..5cc4a7b 100644
--- a/articles/rbioapi_string.html
+++ b/articles/rbioapi_string.html
@@ -91,7 +91,7 @@
Moosa
Rezwani
- 2025-01-01
+ 2025-01-06
Source: vignettes/rbioapi_string.Rmd
rbioapi_string.Rmd
diff --git a/articles/rbioapi_uniprot.html b/articles/rbioapi_uniprot.html
index fc578db..f1247ec 100644
--- a/articles/rbioapi_uniprot.html
+++ b/articles/rbioapi_uniprot.html
@@ -87,7 +87,7 @@
Moosa
Rezwani
- 2025-01-01
+ 2025-01-06
Source: vignettes/rbioapi_uniprot.Rmd
rbioapi_uniprot.Rmd
diff --git a/pkgdown.yml b/pkgdown.yml
index a292e07..8258c70 100644
--- a/pkgdown.yml
+++ b/pkgdown.yml
@@ -11,7 +11,7 @@ articles:
rbioapi_string: rbioapi_string.html
rbioapi_uniprot: rbioapi_uniprot.html
rbioapi: rbioapi.html
-last_built: 2025-01-01T04:18Z
+last_built: 2025-01-06T04:14Z
urls:
reference: https://rbioapi.moosa-r.com/reference
article: https://rbioapi.moosa-r.com/articles
diff --git a/search.json b/search.json
index 67f180b..3f6e8f5 100644
--- a/search.json
+++ b/search.json
@@ -1 +1 @@
-[{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":null,"dir":"","previous_headings":"","what":"GNU General Public License","title":"GNU General Public License","text":"Version 3, 29 June 2007Copyright © 2007 Free Software Foundation, Inc. Everyone permitted copy distribute verbatim copies license document, changing allowed.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"preamble","dir":"","previous_headings":"","what":"Preamble","title":"GNU General Public License","text":"GNU General Public License free, copyleft license software kinds works. licenses software practical works designed take away freedom share change works. contrast, GNU General Public License intended guarantee freedom share change versions program–make sure remains free software users. , Free Software Foundation, use GNU General Public License software; applies also work released way authors. can apply programs, . speak free software, referring freedom, price. General Public Licenses designed make sure freedom distribute copies free software (charge wish), receive source code can get want , can change software use pieces new free programs, know can things. protect rights, need prevent others denying rights asking surrender rights. Therefore, certain responsibilities distribute copies software, modify : responsibilities respect freedom others. example, distribute copies program, whether gratis fee, must pass recipients freedoms received. must make sure , , receive can get source code. must show terms know rights. Developers use GNU GPL protect rights two steps: (1) assert copyright software, (2) offer License giving legal permission copy, distribute /modify . developers’ authors’ protection, GPL clearly explains warranty free software. users’ authors’ sake, GPL requires modified versions marked changed, problems attributed erroneously authors previous versions. devices designed deny users access install run modified versions software inside , although manufacturer can . fundamentally incompatible aim protecting users’ freedom change software. systematic pattern abuse occurs area products individuals use, precisely unacceptable. Therefore, designed version GPL prohibit practice products. problems arise substantially domains, stand ready extend provision domains future versions GPL, needed protect freedom users. Finally, every program threatened constantly software patents. States allow patents restrict development use software general-purpose computers, , wish avoid special danger patents applied free program make effectively proprietary. prevent , GPL assures patents used render program non-free. precise terms conditions copying, distribution modification follow.","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_0-definitions","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"0. Definitions","title":"GNU General Public License","text":"“License” refers version 3 GNU General Public License. “Copyright” also means copyright-like laws apply kinds works, semiconductor masks. “Program” refers copyrightable work licensed License. licensee addressed “”. “Licensees” “recipients” may individuals organizations. “modify” work means copy adapt part work fashion requiring copyright permission, making exact copy. resulting work called “modified version” earlier work work “based ” earlier work. “covered work” means either unmodified Program work based Program. “propagate” work means anything , without permission, make directly secondarily liable infringement applicable copyright law, except executing computer modifying private copy. Propagation includes copying, distribution (without modification), making available public, countries activities well. “convey” work means kind propagation enables parties make receive copies. Mere interaction user computer network, transfer copy, conveying. interactive user interface displays “Appropriate Legal Notices” extent includes convenient prominently visible feature (1) displays appropriate copyright notice, (2) tells user warranty work (except extent warranties provided), licensees may convey work License, view copy License. interface presents list user commands options, menu, prominent item list meets criterion.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_1-source-code","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"1. Source Code","title":"GNU General Public License","text":"“source code” work means preferred form work making modifications . “Object code” means non-source form work. “Standard Interface” means interface either official standard defined recognized standards body, , case interfaces specified particular programming language, one widely used among developers working language. “System Libraries” executable work include anything, work whole, () included normal form packaging Major Component, part Major Component, (b) serves enable use work Major Component, implement Standard Interface implementation available public source code form. “Major Component”, context, means major essential component (kernel, window system, ) specific operating system () executable work runs, compiler used produce work, object code interpreter used run . “Corresponding Source” work object code form means source code needed generate, install, (executable work) run object code modify work, including scripts control activities. However, include work’s System Libraries, general-purpose tools generally available free programs used unmodified performing activities part work. example, Corresponding Source includes interface definition files associated source files work, source code shared libraries dynamically linked subprograms work specifically designed require, intimate data communication control flow subprograms parts work. Corresponding Source need include anything users can regenerate automatically parts Corresponding Source. Corresponding Source work source code form work.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_2-basic-permissions","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"2. Basic Permissions","title":"GNU General Public License","text":"rights granted License granted term copyright Program, irrevocable provided stated conditions met. License explicitly affirms unlimited permission run unmodified Program. output running covered work covered License output, given content, constitutes covered work. License acknowledges rights fair use equivalent, provided copyright law. may make, run propagate covered works convey, without conditions long license otherwise remains force. may convey covered works others sole purpose make modifications exclusively , provide facilities running works, provided comply terms License conveying material control copyright. thus making running covered works must exclusively behalf, direction control, terms prohibit making copies copyrighted material outside relationship . Conveying circumstances permitted solely conditions stated . Sublicensing allowed; section 10 makes unnecessary.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_3-protecting-users-legal-rights-from-anti-circumvention-law","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"3. Protecting Users’ Legal Rights From Anti-Circumvention Law","title":"GNU General Public License","text":"covered work shall deemed part effective technological measure applicable law fulfilling obligations article 11 WIPO copyright treaty adopted 20 December 1996, similar laws prohibiting restricting circumvention measures. convey covered work, waive legal power forbid circumvention technological measures extent circumvention effected exercising rights License respect covered work, disclaim intention limit operation modification work means enforcing, work’s users, third parties’ legal rights forbid circumvention technological measures.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_4-conveying-verbatim-copies","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"4. Conveying Verbatim Copies","title":"GNU General Public License","text":"may convey verbatim copies Program’s source code receive , medium, provided conspicuously appropriately publish copy appropriate copyright notice; keep intact notices stating License non-permissive terms added accord section 7 apply code; keep intact notices absence warranty; give recipients copy License along Program. may charge price price copy convey, may offer support warranty protection fee.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_5-conveying-modified-source-versions","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"5. Conveying Modified Source Versions","title":"GNU General Public License","text":"may convey work based Program, modifications produce Program, form source code terms section 4, provided also meet conditions: ) work must carry prominent notices stating modified , giving relevant date. b) work must carry prominent notices stating released License conditions added section 7. requirement modifies requirement section 4 “keep intact notices”. c) must license entire work, whole, License anyone comes possession copy. License therefore apply, along applicable section 7 additional terms, whole work, parts, regardless packaged. License gives permission license work way, invalidate permission separately received . d) work interactive user interfaces, must display Appropriate Legal Notices; however, Program interactive interfaces display Appropriate Legal Notices, work need make . compilation covered work separate independent works, nature extensions covered work, combined form larger program, volume storage distribution medium, called “aggregate” compilation resulting copyright used limit access legal rights compilation’s users beyond individual works permit. Inclusion covered work aggregate cause License apply parts aggregate.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_6-conveying-non-source-forms","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"6. Conveying Non-Source Forms","title":"GNU General Public License","text":"may convey covered work object code form terms sections 4 5, provided also convey machine-readable Corresponding Source terms License, one ways: ) Convey object code , embodied , physical product (including physical distribution medium), accompanied Corresponding Source fixed durable physical medium customarily used software interchange. b) Convey object code , embodied , physical product (including physical distribution medium), accompanied written offer, valid least three years valid long offer spare parts customer support product model, give anyone possesses object code either (1) copy Corresponding Source software product covered License, durable physical medium customarily used software interchange, price reasonable cost physically performing conveying source, (2) access copy Corresponding Source network server charge. c) Convey individual copies object code copy written offer provide Corresponding Source. alternative allowed occasionally noncommercially, received object code offer, accord subsection 6b. d) Convey object code offering access designated place (gratis charge), offer equivalent access Corresponding Source way place charge. need require recipients copy Corresponding Source along object code. place copy object code network server, Corresponding Source may different server (operated third party) supports equivalent copying facilities, provided maintain clear directions next object code saying find Corresponding Source. Regardless server hosts Corresponding Source, remain obligated ensure available long needed satisfy requirements. e) Convey object code using peer--peer transmission, provided inform peers object code Corresponding Source work offered general public charge subsection 6d. separable portion object code, whose source code excluded Corresponding Source System Library, need included conveying object code work. “User Product” either (1) “consumer product”, means tangible personal property normally used personal, family, household purposes, (2) anything designed sold incorporation dwelling. determining whether product consumer product, doubtful cases shall resolved favor coverage. particular product received particular user, “normally used” refers typical common use class product, regardless status particular user way particular user actually uses, expects expected use, product. product consumer product regardless whether product substantial commercial, industrial non-consumer uses, unless uses represent significant mode use product. “Installation Information” User Product means methods, procedures, authorization keys, information required install execute modified versions covered work User Product modified version Corresponding Source. information must suffice ensure continued functioning modified object code case prevented interfered solely modification made. convey object code work section , , specifically use , User Product, conveying occurs part transaction right possession use User Product transferred recipient perpetuity fixed term (regardless transaction characterized), Corresponding Source conveyed section must accompanied Installation Information. requirement apply neither third party retains ability install modified object code User Product (example, work installed ROM). requirement provide Installation Information include requirement continue provide support service, warranty, updates work modified installed recipient, User Product modified installed. Access network may denied modification materially adversely affects operation network violates rules protocols communication across network. Corresponding Source conveyed, Installation Information provided, accord section must format publicly documented (implementation available public source code form), must require special password key unpacking, reading copying.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_7-additional-terms","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"7. Additional Terms","title":"GNU General Public License","text":"“Additional permissions” terms supplement terms License making exceptions one conditions. Additional permissions applicable entire Program shall treated though included License, extent valid applicable law. additional permissions apply part Program, part may used separately permissions, entire Program remains governed License without regard additional permissions. convey copy covered work, may option remove additional permissions copy, part . (Additional permissions may written require removal certain cases modify work.) may place additional permissions material, added covered work, can give appropriate copyright permission. Notwithstanding provision License, material add covered work, may (authorized copyright holders material) supplement terms License terms: ) Disclaiming warranty limiting liability differently terms sections 15 16 License; b) Requiring preservation specified reasonable legal notices author attributions material Appropriate Legal Notices displayed works containing ; c) Prohibiting misrepresentation origin material, requiring modified versions material marked reasonable ways different original version; d) Limiting use publicity purposes names licensors authors material; e) Declining grant rights trademark law use trade names, trademarks, service marks; f) Requiring indemnification licensors authors material anyone conveys material (modified versions ) contractual assumptions liability recipient, liability contractual assumptions directly impose licensors authors. non-permissive additional terms considered “restrictions” within meaning section 10. Program received , part , contains notice stating governed License along term restriction, may remove term. license document contains restriction permits relicensing conveying License, may add covered work material governed terms license document, provided restriction survive relicensing conveying. add terms covered work accord section, must place, relevant source files, statement additional terms apply files, notice indicating find applicable terms. Additional terms, permissive non-permissive, may stated form separately written license, stated exceptions; requirements apply either way.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_8-termination","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"8. Termination","title":"GNU General Public License","text":"may propagate modify covered work except expressly provided License. attempt otherwise propagate modify void, automatically terminate rights License (including patent licenses granted third paragraph section 11). However, cease violation License, license particular copyright holder reinstated () provisionally, unless copyright holder explicitly finally terminates license, (b) permanently, copyright holder fails notify violation reasonable means prior 60 days cessation. Moreover, license particular copyright holder reinstated permanently copyright holder notifies violation reasonable means, first time received notice violation License (work) copyright holder, cure violation prior 30 days receipt notice. Termination rights section terminate licenses parties received copies rights License. rights terminated permanently reinstated, qualify receive new licenses material section 10.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_9-acceptance-not-required-for-having-copies","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"9. Acceptance Not Required for Having Copies","title":"GNU General Public License","text":"required accept License order receive run copy Program. Ancillary propagation covered work occurring solely consequence using peer--peer transmission receive copy likewise require acceptance. However, nothing License grants permission propagate modify covered work. actions infringe copyright accept License. Therefore, modifying propagating covered work, indicate acceptance License .","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_10-automatic-licensing-of-downstream-recipients","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"10. Automatic Licensing of Downstream Recipients","title":"GNU General Public License","text":"time convey covered work, recipient automatically receives license original licensors, run, modify propagate work, subject License. responsible enforcing compliance third parties License. “entity transaction” transaction transferring control organization, substantially assets one, subdividing organization, merging organizations. propagation covered work results entity transaction, party transaction receives copy work also receives whatever licenses work party’s predecessor interest give previous paragraph, plus right possession Corresponding Source work predecessor interest, predecessor can get reasonable efforts. may impose restrictions exercise rights granted affirmed License. example, may impose license fee, royalty, charge exercise rights granted License, may initiate litigation (including cross-claim counterclaim lawsuit) alleging patent claim infringed making, using, selling, offering sale, importing Program portion .","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_11-patents","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"11. Patents","title":"GNU General Public License","text":"“contributor” copyright holder authorizes use License Program work Program based. work thus licensed called contributor’s “contributor version”. contributor’s “essential patent claims” patent claims owned controlled contributor, whether already acquired hereafter acquired, infringed manner, permitted License, making, using, selling contributor version, include claims infringed consequence modification contributor version. purposes definition, “control” includes right grant patent sublicenses manner consistent requirements License. contributor grants non-exclusive, worldwide, royalty-free patent license contributor’s essential patent claims, make, use, sell, offer sale, import otherwise run, modify propagate contents contributor version. following three paragraphs, “patent license” express agreement commitment, however denominated, enforce patent (express permission practice patent covenant sue patent infringement). “grant” patent license party means make agreement commitment enforce patent party. convey covered work, knowingly relying patent license, Corresponding Source work available anyone copy, free charge terms License, publicly available network server readily accessible means, must either (1) cause Corresponding Source available, (2) arrange deprive benefit patent license particular work, (3) arrange, manner consistent requirements License, extend patent license downstream recipients. “Knowingly relying” means actual knowledge , patent license, conveying covered work country, recipient’s use covered work country, infringe one identifiable patents country reason believe valid. , pursuant connection single transaction arrangement, convey, propagate procuring conveyance , covered work, grant patent license parties receiving covered work authorizing use, propagate, modify convey specific copy covered work, patent license grant automatically extended recipients covered work works based . patent license “discriminatory” include within scope coverage, prohibits exercise , conditioned non-exercise one rights specifically granted License. may convey covered work party arrangement third party business distributing software, make payment third party based extent activity conveying work, third party grants, parties receive covered work , discriminatory patent license () connection copies covered work conveyed (copies made copies), (b) primarily connection specific products compilations contain covered work, unless entered arrangement, patent license granted, prior 28 March 2007. Nothing License shall construed excluding limiting implied license defenses infringement may otherwise available applicable patent law.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_12-no-surrender-of-others-freedom","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"12. No Surrender of Others’ Freedom","title":"GNU General Public License","text":"conditions imposed (whether court order, agreement otherwise) contradict conditions License, excuse conditions License. convey covered work satisfy simultaneously obligations License pertinent obligations, consequence may convey . example, agree terms obligate collect royalty conveying convey Program, way satisfy terms License refrain entirely conveying Program.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_13-use-with-the-gnu-affero-general-public-license","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"13. Use with the GNU Affero General Public License","title":"GNU General Public License","text":"Notwithstanding provision License, permission link combine covered work work licensed version 3 GNU Affero General Public License single combined work, convey resulting work. terms License continue apply part covered work, special requirements GNU Affero General Public License, section 13, concerning interaction network apply combination .","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_14-revised-versions-of-this-license","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"14. Revised Versions of this License","title":"GNU General Public License","text":"Free Software Foundation may publish revised /new versions GNU General Public License time time. new versions similar spirit present version, may differ detail address new problems concerns. version given distinguishing version number. Program specifies certain numbered version GNU General Public License “later version” applies , option following terms conditions either numbered version later version published Free Software Foundation. Program specify version number GNU General Public License, may choose version ever published Free Software Foundation. Program specifies proxy can decide future versions GNU General Public License can used, proxy’s public statement acceptance version permanently authorizes choose version Program. Later license versions may give additional different permissions. However, additional obligations imposed author copyright holder result choosing follow later version.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_15-disclaimer-of-warranty","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"15. Disclaimer of Warranty","title":"GNU General Public License","text":"WARRANTY PROGRAM, EXTENT PERMITTED APPLICABLE LAW. EXCEPT OTHERWISE STATED WRITING COPYRIGHT HOLDERS /PARTIES PROVIDE PROGRAM “” WITHOUT WARRANTY KIND, EITHER EXPRESSED IMPLIED, INCLUDING, LIMITED , IMPLIED WARRANTIES MERCHANTABILITY FITNESS PARTICULAR PURPOSE. ENTIRE RISK QUALITY PERFORMANCE PROGRAM . PROGRAM PROVE DEFECTIVE, ASSUME COST NECESSARY SERVICING, REPAIR CORRECTION.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_16-limitation-of-liability","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"16. Limitation of Liability","title":"GNU General Public License","text":"EVENT UNLESS REQUIRED APPLICABLE LAW AGREED WRITING COPYRIGHT HOLDER, PARTY MODIFIES /CONVEYS PROGRAM PERMITTED , LIABLE DAMAGES, INCLUDING GENERAL, SPECIAL, INCIDENTAL CONSEQUENTIAL DAMAGES ARISING USE INABILITY USE PROGRAM (INCLUDING LIMITED LOSS DATA DATA RENDERED INACCURATE LOSSES SUSTAINED THIRD PARTIES FAILURE PROGRAM OPERATE PROGRAMS), EVEN HOLDER PARTY ADVISED POSSIBILITY DAMAGES.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_17-interpretation-of-sections-15-and-16","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"17. Interpretation of Sections 15 and 16","title":"GNU General Public License","text":"disclaimer warranty limitation liability provided given local legal effect according terms, reviewing courts shall apply local law closely approximates absolute waiver civil liability connection Program, unless warranty assumption liability accompanies copy Program return fee. END TERMS CONDITIONS","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"how-to-apply-these-terms-to-your-new-programs","dir":"","previous_headings":"","what":"How to Apply These Terms to Your New Programs","title":"GNU General Public License","text":"develop new program, want greatest possible use public, best way achieve make free software everyone can redistribute change terms. , attach following notices program. safest attach start source file effectively state exclusion warranty; file least “copyright” line pointer full notice found. Also add information contact electronic paper mail. program terminal interaction, make output short notice like starts interactive mode: hypothetical commands show w show c show appropriate parts General Public License. course, program’s commands might different; GUI interface, use “box”. also get employer (work programmer) school, , sign “copyright disclaimer” program, necessary. information , apply follow GNU GPL, see . GNU General Public License permit incorporating program proprietary programs. program subroutine library, may consider useful permit linking proprietary applications library. want , use GNU Lesser General Public License instead License. first, please read .","code":" Copyright (C) 2020 Moosa Rezwani This program is free software: you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program. If not, see . rbioapi Copyright (C) 2020 Moosa Rezwani This program comes with ABSOLUTELY NO WARRANTY; for details type 'show w'. This is free software, and you are welcome to redistribute it under certain conditions; type 'show c' for details."},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"what-does-rbioapi-do","dir":"Articles","previous_headings":"","what":"What does rbioapi do?","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"Currently fully supports Enrichr, JASPAR, miEAA, PANTHER, Reactome, STRING, UniProt! goal rbioapi provide user-friendly consistent interface biological databases services: way insulates user technicalities using web services API creates unified easy--use interface biological medical web services. rbioapi, need technical knowledge web services API learn work new package every biologic service database. ongoing project; New databases services added periodically. Feel free suggest databases services often use.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"what-is-supported-by-rbioapi","dir":"Articles","previous_headings":"","what":"What is Supported by rbioapi?","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"rbioapi dedicated Biological Medical databases web services. Currently, rbioapi supports covers every API resources following services: (alphabetical order): CRAN (Stable) version: (https://cran.r-project.org/package=rbioapi) Enrichr (rbioapi vignette article) (new) JASPAR (rbioapi vignette article) (new) miEAA (rbioapi vignette article) PANTHER (rbioapi vignette article) Reactome (rbioapi vignette article) STRING (rbioapi vignette article) UniProt (rbioapi vignette article) Github (Developmental) version: (https://github.com/moosa-r/rbioapi/): currently none services dedicated vignette article. However, article, write general framework rbioapi. Make sure check vignette article service learn use . Note : rbioapi ongoing project. New databases services implemented periodically order gradually make package comprehensive possible. see often using certain database/service? Feel free suggest database/service creating issue GitHub repository. appreciate suggestions.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"How-to-install","dir":"Articles","previous_headings":"","what":"How to install?","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"can install stable release version rbioapi CRAN : However, CRAN version released every 1-2 months, can install recent (development) version GitHub : Now, can load package:","code":"install.packages(\"rbioapi\") install.packages(\"remotes\") remotes::install_github(\"moosa-r/rbioapi\") library(rbioapi)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"naming-conventions","dir":"Articles","previous_headings":"","what":"Naming conventions","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"make namespace organized, functions named following pattern: example, rba_string_version() call STRING’s version resource. Thus, version, rbioapi function one following naming schema: rba_enrichr_* rba_jaspar_* rba_mieaa_* rba_panther_* rba_reactome_* rba_string_* rba_uniprot_* three exceptions: rba_options(), rba_connection_test(), rba_pages(); helper functions. later.","code":"rba_[service_name]_[resource_name] rba_string_version() #> Retrieving the STRING database version and address used by rbioapi. #> $string_version #> [1] \"12.0\" #> #> $stable_address #> [1] \"https://version-12-0.string-db.org\""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"changing-the-options","dir":"Articles","previous_headings":"","what":"Changing the options","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"provide control, multiple options implemented. See manual rba_options() function full description available options. short, options govern rbioapi’s connection servers (e.g. timeout, retry) options modify experience rbioapi (e.g. verbose, diagnostics, save_file). two ways may use change option. Also, can get table available rbioapi options current values calling rba_options()without argument: Now, let us consider ways can alter settings:","code":"rba_options() #> rbioapi_option current_value allowed_value #> 1 diagnostics FALSE Logical (TRUE/FALSE) #> 2 dir_name rbioapi Character #> 3 progress FALSE Logical (TRUE/FALSE) #> 4 retry_max 0 Numeric (0 or greater) #> 5 retry_wait 10 Numeric (0 or greater) #> 6 save_file FALSE Logical (TRUE/FALSE) #> 7 skip_error TRUE Logical (TRUE/FALSE) #> 8 timeout 30 Numeric (0.1 or greater) #> 9 verbose TRUE Logical (TRUE/FALSE)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"changing-the-options-change-the-option-globally","dir":"Articles","previous_headings":"Changing the options","what":"Change the option globally","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"Changing option globally means rest R session, rbioapi function respect changed option. , use rba_options(). argument function corresponds certain option; Thus running function desired new values, globally alter rbioapi option. example:","code":"rba_options(save_file = TRUE) ## From now on, the raw file of server's response will be saved to your working directory. rba_options(verbose = FALSE) ## From now on, the package will be quiet."},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"changing-the-options-change-the-option-only-within-a-function-call","dir":"Articles","previous_headings":"Changing the options","what":"Change the option only within a function call","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"can pass additional arguments rbioapi function using “ellipsis” (familiar … dot dot dot!). Meaning can call function additional arguments ‘option = value’ pair. way, changes options confined within particular function call. example:","code":"## Save the server's raw response file: x <- rba_reactome_species(only_main = TRUE, save_file = \"reactome_species.json\") ## Also, in the case of connection failure, retry up to 10 times: x <- rba_reactome_species(only_main = TRUE, save_file = \"reactome_species.json\", retry_max = 10) ## Run these codes in your own R session to see the difference. ## show internal diagnostics boring details x <- rba_uniprot_proteins_crossref(db_id = \"CD40\", db_name = \"HGNC\", diagnostics = TRUE) ## The next function you call, will still use the default rbioapi options x <- rba_uniprot_proteins_crossref(db_id = \"CD40\", db_name = \"HGNC\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"connection-test","dir":"Articles","previous_headings":"","what":"Connection test","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"second exception functions’ naming schema rba_connection_test(). Run simple function check connection supported services/databases. encounter errors using rbioapi, kindly run function make sure internet connection servers fine.","code":"rba_connection_test(print_output = TRUE) #> Checking Your connection to the Databases currently supported by rbioapi: #> --->>> Internet : #> +++ Connected to the Internet. #> --->>> Enrichr : #> +++ The server is responding. #> --->>> Ensembl : #> +++ The server is responding. #> --->>> JASPAR : #> +++ The server is responding. #> --->>> miEAA : #> +++ The server is responding. #> --->>> PANTHER : #> +++ The server is responding. #> --->>> Reactome Content Service : #> +++ The server is responding. #> --->>> Reactome Analysis Service : #> +++ The server is responding. #> --->>> STRING : #> +++ The server is responding. #> --->>> UniProt : #> +++ The server is responding."},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"multi-pages","dir":"Articles","previous_headings":"","what":"Iterating over paginated results","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"API resources return paginated responses. particularly common API resources return potentially large responses. rbioapi, cases, arguments “page_number” (default value 1) -API resource allows- “page_size”. save time, may use rba_pages(). function iterate pages specified. Take rba_uniprot_taxonomy_name example. function allows search taxonomic nodes UniProt. response can potentially huge size, UniProt returns paginated response. example, search nodes contain “adenovirus”, large number hits: can see, server returned first page response, retrieve pages, make separate calls change “page_number” argument within call, simply use rba_pages() demonstrated : can see, done : Wrap function call qoute() enter input rba_pages(). Replace argument want iterate , string format: “pages:start:end”. example, supplied page_number = “pages:1:3” get responses pages 1 3.","code":"adeno <- rba_uniprot_taxonomy_name(name = \"adenovirus\", search_type = \"contain\", page_number = 1) str(adeno, max.level = 2) #> List of 2 #> $ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ taxonomyId : int [1:200] 10509 10510 10511 10512 10513 10514 10515 10519 10521 10522 ... #> ..$ mnemonic : chr [1:200] \"9ADEN\" \"ADEB3\" \"ADEB7\" \"9ADEN\" ... #> ..$ scientificName: chr [1:200] \"Mastadenovirus\" \"Bovine adenovirus B serotype 3\" \"Bovine adenovirus 7\" \"Canine adenovirus 1\" ... #> ..$ rank : chr [1:200] \"genus\" \"serotype\" \"serotype\" \"serotype\" ... #> ..$ superregnum : chr [1:200] \"V\" \"V\" \"V\" \"V\" ... #> ..$ hidden : logi [1:200] FALSE TRUE TRUE TRUE TRUE TRUE ... #> ..$ commonName : chr [1:200] NA \"BAdV-3\" \"BAdV-7\" NA ... #> ..$ synonym : chr [1:200] NA \"Mastadenovirus bos3\" NA NA ... #> $ pageInfo :List of 3 #> ..$ resultsPerPage: int 200 #> ..$ currentPage : int 1 #> ..$ totalRecords : int 1102 adeno_pages = rba_pages(quote(rba_uniprot_taxonomy_name(name = \"adenovirus\", search_type = \"contain\", page_number = \"pages:1:3\"))) ## You can inspect the structure of the response: str(adeno_pages, max.level = 2) #> List of 3 #> $ page_1:List of 2 #> ..$ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ pageInfo :List of 3 #> $ page_2:List of 2 #> ..$ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ pageInfo :List of 3 #> $ page_3:List of 2 #> ..$ taxonomies:'data.frame': 200 obs. of 6 variables: #> ..$ pageInfo :List of 3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"how-to-cite","dir":"Articles","previous_headings":"","what":"How and what to cite?","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"rbioapi interface databases services. Thus, used rbioapi published research, addition kindly citing rbioapi, make sure fully properly cite databases/services used. Suggested citations added functions’ manuals, “references” section; Nevertheless, user’s responsibility check proper citations properly cite database/services used.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"how-to-cite-rbioapi","dir":"Articles","previous_headings":"How and what to cite?","what":"How to cite rbioapi","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"how-to-cite-services","dir":"Articles","previous_headings":"How and what to cite?","what":"How to cite the databases and web services","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"cite Enrichr. (See Enrichr website) cite JASPAR. (See JASPAR website) cite miEAA. (See miEAA website) cite PANTHER. (See PANTHER website) cite Reactome. (See Reactome website) cite STRING. (See STRING website) cite UniProt. (See UniProt website)","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"code-of-conduct","dir":"Articles","previous_headings":"","what":"Code of conduct","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"package, rbioapi, unofficial interface implementation associated, endorsed, officially connected way original databases web services. creators maintainers rbioapi independent entities official relationship databases web services. using rbioapi, remember querying data web services; please considerate. Never flood server requests, need download unreasonably large volumes data, directly downloading databases supplied services may better alternative. see rate-limited server (HTTP 429 Many Requests response status code), know sending requests server interprets normal behavior, please seek methods use Sys.sleep() requests.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"what-next","dir":"Articles","previous_headings":"","what":"What next?","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"supported service dedicated vignette article. Make sure check . Enrichr (Documentation site) JASPAR (Documentation site) miEAA (Documentation site) PANTHER (Documentation site) Reactome (Documentation site) STRING (Documentation site) UniProt (Documentation site) also adding vignette articles focusing tasks workflows: rbioapi: Enrichment (-Representation) Analysis R (documentation site)","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"design-philosophy","dir":"Articles","previous_headings":"","what":"Design philosophy of rbioapi","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"learn design philosophy concepts behind developing rbioapi, please read paper Bioinformatics.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"article rbioapi documentation site Functions references rbioapi documentation site","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] digest_0.6.37 desc_1.4.3 R6_2.5.1 fastmap_1.2.0 #> [5] xfun_0.49 cachem_1.1.0 knitr_1.49 htmltools_0.5.8.1 #> [9] rmarkdown_2.29 lifecycle_1.0.4 cli_3.6.3 sass_0.4.9 #> [13] pkgdown_2.1.1 textshaping_0.4.1 jquerylib_0.1.4 systemfonts_1.1.0 #> [17] compiler_4.4.2 httr_1.4.7 tools_4.4.2 ragg_1.3.3 #> [21] curl_6.0.1 evaluate_1.0.1 bslib_0.8.0 yaml_2.3.10 #> [25] jsonlite_1.8.9 rlang_1.1.4 fs_1.6.5 htmlwidgets_1.6.4"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"how-to-install","dir":"Articles","previous_headings":"","what":"How to install?","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"can install stable release version rbioapi CRAN : However, CRAN version released every 1-2 months, can install recent (development) version GitHub : Now, can load package:","code":"install.packages(\"rbioapi\") install.packages(\"remotes\") remotes::install_github(\"moosa-r/rbioapi\") library(rbioapi)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"what-is-over-representation-analysis","dir":"Articles","previous_headings":"","what":"What is Over-representation analysis?","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"Enrichment (-Representation) analysis commonly performed one’s analysis yields list genes, proteins, entities. delve details refer D. W. Huang et al.: Nucleic Acids Res. 37, 1 (2009) thorough review subject. short, perform analysis, addition algorithms, two data required: gene list derived analysis. Gene sets, genes grouped based shared property concept (pathway, role diseases, physical location, etc.). -representation analysis, can compare gene list find member gene set -represented, meaning present list manner can explained chance alone.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"setting-up-data","dir":"Articles","previous_headings":"","what":"Setting up the data","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"Many web services supported rbioapi provide tools perform -representation analysis gene sets curated databases. Among databases web services currently supported rbioapi, Enrichr, miEAA, PANTHER, Reactome, STRING provide services. service dedicated vignette article rbioapi. focus performing Enrichment (-Representation) analysis. demonstration, use results Galani et al.: Nat. Immunol. 22, 32 (2021) compared gene expression critically ill non-critically ill COVID patients healthy individuals. assign variable 1214 differentially expressed genes (DEGs) exclusively induced critically ill COVID patients. Next, see insights can extract list. Please Note: -representation services return large responses. reduce size vignette article, display first 10 rows Data Frame.","code":"covid_critical <- c(\"TXNDC5\", \"GABRR2\", \"MGAM2\", \"LOC200772\", \"LYPD2\", \"IFI27\", \"RPH3A\", \"OTOF\", \"NBPF8\", \"CLEC4F\", \"CNGB1\", \"HIST1H2BF\", \"HIF1A\", \"SDC1\", \"TUBB8\", \"FBXO39\", \"TPSB2\", \"CD177\", \"LRRN3\", \"EBLN2\", \"PCSK9\", \"ELK2AP\", \"UCHL1\", \"C22orf15\", \"LPO\", \"C3orf20\", \"CLRN1-AS1\", \"GPR75\", \"CA12\", \"RAB19\", \"CHRFAM7A\", \"CRYGN\", \"DLGAP5\", \"BTBD8\", \"LOC100272216\", \"PRG3\", \"CYP46A1\", \"LOC102723604\", \"PPAP2B\", \"C4BPA\", \"SPESP1\", \"LILRP2\", \"UBE2Q1-AS1\", \"MIR3945\", \"NOMO3\", \"MEG3\", \"LOC400927-CSNK1E\", \"MIR6732\", \"MIR590\", \"PPP1R3G\", \"PYCR1\", \"ARHGAP42\", \"MMP8\", \"HMMR\", \"P3H2\", \"ACER1\", \"NOG\", \"RAB39A\", \"ANTXRLP1\", \"LINC00266-3\", \"GPRC5D\", \"MCM10\", \"TSPY26P\", \"ANKRD36BP1\", \"GBP1P1\", \"PRL\", \"CYP1A1\", \"KIF4A\", \"LOC102724323\", \"SERPINB10\", \"GSTA4\", \"TRIM51\", \"MIXL1\", \"RNASE1\", \"CASC8\", \"MAOA\", \"XCL1\", \"ADAMTS2\", \"LOC101929125\", \"DCANP1\", \"BHLHA15\", \"ANOS1\", \"SLC18A1\", \"CCDC150\", \"CAV1\", \"SH3BP5\", \"LINC00398\", \"NCOA2\", \"SPATC1\", \"SHROOM2\", \"GPR27\", \"LRRC26\", \"RNF169\", \"USP3-AS1\", \"VWA7\", \"ROCK2\", \"FSTL4\", \"METTL7B\", \"CYP4F29P\", \"LEF1-AS1\", \"HORMAD2-AS1\", \"FBXO15\", \"PPTC7\", \"TYMS\", \"PPP4R2\", \"ZNF608\", \"FAM46B\", \"PCSK1N\", \"LINC00623\", \"CASC5\", \"ZNF224\", \"DENND2C\", \"WDR86\", \"PTGR1\", \"SPATA3-AS1\", \"LOC101927412\", \"KIF14\", \"MMP28\", \"PBK\", \"VMO1\", \"ADCY3\", \"HIST1H2BO\", \"FTO-IT1\", \"MIR342\", \"FANK1\", \"CRIP2\", \"TIAF1\", \"LOC344887\", \"OLFM4\", \"MKNK1-AS1\", \"ZDHHC19\", \"SEPT14\", \"EPSTI1\", \"FOXC1\", \"MIR616\", \"KRT72\", \"LINC01347\", \"LOC101928100\", \"KIAA0895\", \"BOK\", \"HIST1H2AI\", \"DBH-AS1\", \"ADORA2A-AS1\", \"MED12L\", \"SAMD15\", \"TARM1\", \"SMTNL1\", \"POU5F1P3\", \"LINC00968\", \"OAS3\", \"LOC103091866\", \"SH3RF3-AS1\", \"NBPF10\", \"APAF1\", \"SLC2A14\", \"SYT17\", \"ETV3\", \"SHROOM4\", \"AOAH-IT1\", \"NAIP\", \"ALAS2\", \"GLIS3\", \"ADAM17\", \"OLFM1\", \"PCAT29\", \"TNFRSF18\", \"DNASE1L3\", \"IGF2BP3\", \"LINC01271\", \"AP3B2\", \"TXNDC2\", \"CEP55\", \"SIGLEC1\", \"RAB3IL1\", \"PLD4\", \"KIFC1\", \"LINC00487\", \"ABHD12B\", \"ITGA7\", \"GJB6\", \"CARD14\", \"LRRN2\", \"MPO\", \"KLRC3\", \"LOC100507487\", \"SCGB3A1\", \"CD38\", \"LRRN1\", \"SYCP2L\", \"ANLN\", \"ASPM\", \"OAS1\", \"IFI44L\", \"CDCA3\", \"HLA-DQB2\", \"ANO9\", \"NUDT11\", \"HMP19\", \"DEPDC1\", \"GPR84\", \"PLEKHF1\", \"PI16\", \"RDH5\", \"TMED8\", \"LINC00824\", \"SEPT4\", \"CLIC3\", \"B4GALNT3\", \"OLAH\", \"ITGA1\", \"FOXI1\", \"LOC100506142\", \"CDC20\", \"HAGHL\", \"GTSCR1\", \"B3GALNT1\", \"SOCS3\", \"PCDH1\", \"TAS2R20\", \"CDC25A\", \"NPDC1\", \"LOC100505915\", \"XCL2\", \"TIAM2\", \"LOC100288069\", \"IL34\", \"IL18R1\", \"CYYR1\", \"ZNF888\", \"FAM20A\", \"MDS2\", \"ABCA13\", \"KCNJ1\", \"SLC4A9\", \"EXO1\", \"LAIR2\", \"IQSEC3\", \"SCT\", \"SLC26A8\", \"ESCO2\", \"ZDHHC1\", \"SNORA63\", \"FBLN5\", \"PRUNE2\", \"CPNE7\", \"CDHR2\", \"GNLY\", \"APOBEC3B\", \"MFSD9\", \"SYNGR3\", \"PTGDS\", \"COL17A1\", \"TBC1D14\", \"AIM2\", \"TMEM204\", \"FAM157B\", \"ZBED6\", \"EME1\", \"ATF3\", \"KBTBD4\", \"LUC7L2\", \"KIF20A\", \"LCNL1\", \"DOCK9-AS2\", \"KCNE1\", \"BTN2A3P\", \"KL\", \"IDI2-AS1\", \"EBF4\", \"SCARNA21\", \"CEACAM6\", \"KLRB1\", \"C5orf58\", \"ASXL2\", \"RPLP0P2\", \"CYTL1\", \"DIAPH3\", \"DOK7\", \"RFFL\", \"KIAA1107\", \"TAS2R40\", \"CCDC186\", \"COL6A2\", \"METRN\", \"SNHG25\", \"RRM2\", \"CYP1B1\", \"NEURL1\", \"MATK\", \"SLC28A3\", \"JCHAIN\", \"TNFRSF4\", \"FXYD1\", \"PLLP\", \"ARHGAP23\", \"SNORA4\", \"MYO18A\", \"ZNF429\", \"NRN1\", \"HJURP\", \"TCN1\", \"CDC6\", \"ATP5EP2\", \"SOAT2\", \"LOC101928034\", \"EIF2AK2\", \"ARG1\", \"SLC16A11\", \"TPPP3\", \"TMEM38A\", \"TOP2A\", \"LINC00999\", \"DGCR9\", \"RCAN3AS\", \"CACNG6\", \"LINC01550\", \"TDRD9\", \"CARD17\", \"GBP6\", \"LY6E\", \"RSAD2\", \"LOC100506258\", \"PRKAR2A\", \"LTF\", \"IGLL5\", \"FAM157A\", \"LOC101927018\", \"CCR7\", \"FLJ42351\", \"IFIT3\", \"GPRIN1\", \"ANXA9\", \"TMEM119\", \"PARGP1\", \"A3GALT2\", \"CYP4F22\", \"PLBD1-AS1\", \"SELM\", \"NCR3\", \"PNPLA1\", \"BMX\", \"LOC440461\", \"GAMT\", \"CEACAM8\", \"TP53I13\", \"C1orf226\", \"SKA3\", \"DHRS3\", \"VRK2\", \"BTBD19\", \"ETNK2\", \"LOC728323\", \"NRIR\", \"ADORA2A\", \"GPR162\", \"CMPK2\", \"USP18\", \"P4HA2\", \"TSSK4\", \"EP300\", \"CLEC4D\", \"LCN10\", \"GPR141\", \"SH2D2A\", \"GOLGA7B\", \"TMIGD2\", \"DLL4\", \"HP\", \"CXCR6\", \"MAL\", \"C12orf57\", \"CLIC5\", \"IL4\", \"IGFBP6\", \"ERG\", \"HERC3\", \"KEL\", \"MSX2P1\", \"INE1\", \"PRKCQ-AS1\", \"FHIT\", \"SLC1A7\", \"KIAA1958\", \"SARDH\", \"PFKFB3\", \"SNORD89\", \"IFI44\", \"DDX60\", \"TMEM238\", \"HAR1A\", \"EGR1\", \"VNN1\", \"TRIM9\", \"TAF13\", \"AP3S2\", \"TMEM56\", \"KLRC2\", \"CACNA1C-AS2\", \"ALX3\", \"FCGBP\", \"CD247\", \"ALDH1L2\", \"HIST1H2AC\", \"RTP5\", \"PPARG\", \"AMPH\", \"LINC00861\", \"CDKL5\", \"MYBL2\", \"LOC101927051\", \"TLR5\", \"TMEM121\", \"BMP8B\", \"AK5\", \"RBP5\", \"LINC01355\", \"PITRM1-AS1\", \"CMTM1\", \"BIRC5\", \"C10orf10\", \"TNFRSF25\", \"ZAP70\", \"LOC105373383\", \"DSP\", \"WDR86-AS1\", \"RPLP2\", \"KREMEN1\", \"LOC101927550\", \"PDZD4\", \"LOC100130451\", \"MKI67\", \"LOC728743\", \"CXCL10\", \"LINC01547\", \"LOC645513\", \"ATOH8\", \"S1PR5\", \"KISS1R\", \"MELK\", \"TCEA3\", \"SLC22A20\", \"RAMP1\", \"FOLR2\", \"GGT6\", \"CACNA1E\", \"FABP6\", \"RAP2C-AS1\", \"PRRG4\", \"FAM63B\", \"BLK\", \"P3H3\", \"WIPF2\", \"TROAP\", \"FAHD2CP\", \"CA6\", \"LINC00892\", \"LRCH3\", \"BUB1B\", \"LOC100996286\", \"NT5E\", \"PASK\", \"BATF2\", \"TTC39C-AS1\", \"ACTA2\", \"CHIT1\", \"LAMC1\", \"TNFAIP3\", \"ANKRD22\", \"C12orf42\", \"SPON2\", \"SLX4IP\", \"TNNC1\", \"ZNF771\", \"SPEG\", \"HIST1H4H\", \"HTR6\", \"TNFRSF17\", \"FSD1\", \"LINC00266-1\", \"CD6\", \"PRSS30P\", \"SFTPD\", \"COPZ2\", \"BPI\", \"CCIN\", \"CDK1\", \"ATP2C2\", \"GOLGA8H\", \"USP44\", \"SLC14A1\", \"ZDHHC14\", \"SNORD50A\", \"LTK\", \"KCNG2\", \"MAPK11\", \"ACOT4\", \"CTSW\", \"C1orf106\", \"CDKN3\", \"UPB1\", \"CAMK2N1\", \"RBM5-AS1\", \"DNLZ\", \"GZMM\", \"PLA2G7\", \"ZCCHC2\", \"PRSS41\", \"RPL13\", \"OLR1\", \"BCAS4\", \"EPB41\", \"TRABD2A\", \"PBX4\", \"GZMK\", \"PNPLA7\", \"B4GALT5\", \"ARHGEF17\", \"APOA1\", \"GPA33\", \"KLRG1\", \"GBP5\", \"LOC102723701\", \"CENPA\", \"LOC285696\", \"KCNK5\", \"SUSD4\", \"RPS28\", \"ESPL1\", \"ITGB4\", \"SPAG16\", \"CYP4F35P\", \"CD3D\", \"BMS1P20\", \"CBS\", \"ETV2\", \"SPATS2L\", \"DUSP13\", \"FAM19A1\", \"VSIG10L\", \"CD2\", \"NHSL2\", \"FAAH2\", \"FXYD7\", \"NTN5\", \"FICD\", \"GLDC\", \"LOC101927865\", \"LINC00944\", \"PTPRCAP\", \"GNB3\", \"TRIM22\", \"PRRT1\", \"NR1I3\", \"BTN3A1\", \"STX16-NPEPL1\", \"TMEM191A\", \"SERPINB2\", \"UST\", \"GALNT12\", \"BUB1\", \"GTF2I\", \"FOSL2\", \"COL13A1\", \"RGS9\", \"NCALD\", \"DNAH10\", \"CA11\", \"CKB\", \"HSPB1\", \"CDC45\", \"ATP7B\", \"WNT5B\", \"ZNF699\", \"PRRT4\", \"GALNT14\", \"ZNF319\", \"DNAH17\", \"LOC283710\", \"CPEB4\", \"LY6G6C\", \"PPAN\", \"WASH5P\", \"HIST1H3H\", \"IL32\", \"TEPP\", \"CNR1\", \"YJEFN3\", \"FAM159A\", \"FGFBP2\", \"FKBP5\", \"BIN1\", \"VPREB3\", \"E2F8\", \"HK3\", \"CDH2\", \"HFE\", \"BEAN1-AS1\", \"KIFC3\", \"HELB\", \"HLA-DPB1\", \"GZMH\", \"LMNB1\", \"CC2D2A\", \"IQCH-AS1\", \"CTSF\", \"TMEM132D\", \"LEF1\", \"REL\", \"CBR3\", \"WNT10B\", \"LOC100289473\", \"APBA2\", \"KIF23\", \"LOC646471\", \"PNMA6A\", \"EPC2\", \"HBEGF\", \"S100B\", \"C14orf132\", \"KCND1\", \"SIPA1L2\", \"NCAPG\", \"OAS2\", \"C3AR1\", \"CSF1\", \"CHCHD6\", \"AUTS2\", \"IL24\", \"CDC42EP2\", \"LTBP3\", \"PXT1\", \"ADAMTS10\", \"BLZF1\", \"TPST1\", \"ID3\", \"GYG1\", \"EFCAB2\", \"MYO10\", \"TLE2\", \"SLC30A1\", \"CCNI\", \"WNT7A\", \"RBL2\", \"ERICH6-AS1\", \"IGFBP3\", \"DTL\", \"SORBS3\", \"RPS19\", \"SMA4\", \"RPS27\", \"BEAN1\", \"MIRLET7BHG\", \"ABCA1\", \"ZKSCAN7\", \"GPR34\", \"GPR153\", \"TRIM52\", \"GRASP\", \"RNASE2\", \"CENPF\", \"ACTG1P20\", \"MMP9\", \"ZFP82\", \"RTN1\", \"RPS21\", \"PCBP1-AS1\", \"PVRL3\", \"RPS10\", \"FER1L4\", \"SEPT1\", \"DEPDC1B\", \"LINC00926\", \"SEC14L2\", \"LOC100420587\", \"PCSK4\", \"HPS3\", \"KIR3DL1\", \"SPRN\", \"HRH2\", \"FAHD2B\", \"P3H4\", \"TMEM160\", \"ENGASE\", \"RAD51AP1\", \"ZNF233\", \"RAP1GAP\", \"TTBK2\", \"PINK1\", \"SH2D1B\", \"BAIAP2L1\", \"BECN1\", \"RPL13A\", \"INHBB\", \"HPCAL4\", \"TPM2\", \"ACVR2B\", \"CEP126\", \"RPL18\", \"B3GNT7\", \"ROBO3\", \"MYOM2\", \"SLC51A\", \"CCL5\", \"PROSER3\", \"RPL18A\", \"SERINC4\", \"ATP11B\", \"SMARCD3\", \"STMN3\", \"FAM173A\", \"CDK5RAP2\", \"GGH\", \"EIF4G3\", \"C18orf32\", \"SHCBP1\", \"CCM2L\", \"LAT\", \"PRF1\", \"ARL15\", \"WHAMMP1\", \"NBN\", \"ARHGEF11\", \"ZWINT\", \"BTBD11\", \"MCOLN2\", \"EYS\", \"GRAP\", \"TAP1\", \"FAM157C\", \"ANXA3\", \"MCEMP1\", \"TCF7\", \"IGSF9B\", \"SDSL\", \"LNPEP\", \"NSUN5P1\", \"FAM110B\", \"SPNS3\", \"ACTL10\", \"GCSAM\", \"LOC101927482\", \"UGCG\", \"CD24\", \"SCO2\", \"GMCL1\", \"SAMD12\", \"NUSAP1\", \"WNT1\", \"NME3\", \"LOC728084\", \"RGS18\", \"PNMA3\", \"KLRF1\", \"ENO2\", \"SUPT3H\", \"ATP5D\", \"ZC3H13\", \"PSTPIP2\", \"SNORD81\", \"SESN2\", \"TK1\", \"LHFPL2\", \"SCARNA10\", \"SERPING1\", \"SYT2\", \"SNORA33\", \"JAK2\", \"CYB5D1\", \"SH3RF3\", \"ARL14EP\", \"UBASH3A\", \"ARL5B\", \"SPRED2\", \"NELL2\", \"PPP2R2B\", \"CDH12\", \"WDR54\", \"KLF4\", \"MTUS1\", \"ELF1\", \"CARNS1\", \"CLEC10A\", \"CD3E\", \"TTK\", \"KBTBD7\", \"TPX2\", \"ZNF69\", \"AICDA\", \"TAMM41\", \"LOC100288152\", \"AK1\", \"MMP24\", \"SAMD9L\", \"RAD51\", \"ACE\", \"COLGALT2\", \"NEDD4\", \"SPEF2\", \"CENPE\", \"CRISPLD2\", \"TSEN54\", \"RCVRN\", \"FRMD3\", \"SKAP1\", \"CYP4F3\", \"TMEM161B-AS1\", \"KANSL1L\", \"SLC29A2\", \"CEP97\", \"XAF1\", \"CDKN1C\", \"PRDM5\", \"HBP1\", \"CACNG8\", \"RP2\", \"OASL\", \"NPIPA1\", \"ZNF354A\", \"RPL32\", \"GLTSCR2\", \"CD52\", \"SBK1\", \"ZNF703\", \"GBP1\", \"C4orf29\", \"ERV3-1\", \"ABCC2\", \"EPB41L5\", \"FFAR3\", \"PLEKHB1\", \"LOC100507387\", \"RPL36\", \"PRC1\", \"C19orf60\", \"PRSS23\", \"CD160\", \"HOPX\", \"SAMD10\", \"RPSAP9\", \"CDCA2\", \"SWT1\", \"NPEPL1\", \"RORC\", \"MS4A3\", \"BCL2L15\", \"CXCR5\", \"EPHX2\", \"B3GNT9\", \"CDCA7L\", \"LMTK2\", \"UBAP1L\", \"CD79B\", \"OBSCN\", \"TMEM102\", \"ZNF540\", \"SPP1\", \"HABP4\", \"LOC100130872\", \"APBB1\", \"GPC2\", \"CD1C\", \"LONRF3\", \"NR2C2\", \"NSUN7\", \"SIGIRR\", \"SNORD38B\", \"FAM65C\", \"HELZ2\", \"ARL4D\", \"ENO3\", \"RPL9\", \"IFT81\", \"LSMEM2\", \"SCARNA2\", \"CD5\", \"AHNAK2\", \"RPL27A\", \"SOX8\", \"TMEM161A\", \"ZNF81\", \"PXK\", \"LOC441081\", \"RPS26\", \"CCNB1\", \"PLXDC1\", \"NFKBIA\", \"PKMYT1\", \"SLC27A5\", \"LRRC4\", \"TARP\", \"MAP2K6\", \"EIF1B-AS1\", \"SCARNA17\", \"NUDT8\", \"EAF1\", \"TBC1D8\", \"SESTD1\", \"CLEC12B\", \"ZNF776\", \"PDCD1\", \"FBXL16\", \"SLFN14\", \"ATP8B3\", \"ZNF396\", \"STOM\", \"CCDC30\", \"FAM86FP\", \"FAM129C\", \"TMEM42\", \"ZNF607\", \"IL11RA\", \"ECHDC2\", \"CCNE2\", \"PUS7L\", \"EFCAB12\", \"TGFA\", \"MAPK14\", \"NSG1\", \"C9orf142\", \"KLHL15\", \"LOC102723766\", \"VEGFB\", \"TJP3\", \"YAE1D1\", \"PROS1\", \"CSGALNACT2\", \"HLA-DOA\", \"TUBBP5\", \"RPL37A\", \"FAM195A\", \"LTB4R2\", \"NCAPH\", \"EVL\", \"CR1\", \"LTC4S\", \"ANKS3\", \"RPL35\", \"GLIS2\", \"TRAPPC6A\", \"LIPN\", \"RPS12\", \"RPL38\", \"LIME1\", \"PHGDH\", \"C4orf48\", \"SLED1\", \"BACH2\", \"EVA1C\", \"GATA3\", \"SLC25A38\", \"USP32\", \"RPL39\", \"EGR2\", \"USP35\", \"ZNF662\", \"PLEKHG1\", \"CRTAM\", \"AANAT\", \"OPLAH\", \"FBXO6\", \"LOXL1\", \"LOC101928786\", \"FRMD4B\", \"IL1R1\", \"ADM2\", \"DNASE1L1\", \"STAT4\", \"RPLP1\", \"TTC9\", \"BEND7\", \"F8\", \"FOSB\", \"SLAMF6\", \"STK17B\", \"PVT1\", \"ARVCF\", \"APOBEC3C\", \"CDK14\", \"RPS14\", \"POLQ\", \"CDC42BPG\", \"CCDC85B\", \"UBR5-AS1\", \"TNNT3\", \"TCL1A\", \"IL7R\", \"PTX3\", \"KLHL14\", \"MTRNR2L1\", \"ZBTB46\", \"RPL34\", \"VPS9D1-AS1\", \"KLF7\", \"RPL10A\", \"SLC2A11\", \"ACTN4\", \"RPSA\", \"SGK223\", \"PLSCR1\", \"SBF2\", \"LINC01420\", \"CDCA5\", \"F5\", \"ADGRB2\", \"RPL23A\", \"MAN1A2\", \"LLGL2\", \"GINS2\", \"NUDT14\", \"TG\", \"RSRC1\", \"TMEM256\", \"SYTL2\", \"TYSND1\", \"TPGS1\", \"ABHD14B\", \"LSM7\", \"ZNF281\", \"CEMP1\", \"M1AP\", \"CD82\", \"LOC101928150\", \"MRPL41\", \"IFIH1\", \"CCNB2\", \"IFITM10\", \"RPS3A\", \"TMEM8B\", \"CEP135\", \"SIRPB2\", \"IRS2\", \"SYCE1L\", \"SULT1B1\", \"ADAM9\", \"ZCCHC18\", \"DDIAS\", \"LINC01278\", \"MTHFD2\", \"TIGIT\", \"FUOM\", \"FOSL1\", \"RPS16\", \"BRAF\", \"CACNA1I\", \"EXT1\", \"GPR82\", \"LRRC45\", \"STAG1\", \"KIF11\", \"NCAM1\", \"RNF24\", \"KIAA2018\", \"SAMD9\", \"ABCA2\", \"PVRIG\", \"RASGRF2\", \"IRAK2\", \"ARHGEF4\", \"ZNF682\", \"RASSF7\", \"THAP7\", \"KIF1B\", \"GAS5\", \"KIF15\", \"RMRP\", \"GALM\", \"LYNX1\", \"C7orf50\", \"ATXN1L\", \"KCNN4\", \"LDLRAP1\", \"RETSAT\", \"RNF10\", \"NOXA1\", \"UBXN7\", \"UHRF1BP1L\", \"TESPA1\", \"MB21D1\", \"LINC00116\", \"FOXM1\", \"CCR6\", \"NMUR1\", \"RPL22\", \"LCK\", \"MEGF9\", \"CLSPN\", \"MIR4697HG\", \"PPP1R15A\", \"ADCK5\", \"SAMD3\", \"RPS27A\", \"TPPP\", \"PIWIL4\", \"ANKRD33B\", \"IL18RAP\", \"SNRPD2\", \"WASF1\", \"ALDH5A1\", \"FAM149B1\", \"RPS18\", \"SLCO4C1\", \"MGC16275\", \"ZNF837\", \"SAMHD1\", \"NSMF\", \"PDIA6\", \"SNX20\", \"ATF7IP2\", \"BPHL\", \"RPL35A\", \"NFKBIZ\", \"LMF1\", \"MGMT\", \"PPL\", \"FAM120C\", \"APRT\", \"RANGRF\", \"PHLDB3\", \"IDNK\", \"RPS15\", \"LGR6\", \"MOB1A\", \"CREB5\", \"THEM4\", \"ENDOG\", \"RPL7\", \"EDN1\", \"ZNF808\", \"SNHG15\", \"RPL3\", \"SMCR8\", \"FCMR\", \"ZNF449\", \"ZBTB37\", \"NHLRC4\", \"DHRS9\", \"C1QTNF3\", \"MS4A1\", \"AFF2\", \"FBXO32\", \"SLC6A6\", \"ZSCAN30\", \"CHPT1\", \"PARP14\", \"MZT2B\", \"FLT3LG\", \"TCTN2\", \"MAN1A1\", \"LOC728175\", \"ALOX5\", \"DUSP18\", \"ZC3H12D\", \"PECR\", \"LRRC37A3\", \"EPB41L4A-AS1\", \"SPAG5\", \"KDM7A\", \"DDX31\", \"NCOA6\", \"SLC6A12\", \"FCER1A\", \"FBXL13\", \"AKR7A2\", \"PRR5\", \"PRKCE\", \"PPP1R3D\", \"SYNM\", \"GLI1\", \"NTNG2\", \"EEF1G\", \"LOC643802\", \"MAGEE1\", \"PIK3AP1\", \"RPS8\", \"SNHG19\", \"C19orf70\", \"GAS7\", \"PHF12\", \"ATP11A\", \"SLC22A23\", \"ATP6V0E2\", \"UCKL1-AS1\", \"TIPARP\", \"BEX2\", \"FAM102A\", \"RPS20\", \"TTC16\", \"PLP2\", \"HAPLN3\", \"C19orf24\", \"ZNF397\", \"FOXO4\", \"TRAPPC2B\", \"QTRT1\", \"CDK10\", \"PDZD8\", \"GIPC1\", \"CD274\", \"C9orf139\", \"SPIB\", \"KLHDC7B\", \"ZNF32\", \"ELMO2\", \"AK4\", \"SAMD4B\", \"MFSD3\", \"EXD3\", \"SLC37A3\", \"RPL8\", \"TRIM56\", \"NMB\", \"PIPOX\", \"PXN-AS1\", \"SLC2A5\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"enrichr","dir":"Articles","previous_headings":"","what":"Enrichr","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"Enrichr , developed Ma’ayan Lab, service perform enrichment analysis considerable number curated gene set libraries across various species. thoroughly covered performing enrichment analysis Enrichr vignette article Enrichr & rbioapi. Therefore, provide brief demonstration . First, let us retrieve list available libraries Enrichr using rba_enrichr_libs() function. can find available Enrichr libraries libraryName column returned data frame. required argument rba_enrichr() function gene_list, use gene_set_library argument request enrichment analysis “KEGG_2021_Human” library. gene_set_library parameter, can also provide multiple gene set libraries leave default parameter NULL perform enrichment analysis using every gene set library available Enrichr. Also note regex_library_name parameter TRUE (default value), gene_set_library parameter considered regex pattern, partial matchs also selected. can see , one library selected, results list elements enrichment results one library: also possible provide background gene list Enrichr analysis. feature supported organism set “human”.","code":"enrichr_libs <- rba_enrichr_libs(organism = \"human\") #> Retrieving List of available libraries and statistics from Enrichr human. enrichr_enrich <- rba_enrichr(gene_list = covid_critical, organism = \"human\", gene_set_library = \"KEGG_2021_Human\") #> --Step 1/3: #> Retrieving List of available libraries and statistics from Enrichr human. #> --Step 2/3: #> Uploading 1214 gene symbols to Enrichr human. #> --Step 3/3: #> Performing enrichment analysis on gene-list 86963009 against Enrichr human library: KEGG_2021_Human. enrichr_enrich_kegg <- rba_enrichr(gene_list = covid_critical, gene_set_library = \"kegg\", regex_library_name = TRUE # default value ) #> --Step 1/3: #> Retrieving List of available libraries and statistics from Enrichr human. #> --Step 2/3: #> Uploading 1214 gene symbols to Enrichr human. #> --Step 3/3: #> Performing enrichment analysis on gene-list 86963010 using multiple Enrichr human libraries. #> Note: You have selected '6' Enrichr human libraries. Note that for each library, a separate call should be sent to Enrichr server. Thus, this could take a while depending on the number of selected libraries and your network connection. #> | | | 0% | |============ | 17% | |======================= | 33% | |=================================== | 50% | |=============================================== | 67% | |========================================================== | 83% | |======================================================================| 100% str(enrichr_enrich_kegg, max.level = 1) #> List of 6 #> $ KEGG_2013 :'data.frame': 139 obs. of 9 variables: #> $ KEGG_2015 :'data.frame': 131 obs. of 9 variables: #> $ KEGG_2016 :'data.frame': 260 obs. of 9 variables: #> $ KEGG_2019_Human:'data.frame': 272 obs. of 9 variables: #> $ KEGG_2019_Mouse:'data.frame': 267 obs. of 9 variables: #> $ KEGG_2021_Human:'data.frame': 285 obs. of 9 variables:"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"reactome-analysis-services","dir":"Articles","previous_headings":"","what":"Reactome Analysis services","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"Reactome curates extensive top-quality cellular pathways data across various species. Given fact proteins operate organized units, pathways, analyzing list Reactome pathways gene sets can provide valuable insights functional trajectories results. can refer Reactome & rbioapi article -depth coverage Reactome services. demonstrate -representation functionality function rba_reactome_analysis() accepts gene lists table input. table supplied, first column consist identifiers, next column numerical gene expression values. Refer rba_reactome_analysis() function’s manual details. , use gene list critical COVID: Let us examine response’s structure: list’s element names self-explanatory. results returned data frame pathways element. Note Reactome map provided gene identifiers identifiers may found. Hence, keep eye identifiersNotFound element. Naturally, can alter analysis parameters using rba_reactome_analysis() function’s arguments. used parameters returned “summary” element. code chunk, note “token” associated analysis. can use token perform following. Retrieve analysis results: addition main response, can download data associated request. see argument request rba_reactome_analysis_download() function’s manual information. , download CSV file input identifiers found: Reactome also generates nice report analysis pdf format, make sure try :","code":"reactome <- rba_reactome_analysis(input = covid_critical) #> Retrieving Reactome Analysis Results of your supplied Identifiers. str(reactome, max.level = 1) #> List of 8 #> $ summary :List of 7 #> $ expression :List of 1 #> $ identifiersNotFound: int 560 #> $ pathwaysFound : int 1535 #> $ pathways :'data.frame': 1535 obs. of 19 variables: #> $ resourceSummary :'data.frame': 4 obs. of 3 variables: #> $ speciesSummary :'data.frame': 1 obs. of 5 variables: #> $ warnings : list() str(reactome$summary) #> List of 7 #> $ token : chr \"MjAyNDEyMDkxNzUwNTFfMjc%3D\" #> $ projection : logi TRUE #> $ interactors : logi FALSE #> $ type : chr \"OVERREPRESENTATION\" #> $ sampleName : chr \"Gene names\" #> $ text : logi TRUE #> $ includeDisease: logi TRUE reactome_2 <- rba_reactome_analysis_token(reactome$summary$token) rba_reactome_analysis_download(token = reactome$summary$token, request = \"not_found_ids\", save_to = \"my_analysis.csv\") rba_reactome_analysis_pdf(token = reactome$summary$token, species = 9606, #Homo sapiens save_to = \"my_analysis.pdf\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"panther","dir":"Articles","previous_headings":"","what":"PANTHER","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"PANTHER (protein analysis evolutionary relationships) project provides classification systems genes proteins. PANTHER also provides enrichment service. fact, enrichment tool available Gene Ontology (GO) website powered PANTHER. Just like previous sections, review enrichment functionality ; -depth review PANTHER refer vignette article “PANTHER & rbioapi”. perform analysis, first, need choose annotation datasets (.e. collection gene sets) want compare results . retrieve list available annotation datasets, call following function: Note enter “id” datasets, label. example, entering “biological_process” incorrect, rather use “GO:0008150”. , demonstrate enrichment analysis using Biological Process annotations. Gene Ontology (GO) project one pinnacles scientists’ collective effort bioinformatics. GO Consortium provides comprehensive model biological systems. short, GO curates thoroughly designed directed acyclic graph (DAG) ontologies. may think tree terms, branches , terms become specific). protein may annotated one terms. terms organized three domains: “Molecular Function,” “Biological Process,” “Cellular Component”. GO slim datasets refer subsets cut-version GO terms. familiar GO, strongly encourage see page follow links provides: GO resource. Depending provided input, PANTHER conduct two types analysis: character vector supplied, -representation analysis performed using either Fisher’s exact binomial test. data frame gene identifiers corresponding expression values supplied, statistical enrichment test performed using Mann-Whitney U (Wilcoxon Rank-Sum) test. rbioapi determines proper analysis based class genes parameter. Please refer details section rba_panther_enrich() function manual rbioapi & PANTHER vignette article information. , demonstrate using gene list, without expression values: addition results table, PANTHER returns useful information analysis. names self-explanatory: analysis results returned Data Frame element named result:","code":"panther_sets <- rba_panther_info(what = \"datasets\") #> Retrieving available annotation datasets. panther_enrich <- rba_panther_enrich(genes = covid_critical, organism = 9606, #Homo sapiens annot_dataset = \"GO:0008150\" #Biological Process ) #> Performing PANTHER over-representation analysis (Fisher's exact test) on 1214 genes from `organism 9606` against `GO:0008150` datasets. str(panther_enrich, 2) #> List of 9 #> $ reference :List of 3 #> ..$ organism : chr \"Homo sapiens\" #> ..$ mapped_count : int 20580 #> ..$ unmapped_count: int 0 #> $ input_list :List of 5 #> ..$ organism : chr \"Homo sapiens\" #> ..$ mapped_count : int 1040 #> ..$ mapped_id : chr [1:1040] \"SCT\" \"C4BPA\" \"FAM159A\" \"TSEN54\" ... #> ..$ unmapped_count: int 174 #> ..$ unmapped_id : chr [1:174] \"LOC200772\" \"ELK2AP\" \"CLRN1-AS1\" \"LOC100272216\" ... #> $ result :'data.frame': 15029 obs. of 9 variables: #> ..$ number_in_list : int [1:15029] 38 108 104 136 195 77 295 143 129 129 ... #> ..$ fold_enrichment : num [1:15029] 5.57 2.04 2 1.79 1.59 ... #> ..$ fdr : num [1:15029] 1.86e-14 1.04e-08 6.92e-08 5.89e-08 6.17e-08 ... #> ..$ expected : num [1:15029] 6.82 52.94 52.06 75.84 122.53 ... #> ..$ number_in_reference: int [1:15029] 132 1024 1007 1467 2370 677 4070 1620 1420 1423 ... #> ..$ pValue : num [1:15029] 1.24e-18 1.38e-12 1.38e-11 1.57e-11 2.05e-11 ... #> ..$ plus_minus : chr [1:15029] \"+\" \"+\" \"+\" \"+\" ... #> ..$ term.id : chr [1:15029] \"GO:0002181\" \"GO:0002684\" \"GO:0050776\" \"GO:0009607\" ... #> ..$ term.label : chr [1:15029] \"cytoplasmic translation\" \"positive regulation of immune system process\" \"regulation of immune response\" \"response to biotic stimulus\" ... #> $ search :List of 1 #> ..$ search_type: chr \"overrepresentation\" #> $ tool_release_date : int 20240807 #> $ enrichment_test_type : chr \"FISHER\" #> $ annotDataSet : chr \"GO:0008150\" #> $ annot_version_release_date: chr \"GO Ontology database DOI: 10.5281/zenodo.14083199 Released 2024-11-03\" #> $ correction : chr \"FDR\""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"string","dir":"Articles","previous_headings":"","what":"STRING","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"addition proteins interaction data, STRING also curates proteins/genes annotations provides enrichment analysis services. can perform analysis multiple gene sets. gene sets can accessed using services two gene sets exclusive STRING. See “D. Szklarczyk et al.: Nucleic Acids Res. 49, D1 (2021)” information. . review enrichment functionality ; -depth review STRING refer vignette article “STRING & rbioapi”. Gene sets exclusively STRING: Reference Publications (PubMed) Hierarchical clustering STRING network Gene sets also available services: Gene Ontology domains: Molecular Function, Biological Process, Cellular Component COMPARTMENTS Human Disease Ontology InterPro KEG1G pathways UniProt keyword Pfam Reactome pathways BRENDA Tissue Enzyme Source Ontology SMART can directly supply covid_critical variable STRING’s enrichment function: can see, default list returned element data Frame enrichment analysis results one gene sets listed : “PMID” element, see PubMed papers -represented gene list. keep table tidy, displaying inputGenes preferredNames columns. can retrieve annotations associated input protein(s). difference statistical analysis performed full annotations input gene returned. potentially unwieldy response, allow_pubmed set fo FALSE default. set TRUE also retrieve PubMed paper abstracts include gene. can see, input gene large number annotations. Let us take look PMID Data Frame, contains PubMed Abstract paper terms: addition data frame, can also get plot summarizing enrichment results. API endpoint supports extensive customization plot; please refer rba_string_enrichment_image() function’s manual detailed instructions. perform enrichment analysis KEGG database, retrieve plot results. Visualization enrichment analysis results","code":"string_enrich <- rba_string_enrichment(ids = covid_critical, species = 9606 #Homo sapiens ) #> Performing functional enrichment of 1214 Input Identifiers. str(string_enrich, max.level = 1) #> List of 13 #> $ COMPARTMENTS :'data.frame': 18 obs. of 10 variables: #> $ Component :'data.frame': 19 obs. of 10 variables: #> $ DISEASES :'data.frame': 10 obs. of 10 variables: #> $ Function :'data.frame': 1 obs. of 10 variables: #> $ HPO :'data.frame': 3 obs. of 10 variables: #> $ KEGG :'data.frame': 6 obs. of 10 variables: #> $ Keyword :'data.frame': 18 obs. of 10 variables: #> $ NetworkNeighborAL:'data.frame': 46 obs. of 10 variables: #> $ PMID :'data.frame': 100 obs. of 10 variables: #> $ Process :'data.frame': 77 obs. of 10 variables: #> $ RCTM :'data.frame': 49 obs. of 10 variables: #> $ TISSUES :'data.frame': 14 obs. of 10 variables: #> $ WikiPathways :'data.frame': 3 obs. of 10 variables: string_annot <- rba_string_annotations(ids = \"CD177\", species = 9606, #Homo sapiens allow_pubmed = TRUE ) #> Retrieving functional annotations of 1 Input Identifiers. str(string_annot, max.level = 1) #> List of 13 #> $ COMPARTMENTS :'data.frame': 31 obs. of 8 variables: #> $ Component :'data.frame': 43 obs. of 8 variables: #> $ DISEASES :'data.frame': 6 obs. of 8 variables: #> $ Function :'data.frame': 9 obs. of 8 variables: #> $ HPO :'data.frame': 8 obs. of 8 variables: #> $ InterPro :'data.frame': 2 obs. of 8 variables: #> $ Keyword :'data.frame': 13 obs. of 8 variables: #> $ NetworkNeighborAL:'data.frame': 5 obs. of 8 variables: #> $ Pfam :'data.frame': 1 obs. of 8 variables: #> $ PMID :'data.frame': 2453 obs. of 8 variables: #> $ Process :'data.frame': 92 obs. of 8 variables: #> $ RCTM :'data.frame': 7 obs. of 8 variables: #> $ TISSUES :'data.frame': 13 obs. of 8 variables: graph_3 <- rba_string_enrichment_image(ids = covid_critical, species = 9606, category = \"KEGG\", image_format = \"image\", save_image = FALSE, group_by_similarity = 0.6)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"mieaa","dir":"Articles","previous_headings":"","what":"miEAA","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"miRNA Enrichment Analysis Annotation Tool (miEAA) service provided Chair Clinical Bioinformatics Saarland University. makes miEAA unique among services presented miEAA curates miRNA sets. Hence can directly perform miRNA enrichment analysis across various species services miEAA provides. -depth covered performing enrichment analysis miEAA vignette article “miEEA & rbioapii”. Therefore, provide brief demonstration . can use covid_critical gene list . rather use miRNA list paper “. Parray et al.: Vaccines 9, 1056 (2021)”. used microarray find differentially expressed miRNA severe versus mild COVID 19 patients’ blood. necessary, can first see enrichment categories available mature human miRNA: Next, use wrapper function available perform necessary steps one function call. Note supplied categories parameter. left NULL, enrichment performed every available category.","code":"covid_mirna <- c(\"hsa-miR-3609\", \"hsa-miR-199a-5p\", \"hsa-miR-139-5p\", \"hsa-miR-145-5p\",\"hsa-miR-3651\", \"hsa-miR-1273h-3p\", \"hsa-miR-4632-5p\",\"hsa-miR-6861-5p\", \"hsa-miR-6802-5p\",\"hsa-miR-5196-5p\",\"hsa-miR-92b-5p\", \"hsa-miR-6805-5p\",\"hsa-miR-98-5p\",\"hsa-miR-3185\", \"hsa-miR-572\",\"hsa-miR-371b-5p\",\"hsa-miR-3180\", \"hsa-miR-8073\",\"hsa-miR-4750-5p\",\"hsa-miR-6075\", \"hsa-let-7i-5p\",\"hsa-miR-1231\",\"hsa-miR-885-3p\") rba_mieaa_cats(mirna_type = \"mature\", species = 9606 #Homo sapiens ) #> Retrieving available enrichment categories of miRNA for Homo sapiens. #> Annotations derived over miRTarBase (Gene Ontology) #> \"GO_Annotations_indirect_mature\" #> Annotation (Gene Ontology) #> \"GO_Annotations_mature\" #> Pathways (KEGG) #> \"KEGG_mature\" #> exRNA forms (miRandola) #> \"miRandola_mature\" #> Chromosomal location (miRBase) #> \"miRBase_Chromosomes_mature\" #> Conservation (miRBase) #> \"miRBase_Conserved_miRNAs_5_organisms_mature\" #> Confidence (miRBase) #> \"miRBase_High_confidence_mature\" #> Seed family (miRBase) #> \"miRBase_Seed_family_mature\" #> GO Biological process (miRPathDB) #> \"miRPathDB_GO_Biological_process_mature\" #> GO Cellular component (miRPathDB) #> \"miRPathDB_GO_Cellular_component_mature\" #> GO Molecular function (miRPathDB) #> \"miRPathDB_GO_Molecular_function_mature\" #> KEGG (miRPathDB) #> \"miRPathDB_KEGG_mature\" #> Reactome (miRPathDB) #> \"miRPathDB_Reactome_mature\" #> WikiPathways (miRPathDB) #> \"miRPathDB_WikiPathways_mature\" #> Target genes (miRTarBase) #> \"miRTarBase_mature\" #> Diseases (miRWalk) #> \"miRWalk_Diseases_mature\" #> Gene Ontology (miRWalk) #> \"miRWalk_GO_mature\" #> Organs (miRWalk) #> \"miRWalk_Organs_mature\" #> Pathways (miRWalk) #> \"miRWalk_Pathways_mature\" #> Diseases (MNDR) #> \"MNDR_mature\" #> Interactions (NPInter) #> \"NPInter_mature\" #> Gender/Age #> \"Published_Age_gender_mature\" #> Cell-type specific (Atlas) #> \"Published_cell_specific_mature\" #> Cell-type specific (Cellular microRNAome) #> \"miRNAome_mature\" #> Published Diseases #> \"Published_Diseases_mature\" #> Immune cells #> \"Published_Immune_cells_mature\" #> Localization (RNALocate) #> \"RNALocate_mature\" #> Drugs (SM2miR) #> \"SM2miR_mature\" #> Expressed in tissue (Tissue Atlas) #> \"TissueAtlas_mature\" #> Tissue specific (isomiRdb) #> \"isomiRdb_tissue_specific_mature\" #> High confidence (MirGeneDB) #> \"MirGeneDB_High_confidence_mature\" #> isomiRs (isomiRdb) #> \"isomiRdb_mature\" mieaa_enrich <- rba_mieaa_enrich(test_set = covid_mirna, mirna_type = \"mature\", test_type = \"ORA\", species = 9606, categories = \"miRPathDB_GO_Biological_process_mature\") #> -- Step 1/3: Submitting Enrichment analysis request: #> Submitting ORA enrichment request for 23 miRNA IDs of species Homo sapiens to miEAA servers. #> #> -- Step 2/3: Checking for Submitted enrichment analysis's status every 5 seconds. #> Your submitted job ID is: 980e95d4-a767-4e7a-8c97-40146468db03 #> . #> #> -- Step 3/3: Retrieving the results. #> Retrieving results of submitted enrichment request with ID: 980e95d4-a767-4e7a-8c97-40146468db03"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"how-to-cite","dir":"Articles","previous_headings":"","what":"How to cite?","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"rbioapi interface databases services. Thus, used rbioapi published research, kindly addition citing rbioapi, make sure fully properly cite databases/services used. Suggested citations added functions’ manuals, “references” section; Nevertheless, user’s responsibility check proper citations properly cite database/services used. Please see rbioapi’s main vignette article details.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] httr_1.4.7 cli_3.6.3 knitr_1.49 rlang_1.1.4 #> [5] xfun_0.49 png_0.1-8 textshaping_0.4.1 jsonlite_1.8.9 #> [9] DT_0.33 htmltools_0.5.8.1 ragg_1.3.3 sass_0.4.9 #> [13] rmarkdown_2.29 grid_4.4.2 crosstalk_1.2.1 evaluate_1.0.1 #> [17] jquerylib_0.1.4 fastmap_1.2.0 yaml_2.3.10 lifecycle_1.0.4 #> [21] compiler_4.4.2 fs_1.6.5 htmlwidgets_1.6.4 systemfonts_1.1.0 #> [25] digest_0.6.37 R6_2.5.1 curl_6.0.1 magrittr_2.0.3 #> [29] bslib_0.8.0 tools_4.4.2 pkgdown_2.1.1 cachem_1.1.0 #> [33] desc_1.4.3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.A: Enrichr & rbioapi","text":"Enrichr popular gene-set enrichment analysis tool developed Ma’ayan Lab.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"gene-set-library-concept-in-enrichr","dir":"Articles","previous_headings":"","what":"Gene set library concept in Enrichr","title":"2.A: Enrichr & rbioapi","text":"Directly quoting Enrichr’s help page: gene set library set related gene sets enrichment terms […] libraries constructed many sources published studies major biological biomedical online databases. Others created available Enrichr. (source: https://maayanlab.cloud/Enrichr/help#background) get list available libraries Enrichr, use: returned data frame, can find names available Enrichr libraries “libraryName” column. see following sections, can use names request enrichment analysis based selected library libraries.","code":"enrichr_libs <- rba_enrichr_libs()"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"enrichment-analysis-using-enrichr","dir":"Articles","previous_headings":"","what":"Enrichment analysis using Enrichr","title":"2.A: Enrichr & rbioapi","text":"perform enrichment analysis gene-set Enrichr using rbioapi, can take two approaches. begin simple one. first, create vector genes’ NCBI IDs use input example article.","code":"# Create a vector with our genes' NCBI IDs genes <- c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\",\"CDK1\",\"KIF23\",\"PLK1\", \"RAC2\",\"RACGAP1\",\"RHOA\",\"RHOB\", \"PHF14\", \"RBM3\", \"MSL1\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"approach-1-using-the-wrapper-function","dir":"Articles","previous_headings":"Enrichment analysis using Enrichr","what":"Approach 1: Using the one-step Wrapper function","title":"2.A: Enrichr & rbioapi","text":"required input function simply supply gene-set character vector. Optionally can also select one libraries. Please see rba_enrichr() function’s manual details arguments. Note default value argument gene_set_library rba_enrichr function “”. means call function , Enrichr libraries used enrichment analysis uploaded gene list. case, named list, elements dataframe containing genes’ analysis results using Enrichr library. Alternatively, can use gene_set_library argument specify library (libraries) use. demonstrate using “MSigDB_Hallmark_2020” library: supplying gene_set_library argument, rbioapi assumes entering regex pattern. can disable setting regex_library_name FALSE. However, feature useful need -example- partial matches library names. Suppose want perform enrichment analysis every library available Enrichr contains name “MSig”. can following: Note one Enrichr library selected, data frame enrichment analysis result returned. multiple libraries selected, function’s output list element data frame corresponding one selected libraries.","code":"# Request the enrichment analysis results_all <- rba_enrichr(gene_list = genes) # Request the enrichment analysis by a specific library results_msig_hallmark <- rba_enrichr(gene_list = genes, gene_set_library = \"MSigDB_Hallmark_2020\") # Request the enrichment analysis results_msig <- rba_enrichr(gene_list = genes, gene_set_library = \"msig\", regex_library_name = TRUE) #> | | | 0% | |======================= | 33% | |=============================================== | 67% | |======================================================================| 100% # You can drop `regex_library_name = TRUE`, as it is TRUE by default. str(results_msig_hallmark) #> 'data.frame': 18 obs. of 9 variables: #> $ Term : chr \"Mitotic Spindle\" \"G2-M Checkpoint\" \"E2F Targets\" \"Apoptosis\" ... #> $ Overlap : chr \"5/199\" \"4/200\" \"4/200\" \"3/161\" ... #> $ P.value : num 2.57e-07 1.22e-05 1.22e-05 2.17e-04 2.74e-03 ... #> $ Adjusted.P.value : num 4.62e-06 7.29e-05 7.29e-05 9.76e-04 9.87e-03 ... #> $ Old.P.value : int 0 0 0 0 0 0 0 0 0 0 ... #> $ Old.Adjusted.P.value: int 0 0 0 0 0 0 0 0 0 0 ... #> $ Odds.Ratio : num 51 36.7 36.7 31.4 29.7 ... #> $ Combined.Score : num 774 416 416 265 175 ... #> $ Genes : chr \"CDC42;RACGAP1;PLK1;CDK1;KIF23\" \"RACGAP1;PLK1;CDK1;KIF23\" \"RACGAP1;PLK1;CDK1;BRCA1\" \"CDK2;BRCA1;RHOB\" ... str(results_msig, 1) #> List of 3 #> $ MSigDB_Computational :'data.frame': 195 obs. of 9 variables: #> $ MSigDB_Oncogenic_Signatures:'data.frame': 26 obs. of 9 variables: #> $ MSigDB_Hallmark_2020 :'data.frame': 18 obs. of 9 variables:"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"approach-2-going-step-by-step","dir":"Articles","previous_headings":"Enrichment analysis using Enrichr","what":"Approach 2: Going step-by-step","title":"2.A: Enrichr & rbioapi","text":"rba_enrichr() wrapper function. internally executes sequence functions necessary run analysis. Alternatively, go step step. demonstrate steps section. First, need retrieve list available Enrichr libraries. step optional. can skip already know name desired libraries want run analysis every available library. Now, need upload genes list Enrichr. , identifier assigned submitted list, needed next step. returned response, need numeric ID “userListId” element. Finally, ready submit enrichment analysis request Enrichr. explained wrapper function rba_enrichr(), can supply “gene_set_library” argument different ways. select “Table_Mining_of_CRISPR_Studies” library:","code":"# Get a list of available Enrichr libraries libs <- rba_enrichr_libs(store_in_options = TRUE) # Submit your gene-set to enrichr list_id <- rba_enrichr_add_list(gene_list = genes) str(list_id) #> List of 2 #> $ shortId : chr \"0e03fb919e10e6bd6cb5b44c59338684\" #> $ userListId: int 86963048 # Request the analysis results_crispr <- rba_enrichr_enrich(user_list_id = list_id$userListId, gene_set_library = \"Table_Mining_of_CRISPR_Studies\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"other-species","dir":"Articles","previous_headings":"","what":"Working with Other Species","title":"2.A: Enrichr & rbioapi","text":"Enrichr also provides libraries model organisms. following functions organism argument allows perform analysis species humans: rba_enrichr() rba_enrichr_enrich() rba_enrichr_gene_map() rba_enrichr_libs() available options organism argument human”, (H. sapiens & M. musculus), fly” (D. melanogaster), “yeast” (S. cerevisiae), “worm” (C. elegans), “fish” (D. rerio).","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"background-gene-list","dir":"Articles","previous_headings":"","what":"Providing background gene list","title":"2.A: Enrichr & rbioapi","text":"human mouse, Enrichr also support use background gene list. background gene list used compute results statistics. using one-step wrapper rba_enrichr() (Approach 1), Everything handled hood; simply supply background gene background_genes parameter. choose follow step--step approach, please note Enrichr relies API back-end called speedrichr handle analysis background gene list. Therefore, performing analysis background gene list, must explicitly upload target gene list speedrichr. . Later steps automatically interact speedrichr long relevant parameters background genes specified.","code":"# Assume we have the background genes in the variable my_background_genes results_msig <- rba_enrichr(gene_list = genes, background_genes = my_background_genes, regex_library_name = TRUE) # Create a vector with our genes' NCBI IDs genes <- c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\",\"CDK1\",\"KIF23\",\"PLK1\", \"RAC2\",\"RACGAP1\",\"RHOA\",\"RHOB\", \"PHF14\", \"RBM3\", \"MSL1\") # Step 1: Upload the target gene list to speedrichr # Note: Ensure `speedrichr = TRUE` is specified. Otherwise, it will not be # possible to use the background gene list later. list_id_spdr <- rba_enrichr_add_list(gene_list = genes, speedrichr = TRUE) # Step 2: Upload the background gene list # Assume we have the background genes in the variable my_background_genes background_id <- rba_enrichr_add_background(background_genes = my_background_genes) # Step 3: Submit the enrichment analysis and retrieve the results go_results <- rba_enrichr_enrich(user_list_id = list_id_spdr$userListId, background_id = background_id$backgroundid, gene_set_library = \"GO\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"see-also-in-functions-manuals","dir":"Articles","previous_headings":"","what":"See also in Functions’ manuals","title":"2.A: Enrichr & rbioapi","text":"rbioapi Enrichr functions covered vignette, sure check manuals: rba_enrichr_gene_map() rba_enrichr_view_list()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.A: Enrichr & rbioapi","text":"cite Enrichr (Please see https://maayanlab.cloud/Enrichr/help#terms): Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"other-services","dir":"Articles","previous_headings":"","what":"Over-representation analysis Using Other Services","title":"2.A: Enrichr & rbioapi","text":"services supported rbioapi also provide -representation analysis tools. Please see vignette article rbioapi: -Representation (Enrichment) Analysis R (link documentation site) -depth review.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.A: Enrichr & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.A: Enrichr & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] httr_1.4.7 cli_3.6.3 knitr_1.49 rlang_1.1.4 #> [5] xfun_0.49 textshaping_0.4.1 jsonlite_1.8.9 DT_0.33 #> [9] htmltools_0.5.8.1 ragg_1.3.3 sass_0.4.9 rmarkdown_2.29 #> [13] crosstalk_1.2.1 evaluate_1.0.1 jquerylib_0.1.4 fastmap_1.2.0 #> [17] yaml_2.3.10 lifecycle_1.0.4 compiler_4.4.2 fs_1.6.5 #> [21] htmlwidgets_1.6.4 systemfonts_1.1.0 digest_0.6.37 R6_2.5.1 #> [25] curl_6.0.1 magrittr_2.0.3 bslib_0.8.0 tools_4.4.2 #> [29] pkgdown_2.1.1 cachem_1.1.0 desc_1.4.3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.B: JASPAR & rbioapi","text":"Directly quoting Fornes O, Castro-Mondragon JA, Khan , et al: JASPAR (https://jaspar.elixir.) open-access database curated, non-redundant transcription factor (TF)-binding profiles stored position frequency matrices (PFMs) TFs across multiple species six taxonomic groups. 8th release JASPAR, CORE collection expanded 245 new PFMs (169 vertebrates, 42 plants, 17 nematodes, 10 insects, 7 fungi), 156 PFMs updated (125 vertebrates, 28 plants 3 insects). new profiles represent 18% expansion compared previous release. source: Fornes O, Castro-Mondragon JA, Khan , et al. JASPAR 2020: update open-access database transcription factor binding profiles. Nucleic Acids Res. 2019; doi: 10.1093/nar/gkz1001","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"data-organization-in-jaspar","dir":"Articles","previous_headings":"","what":"Data Organization in JASPAR","title":"2.B: JASPAR & rbioapi","text":"JASPAR database transcription factor binding matrices annotations metadata. entities organized hierarchical fashion explore next.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"releases","dir":"Articles","previous_headings":"Data Organization in JASPAR","what":"Releases","title":"2.B: JASPAR & rbioapi","text":"addition latest JASPAR database release (2020), active releases also available. rbioapi JASPAR functions release argument allows use database releases.","code":"## Call the function without any arguments to get a list of releases releases <- rba_jaspar_releases() ## Supply a release number for details: release_7_info <- rba_jaspar_releases(7)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"collections","dir":"Articles","previous_headings":"Data Organization in JASPAR","what":"Collections","title":"2.B: JASPAR & rbioapi","text":"Within release, Matrix profiles organized collections, can use rba_jaspar_collections() get list available collections, read “JASPAR Collections” section documentation page JASPAR web-site thorough review.","code":"## To get a list of available collection in release 2020: rba_jaspar_collections(release = 2020) #> name url #> 1 CORE https://jaspar.elixir.no/api/v1/collections/CORE/ #> 2 UNVALIDATED https://jaspar.elixir.no/api/v1/collections/UNVALIDATED/ ## You can list information of all matrices available in a collection: mat_in_core_2020 <- rba_jaspar_collections_matrices(collection = \"CORE\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"taxonomic-groups","dir":"Articles","previous_headings":"Data Organization in JASPAR","what":"Taxonomic Groups","title":"2.B: JASPAR & rbioapi","text":"Within collection, matrix profiles organized based main taxonomic groups:","code":"## To get a list of taxonomic groups in release 2020: rba_jaspar_taxons(release = 2020) #> name url #> 1 plants https://jaspar.elixir.no/api/v1/taxon/plants/ #> 2 vertebrates https://jaspar.elixir.no/api/v1/taxon/vertebrates/ #> 3 insects https://jaspar.elixir.no/api/v1/taxon/insects/ #> 4 urochordates https://jaspar.elixir.no/api/v1/taxon/urochordates/ #> 5 nematodes https://jaspar.elixir.no/api/v1/taxon/nematodes/ #> 6 fungi https://jaspar.elixir.no/api/v1/taxon/fungi/ #> 7 diatoms https://jaspar.elixir.no/api/v1/taxon/diatoms/ #> 8 trematodes https://jaspar.elixir.no/api/v1/taxon/trematodes/ #> 9 dictyostelium https://jaspar.elixir.no/api/v1/taxon/dictyostelium/ #> 10 cnidaria https://jaspar.elixir.no/api/v1/taxon/cnidaria/ #> 11 oomycota https://jaspar.elixir.no/api/v1/taxon/oomycota/ ## You can list information of all matrices available in a taxonomic group: mat_in_insects <- rba_jaspar_taxons_matrices(tax_group = \"insects\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"species","dir":"Articles","previous_headings":"Data Organization in JASPAR","what":"Species","title":"2.B: JASPAR & rbioapi","text":"go data organization hierarchy, taxonomic group consist species:","code":"## To get a list of species in release 2020: species <- rba_jaspar_species(release = 2020) head(species) #> tax_id species #> 1 5037 Ajellomyces capsulatus #> 2 4151 Antirrhinum majus #> 3 81972 Arabidopsis lyrata subsp. lyrata #> 4 3702 Arabidopsis thaliana #> 5 9913 Bos taurus #> 6 6238 Caenorhabditis briggsae #> url #> 1 https://jaspar.elixir.no/api/v1/species/5037/ #> 2 https://jaspar.elixir.no/api/v1/species/4151/ #> 3 https://jaspar.elixir.no/api/v1/species/81972/ #> 4 https://jaspar.elixir.no/api/v1/species/3702/ #> 5 https://jaspar.elixir.no/api/v1/species/9913/ #> 6 https://jaspar.elixir.no/api/v1/species/6238/ #> matrix_url #> 1 https://jaspar.elixir.no/api/v1/species/5037/ #> 2 https://jaspar.elixir.no/api/v1/species/4151/ #> 3 https://jaspar.elixir.no/api/v1/species/81972/ #> 4 https://jaspar.elixir.no/api/v1/species/3702/ #> 5 https://jaspar.elixir.no/api/v1/species/9913/ #> 6 https://jaspar.elixir.no/api/v1/species/6238/ ## You can list information of all matrices available in a specie: mat_in_human <- rba_jaspar_species_matrices(tax_id = 9606)"},{"path":[]},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"search-matrix-profiles","dir":"Articles","previous_headings":"Matrix Profiles","what":"Search Matrix Profiles","title":"2.B: JASPAR & rbioapi","text":"Retrieving list every matrix available given category option. can also build search query using rba_jaspar_matrix_search. Note search function, required fill every argument. may use combination arguments see fit build query. can even call function without argument get list matrix profiles. instance:","code":"## Get a list of all the available matrix profile: all_matrices <- rba_jaspar_matrix_search() ## Search FOX: FOX_matrices <- rba_jaspar_matrix_search(term = \"FOX\") ## Transcription factors named FOXP3 FOXP3_matrices <- rba_jaspar_matrix_search(term = \"FOXP3\") ## Transcription factors of Zipper-Type Class zipper_matrices <- rba_jaspar_matrix_search(tf_class = \"Zipper-Type\") ## Transcription factors of Zipper-Type Class in PBM collection zipper_pbm_matrices <- rba_jaspar_matrix_search(tf_class = \"Zipper-Type\", collection = \"PBM\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"list-matrix-profiles-associated-to-a-base-identifier","dir":"Articles","previous_headings":"Matrix Profiles","what":"List Matrix Profiles Associated to a Base identifier","title":"2.B: JASPAR & rbioapi","text":"Since JASPAR release 2010, matrix profiles versioned. matrix profile Identifier “base_id.version” naming schema; example “MA0600.2” corresponds second version matrix base ID MA0600. can Use rba_jaspar_matrix_versions get list matrix profiles given base ID. Also note functions, generally used list available matrices, argument called only_last_version.","code":"## Get matrix profiles versions associated to a base id MA0600_versions <- rba_jaspar_matrix_versions(\"MA0600\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"get-a-matrix-profile","dir":"Articles","previous_headings":"Matrix Profiles","what":"Get a Matrix Profile","title":"2.B: JASPAR & rbioapi","text":"Now listed searched matrix profiles, can use rba_jaspar_matrix retrieve matrix profiles. two ways can use function:","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"get-matrix-and-annotations-as-an-r-object","dir":"Articles","previous_headings":"Matrix Profiles > Get a Matrix Profile","what":"Get Matrix and Annotations as an R Object","title":"2.B: JASPAR & rbioapi","text":", fill matrix_id argument rba_jaspar_matrix","code":"pfm_matrix <- rba_jaspar_matrix(matrix_id = \"MA0600.2\") ## you can find the matrix in the pfm element along with ## other elements which correspond to annotations and details str(pfm_matrix) #> List of 24 #> $ matrix_id : chr \"MA0600.2\" #> $ name : chr \"RFX2\" #> $ base_id : chr \"MA0600\" #> $ version : int 2 #> $ collection : chr \"CORE\" #> $ sequence_logo: chr \"https://jaspar.elixir.no/static/logos/svg/MA0600.2.svg\" #> $ versions_url : chr \"https://jaspar.elixir.no/api/v1/matrix/MA0600/versions\" #> $ sites_url : NULL #> $ pfm : num [1:4, 1:16] 1381 5653 4042 2336 270 ... #> ..- attr(*, \"dimnames\")=List of 2 #> .. ..$ : chr [1:4] \"A\" \"C\" \"G\" \"T\" #> .. ..$ : NULL #> $ class : chr \"Fork head/winged helix factors\" #> $ family : chr \"RFX-related factors\" #> $ tfe_id : list() #> $ medline : chr \"8754849\" #> $ pazar_tf_id : list() #> $ remap_tf_name: chr \"RFX2\" #> $ source : chr \"23332764\" #> $ tax_group : chr \"vertebrates\" #> $ type : chr \"HT-SELEX\" #> $ tfe_ids : list() #> $ pubmed_ids : chr \"8754849\" #> $ pazar_tf_ids : list() #> $ uniprot_ids : chr \"P48378\" #> $ species :'data.frame': 1 obs. of 2 variables: #> ..$ tax_id: int 9606 #> ..$ name : chr \"Homo sapiens\" #> $ tffm :List of 7 #> ..$ tffm_id : chr \"TFFM0576.1\" #> ..$ base_id : chr \"TFFM0576\" #> ..$ version : int 1 #> ..$ log_p_1st_order: num 6275 #> ..$ log_p_detailed : num 6660 #> ..$ experiment_name: chr \"CistromeDB_58298\" #> ..$ tffm_url : chr \"https://jaspar.elixir.no/api/v1/tffm/TFFM0576.1/\""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"save-a-matrix-a-file-in-specific-format","dir":"Articles","previous_headings":"Matrix Profiles > Get a Matrix Profile","what":"Save a Matrix a File in Specific Format","title":"2.B: JASPAR & rbioapi","text":"JASPAR provides position frequency matrices (PFM) formatted Raw PFM, JASPAR, TRANSFAC, YAML, MEME. can download matrix profile file formats. , use file_format save_to arguments available rba_jaspar_matrix. two notes : case, function save matrix file returns un-parsed content file character string. save_to argument function, fact rbioapi function can used many ways: 2.1. save_to = NA: rbioapi automatically generate file path working directory, save file path , informs message. 2.2 save_to = file_name without path: rbioapi save file supplied name working directory. 2.3. save_to = directory path (without file): rbioapi save file proper name directory. 2.4. save_to = file path (.e. ending .extension): rbioapi save file exactly path. Make sure file extension path matches requested file format. case, rbioapi save file extension supplied path, issues warning inform . aforementioned cases, file path can absolute relative.","code":"## Different wqays in which you can save the matrix file: meme_matrix1 <- rba_jaspar_matrix(matrix_id = \"MA0600.2\", file_format = \"meme\") meme_matrix2 <- rba_jaspar_matrix(matrix_id = \"MA0600.2\", file_format = \"meme\", save_to = \"my_matrix.meme\") meme_matrix3 <- rba_jaspar_matrix(matrix_id = \"MA0600.2\", file_format = \"meme\", save_to = \"c:/rbioapi\") meme_matrix4 <- rba_jaspar_matrix(matrix_id = \"MA0600.2\", file_format = \"meme\", save_to = \"c:/rbioapi/my_matrix.meme\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"get-binding-sites-of-a-matrix-profiles","dir":"Articles","previous_headings":"Matrix Profiles","what":"Get Binding Sites of a Matrix Profiles","title":"2.B: JASPAR & rbioapi","text":"available, can retrieve information binding sites associated matrix profile. information includes data frame genomic coordination binding site, URL FASTA BED files, along annotations.","code":"## Get binding site of a matrix profile: binding_sites <- rba_jaspar_sites(matrix_id = \"MA0600.2\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"tf-flexible-models-tffms","dir":"Articles","previous_headings":"","what":"TF flexible models (TFFMs)","title":"2.B: JASPAR & rbioapi","text":"JASPAR also stores assigns identifiers TF flexible models (TFFMs). Just like PFM (position frequency matrices), can search TFFMs retrieve information annotations using TFFM Identifier. TFFM IDs versioned, meaning base_id.version format.","code":"## Search TFFMs. This is a search function. Thus, what has been presented ## in `Search Matrix Profiles` section also applies here: ## Get a list of all the available matrix profile: all_tffms <- rba_jaspar_tffm_search() ## Search FOX: FOX_tffms <- rba_jaspar_tffm_search(term = \"FOX\") ## Transcription factors named FOXP3 FOXP3_tffms <- rba_jaspar_tffm_search(term = \"FOXP3\") ## Transcription factors of insects taxonomic group insects_tffms <- rba_jaspar_tffm_search(tax_group = \"insects\") ## Now that you have a TFFM ID, you can retrieve it TFFM0056 <- rba_jaspar_tffm(\"TFFM0056.3\") str(TFFM0056) #> List of 10 #> $ tffm_id : chr \"TFFM0056.3\" #> $ base_id : chr \"TFFM0056\" #> $ version : int 3 #> $ matrix_base_id : chr \"MA0039\" #> $ matrix_id : chr \"MA0039.4\" #> $ matrix_url : chr \"https://jaspar.elixir.no/api/v1/matrix/MA0039.4/\" #> $ matrix_version : int 4 #> $ experiment_name: chr \"CistromeDB_33718\" #> $ first_order :List of 5 #> ..$ log_p : num 7420 #> ..$ dense_logo : chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_first_order_trained_dense_logo.svg\" #> ..$ summary_logo: chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_first_order_trained_summary_logo.svg\" #> ..$ hits : chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_first_order_trained.hits.svg\" #> ..$ xml : chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_first_order_trained.xml\" #> $ detailed :List of 5 #> ..$ log_p : num 6854 #> ..$ dense_logo : chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_detailed_trained_dense_logo.svg\" #> ..$ summary_logo: chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_detailed_trained_summary_logo.svg\" #> ..$ hits : chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_detailed_trained.hits.svg\" #> ..$ xml : chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_detailed_trained.xml\""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.B: JASPAR & rbioapi","text":"cite JASPAR (Please see https://jaspar.elixir./faq/): Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; https://doi.org/10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, https://doi.org/10.1093/bioinformatics/btx804 cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.B: JASPAR & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.B: JASPAR & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] digest_0.6.37 desc_1.4.3 R6_2.5.1 fastmap_1.2.0 #> [5] xfun_0.49 cachem_1.1.0 knitr_1.49 htmltools_0.5.8.1 #> [9] rmarkdown_2.29 lifecycle_1.0.4 cli_3.6.3 sass_0.4.9 #> [13] pkgdown_2.1.1 textshaping_0.4.1 jquerylib_0.1.4 systemfonts_1.1.0 #> [17] compiler_4.4.2 httr_1.4.7 tools_4.4.2 ragg_1.3.3 #> [21] curl_6.0.1 evaluate_1.0.1 bslib_0.8.0 yaml_2.3.10 #> [25] jsonlite_1.8.9 rlang_1.1.4 fs_1.6.5 htmlwidgets_1.6.4"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.C: miEEA & rbioapi","text":"miRNA Enrichment Analysis Annotation Tool (miEAA) service provided Chair Clinical Bioinformatics Saarland University. Basically, miEAA multi-species microRNA enrichment analysis tool. information, see website published paper.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"first-find-enrichment-categories","dir":"Articles","previous_headings":"","what":"First, find enrichment categories","title":"2.C: miEEA & rbioapi","text":"Performing enrichment analysis miRNA set, note based input miRNA type (either mature precursor, mixture !) species, different sets supported enrichment categories. Thus, recommended retrieve list possible enrichment categories may use:","code":"## A list of available enrichment categories for: ## mature human miRNA: rba_mieaa_cats(mirna_type = \"mature\", species = 9606) ## precursor human miRNA rba_mieaa_cats(mirna_type = \"precursor\", species = 9606) ## precursor zebrafish miRNA rba_mieaa_cats(mirna_type = \"mature\", species = \"Danio rerio\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"submit-enrichment-analysis-request-to-mieaa","dir":"Articles","previous_headings":"","what":"Submit Enrichment analysis request to miEAA","title":"2.C: miEEA & rbioapi","text":"two approaches , start simpler one.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"approach-1-using-the-wrapper-function","dir":"Articles","previous_headings":"Submit Enrichment analysis request to miEAA","what":"Approach 1: Using the Wrapper function","title":"2.C: miEEA & rbioapi","text":"Just fill arguments rba_mieaa_enrich() according function’s manual; can see function’s arguments, lot controls enrichment request, need provide test_set, mirna_type, test_type, species:","code":"## 1 We create a variable with our miRNAs' mature IDs mirs <- c(\"hsa-miR-20b-5p\", \"hsa-miR-144-5p\", \"hsa-miR-17-5p\", \"hsa-miR-20a-5p\", \"hsa-miR-222-3p\", \"hsa-miR-106a-5p\", \"hsa-miR-93-5p\", \"hsa-miR-126-3p\", \"hsa-miR-363-3p\", \"hsa-miR-302c-3p\", \"hsa-miR-374b-5p\", \"hsa-miR-18a-5p\", \"hsa-miR-548d-3p\", \"hsa-miR-135a-3p\", \"hsa-miR-558\", \"hsa-miR-130b-5p\", \"hsa-miR-148a-3p\") ## 2a We can perform enrichment analysis on our miRNA set without limiting the analysis to any categories mieaa_all <- rba_mieaa_enrich(test_set = mirs, mirna_type = \"mature\", test_type = \"ORA\", species = 9606) #> -- Step 1/3: Submitting Enrichment analysis request: #> No categories were supplied, Requesting enrichment using all of the 32 available categories for species 'Homo sapiens'. #> Submitting ORA enrichment request for 17 miRNA IDs of species Homo sapiens to miEAA servers. #> #> -- Step 2/3: Checking for Submitted enrichment analysis's status every 5 seconds. #> Your submitted job ID is: a3ca5443-1abb-4fe4-9cca-ccd4c126a771 #> ....... #> #> -- Step 3/3: Retrieving the results. #> Retrieving results of submitted enrichment request with ID: a3ca5443-1abb-4fe4-9cca-ccd4c126a771 ## 2b Or, We can limit the enrichment to certain datasets (enrichment categories) mieaa_kegg <- rba_mieaa_enrich(test_set = mirs, mirna_type = \"mature\", test_type = \"ORA\", species = 9606, categories = \"KEGG_mature\" ) #> -- Step 1/3: Submitting Enrichment analysis request: #> Submitting ORA enrichment request for 17 miRNA IDs of species Homo sapiens to miEAA servers. #> #> -- Step 2/3: Checking for Submitted enrichment analysis's status every 5 seconds. #> Your submitted job ID is: 7a407342-69b6-45b3-8588-adcb203e852d #> . #> #> -- Step 3/3: Retrieving the results. #> Retrieving results of submitted enrichment request with ID: 7a407342-69b6-45b3-8588-adcb203e852d"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"approach-2-going-step-by-step","dir":"Articles","previous_headings":"Submit Enrichment analysis request to miEAA","what":"Approach 2: Going step-by-step","title":"2.C: miEEA & rbioapi","text":"stated , rba_mieaa_enrich() wrapper function, meaning executes following sequence functions: Please Note: services supported rbioapi also provide -representation analysis tools. Please see vignette article rbioapi: -Representation (Enrichment) Analysis R (link documentation site) -depth review.","code":"## 1 Submit enrichment request to miEAA request <- rba_mieaa_enrich_submit(test_set = mirs, mirna_type = \"mature\", test_type = \"ORA\", species = 9606, categories = c(\"miRWalk_Diseases_mature\", \"miRWalk_Organs_mature\") ) ## 2 check for job's running status rba_mieaa_enrich_status(job_id = request$job_id) ## 3 If the job has completed, retrieve the results results <- rba_mieaa_enrich_results(job_id = request$job_id)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"convert-mirna-accessions","dir":"Articles","previous_headings":"","what":"Convert miRNA accessions","title":"2.C: miEEA & rbioapi","text":"miEAA recognizes miRBASE version 22 accessions. can use rba_mieaa_convert_version() convert miRNA accession different miRBASE versions. Also, stated , miEAA differentiate precursor mature miRNA accessions, convert 2 accession types, use rba_mieaa_convert_type().","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.C: miEEA & rbioapi","text":"cite miEAA (Please see https://ccb-compute2.cs.uni-saarland.de/mieaa2/): Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig, Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.C: miEEA & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.C: miEEA & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] httr_1.4.7 cli_3.6.3 knitr_1.49 rlang_1.1.4 #> [5] xfun_0.49 textshaping_0.4.1 jsonlite_1.8.9 DT_0.33 #> [9] htmltools_0.5.8.1 ragg_1.3.3 sass_0.4.9 rmarkdown_2.29 #> [13] crosstalk_1.2.1 evaluate_1.0.1 jquerylib_0.1.4 fastmap_1.2.0 #> [17] yaml_2.3.10 lifecycle_1.0.4 compiler_4.4.2 fs_1.6.5 #> [21] htmlwidgets_1.6.4 systemfonts_1.1.0 digest_0.6.37 R6_2.5.1 #> [25] curl_6.0.1 magrittr_2.0.3 bslib_0.8.0 tools_4.4.2 #> [29] pkgdown_2.1.1 cachem_1.1.0 desc_1.4.3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.D: PANTHER & rbioapi","text":"Directly quoting paper published PANTHER (Protein Analysis Evolutionary Relationships) authors: PANTHER classification system (https://www.pantherdb.org) comprehensive system combines genomes, gene function , pathways statistical analysis tools enable analyze large-scale genome-wide experimental data. system (PANTHER v.14.0) covers 131 complete genomes organized gene families subfamilies; evolutionary relationships represented phylogenetic trees, multiple sequence statistical models (hidden Markov models (HMMs)). families subfamilies annotated Gene Ontology (GO) terms, sequences assigned PANTHER pathways. suite tools built allow users browse query gene functions analyze-scale experimental data number statistical tests. widely used bench scientists, bioinformaticians, computer systems biologists. (source: Mi, Huaiyu, et al. “Protocol Update large-scale genome gene function analysis PANTHER classification system (v. 14.0).” Nature protocols 14.3 (2019): 703-721) available tools PANTHER’s RESTful API services can divided 3 broad categories: Mapping genes, retrieving information, research tools. Herein, provide short introduction; can always check functions’ manuals detailed guides examples.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"map-genes","dir":"Articles","previous_headings":"","what":"Map genes","title":"2.D: PANTHER & rbioapi","text":"rba_panther_mapping(): map gene-set PANTHER database retrieve attributes annotations associated genes rba_panther_ortholog(): Retrieve Orthologs genes rba_panther_homolog(): Retrieve Homologs genes","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"get-information","dir":"Articles","previous_headings":"","what":"Get information","title":"2.D: PANTHER & rbioapi","text":"rba_panther_info(): Retrieve list PANTHER’s supported organisms, datasets, families, pathways rba_panther_family(): Retrieve Orthologs, MSA, Tree topology given PANTHER family.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"gene-list-analysis","dir":"Articles","previous_headings":"","what":"Gene List Analysis","title":"2.D: PANTHER & rbioapi","text":"rba_panther_enrich() equivalent Gene List analysis tool’s webpage. Depending provided input’s class, PANTHER perform either -representation analysis statistical enrichment analysis. demonstrate perform analyses.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"analysis-get-available-annotation-datasets","dir":"Articles","previous_headings":"Gene List Analysis","what":"Get the available annotation datasets","title":"2.D: PANTHER & rbioapi","text":"First, need select annotation dataset conduct analysis based . annotation dataset contains collection terms, term associated group genes. retrieve list available annotation datasets PANTHER, use following command: Please note use ID desired annotation dataset, label. example, using \"biological_process\" incorrect; rather use \"GO:0008150\".","code":"annots <- rba_panther_info(what = \"datasets\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"submit-the-analysis-request","dir":"Articles","previous_headings":"Gene List Analysis","what":"Submit the analysis request","title":"2.D: PANTHER & rbioapi","text":"Depending provided input, PANTHER conduct two types analysis: character vector supplied, -representation analysis performed using either Fisher’s exact binomial test. data frame gene identifiers corresponding expression values supplied, statistical enrichment test performed using Mann-Whitney U (Wilcoxon Rank-Sum) test. rbioapi determines proper analysis based class genes parameter. Please refer details section rba_panther_enrich() function manual information.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"over-representation-analysis","dir":"Articles","previous_headings":"Gene List Analysis > Submit the analysis request","what":"Over-representation analysis","title":"2.D: PANTHER & rbioapi","text":"Now, suppose want perform -representation analysis ‘GO biological process’ annotation dataset. example, provide gene names, thus -representation analysis conducted:","code":"# Create a variable to store the genes vector my_genes_vec <- c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\", \"CDK1\",\"KIF23\",\"PLK1\", \"RAC2\",\"RACGAP1\",\"RHOA\", \"RHOB\", \"PHF14\", \"RBM3\", \"MSL1\") # Submit the analysis request. enriched <- rba_panther_enrich(genes = my_genes_vec, organism = 9606, annot_dataset = \"GO:0008150\", cutoff = 0.05) #> Performing PANTHER over-representation analysis (Fisher's exact test) on 15 genes from `organism 9606` against `GO:0008150` datasets. # Note that we didn't supply the `test_type` parameter. # In this case, the function will default to using Fisher's exact test # (i.e. `test_type = \"FISHER\"`). # You may also use binomial test for the over-representation analysis # (i.e. `test_type = \"BINOMIAL\"`)."},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"statistical-enrichment-analysis","dir":"Articles","previous_headings":"Gene List Analysis > Submit the analysis request","what":"Statistical enrichment analysis","title":"2.D: PANTHER & rbioapi","text":"can see example, vector gene names used. can also use corresponding expression values genes. case, PANTHER perform statistical enrichment analysis. , change supply data frame genes parameter. Note case, Mann-Whitney U Test performed. data frame two columns: first column contain gene identifiers character vector; second column contain corresponding expression values numeric vector. Please Note: services supported rbioapi also provide -representation analysis tools. Please see vignette article rbioapi: -Representation (Enrichment) Analysis R (link documentation site) -depth review.","code":"# Create a variable to store the data frame my_genes_df <- data.frame( genes = c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\", \"CDK1\",\"KIF23\",\"PLK1\", \"RAC2\",\"RACGAP1\",\"RHOA\", \"RHOB\", \"PHF14\", \"RBM3\", \"MSL1\"), ## generate random expression values expression = runif(15, 0, 10) ) # Submit the analysis request. enriched <- rba_panther_enrich(genes = my_genes_df, organism = 9606, annot_dataset = \"GO:0008150\", cutoff = 0.05) # Note that we didn't supply the `test_type` parameter. # In this case, the function will default to Mann-Whitney U Test # (i.e. `test_type = \"Mann-Whitney\"`). # This is the only valid value for the statistical enrichment analysis test, # thus ommiting or supplying it will not make a difference."},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"tree-grafter","dir":"Articles","previous_headings":"","what":"Tree grafter","title":"2.D: PANTHER & rbioapi","text":"rba_panther_tree_grafter() equivalent “Graft sequence PANTHER library trees” tool.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.D: PANTHER & rbioapi","text":"cite PANTHER (Please see https://www.pantherdb.org/publications.jsp#HowToCitePANTHER): Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.D: PANTHER & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.D: PANTHER & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] httr_1.4.7 cli_3.6.3 knitr_1.49 rlang_1.1.4 #> [5] xfun_0.49 textshaping_0.4.1 jsonlite_1.8.9 DT_0.33 #> [9] htmltools_0.5.8.1 ragg_1.3.3 sass_0.4.9 rmarkdown_2.29 #> [13] crosstalk_1.2.1 evaluate_1.0.1 jquerylib_0.1.4 fastmap_1.2.0 #> [17] yaml_2.3.10 lifecycle_1.0.4 compiler_4.4.2 fs_1.6.5 #> [21] htmlwidgets_1.6.4 systemfonts_1.1.0 digest_0.6.37 R6_2.5.1 #> [25] curl_6.0.1 magrittr_2.0.3 bslib_0.8.0 tools_4.4.2 #> [29] pkgdown_2.1.1 cachem_1.1.0 desc_1.4.3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.E: Reactome & rbioapi","text":"Directly quoting Reactome: REACTOME open-source, open access, manually curated peer-reviewed pathway database. goal provide intuitive bioinformatics tools visualization, interpretation analysis pathway knowledge support basic clinical research, genome analysis, modeling, systems biology education. Founded 2003, Reactome project led Lincoln Stein OICR, Peter D’Eustachio NYULMC, Henning Hermjakob EMBL-EBI, Guanming Wu OHSU. (source: https://reactome.org/--reactome) Reactome provides two RESTful API services: Reactome content services Reactome analysis services. rbioapi, naming schema function belongs analysis services starts rba_reactome_analysis* . rba_reactome_* functions without ‘analysis’ infix correspond content services API. continuing reading article, good idea read Reactome Data Model page.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"reactome-analysis-services","dir":"Articles","previous_headings":"","what":"Reactome analysis services","title":"2.E: Reactome & rbioapi","text":"section mostly revolves around rba_reactome_analysis() function. , naturally, start . explained function’s manual, considerable freedom providing main input function; can supply R object (data frame, matrix, simple vector), URL, local file path. Note type analysis decided based whether input 1-dimensional 2-dimensional. explained detail manual rba_reactome_analysis(), see information.rba_reactome_analysis() API equivalent Reactome’s analyse gene list tool. can see function’s arguments correspond choose webpage’s wizard. mentioned, rba_reactome_analysis()’s arguments correspond wizard analyse gene list tool; arguments corresponds contents “Filter results” tab results page. analysis’s token, can retrieve analysis results many formats using rba_reactome_analysis_pdf() rba_reactome_analysis_download(): token guaranteed stored 7 days. , can upload JSON file downloaded using rba_reactome_analysis_download get token : Please Note: services supported rbioapi also provide -representation analysis tools. Please see vignette article rbioapi: -Representation (Enrichment) Analysis R (link documentation site) -depth review.","code":"## 1 We create a simple vector with our genes genes <- c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\", \"CDK1\", \"KIF23\", \"PLK1\", \"RAC2\", \"RACGAP1\", \"RHOA\", \"RHOB\", \"MSL1\", \"PHF21A\", \"INSR\", \"JADE2\", \"P2RX7\", \"CCDC101\", \"PPM1B\", \"ANAPC16\", \"CDH8\", \"HSPA1L\", \"CUL2\", \"ZNF302\", \"CUX1\", \"CYTH2\", \"SEC22C\", \"EIF4E3\", \"ROBO2\", \"CXXC1\", \"LINC01314\", \"ATP5F1\") ## 2 We call reactome analysis with the default parameters analyzed <- rba_reactome_analysis(input = genes, projection = TRUE, p_value = 0.01) ## 3 As always, we use str() to inspect the resutls str(analyzed, 1) #> List of 8 #> $ summary :List of 7 #> $ expression :List of 1 #> $ identifiersNotFound: int 1 #> $ pathwaysFound : int 82 #> $ pathways :'data.frame': 82 obs. of 19 variables: #> $ resourceSummary :'data.frame': 3 obs. of 3 variables: #> $ speciesSummary :'data.frame': 1 obs. of 5 variables: #> $ warnings : list() ## 4 Note that in the summary element: (analyzed$summary) ### 4.a because we supplied a simple vector, the analysis type was: over-representation ### 4.b You need the token for other rba_reactome_analysis_* functions ## 5 Analsis results are in the pathways data frame: # download a full pdf report rba_reactome_analysis_pdf(token = analyzed$summary$token, species = 9606) # download the result in compressed json.gz format rba_reactome_analysis_download(token = analyzed$summary$token, request = \"results\", save_to = \"reactome_results.json\") re_uploaded <- rba_reactome_analysis_import(input = \"reactome_results.json\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"analysis_see-also-in-functions-manuals","dir":"Articles","previous_headings":"Reactome analysis services","what":"See also in Functions’ manuals","title":"2.E: Reactome & rbioapi","text":"rbioapi Reactome analysis functions covered vignette, sure check manuals: rba_reactome_analysis_mapping() rba_reactome_analysis_species() rba_reactome_analysis_token()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"reactome-contents-services","dir":"Articles","previous_headings":"","what":"Reactome contents services","title":"2.E: Reactome & rbioapi","text":"rbioapi functions correspond Reactome content services starting rba_reactome_* without “_analysis” infix. functions cover can objects Reactome knowledge-base. simpler terms, -- correspond can find Reactome Pathway Browser search results. (e.g. pathway, reaction, physical Entity, etc.)","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"retrieve-any-object-from-reactome-knowledge-base","dir":"Articles","previous_headings":"Reactome contents services","what":"Retrieve any object from Reactome knowledge-base","title":"2.E: Reactome & rbioapi","text":"Using rba_reactome_query(), can retrieve object Reactome knowledge-base. simpler terms, mean object roughly anything Reactome associated ID . can range person’s entry proteins, reactions, pathways, species, many ! can explore Reactome’s data schema learn Reactome knowledge-base objects organization. examples, note limited one ID per query. can use vector inputs, limitation supply one ID, enhanced = TRUE.","code":"## 1 query a pathway Entry pathway <- rba_reactome_query(ids = \"R-HSA-109581\", enhanced = TRUE) ## 2 As always we use str() to inspect the output's structure str(pathway, 2) #> List of 28 #> $ dbId : int 109581 #> $ displayName : chr \"Apoptosis\" #> $ stId : chr \"R-HSA-109581\" #> $ stIdVersion : chr \"R-HSA-109581.6\" #> $ created :List of 5 #> ..$ dbId : int 109608 #> ..$ displayName: chr \"Alnemri, E, Hengartner, Michael, Tschopp, Jürg, Tsujimoto, Yoshihide, Hardwick, JM, 2004-01-16\" #> ..$ dateTime : chr \"2004-01-16 21:01:51\" #> ..$ className : chr \"InstanceEdit\" #> ..$ schemaClass: chr \"InstanceEdit\" #> $ modified :List of 6 #> ..$ dbId : int 11015412 #> ..$ displayName: chr \"Weiser, Joel, 2024-11-17\" #> ..$ dateTime : chr \"2024-11-17 16:07:31\" #> ..$ note : chr \"Inserted by org.reactome.orthoinference\" #> ..$ className : chr \"InstanceEdit\" #> ..$ schemaClass: chr \"InstanceEdit\" #> $ isInDisease : logi FALSE #> $ isInferred : logi FALSE #> $ name :List of 1 #> ..$ : chr \"Apoptosis\" #> $ releaseDate : chr \"2004-09-20\" #> $ speciesName : chr \"Homo sapiens\" #> $ authored :List of 1 #> ..$ : int 109608 #> $ edited :List of 1 #> ..$ :List of 5 #> $ figure :List of 1 #> ..$ :List of 5 #> $ goBiologicalProcess:List of 9 #> ..$ dbId : int 2273 #> ..$ displayName : chr \"apoptotic process\" #> ..$ accession : chr \"0006915\" #> ..$ databaseName: chr \"GO\" #> ..$ definition : chr \"A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external sig\"| __truncated__ #> ..$ name : chr \"apoptotic process\" #> ..$ url : chr \"https://www.ebi.ac.uk/QuickGO/term/GO:0006915\" #> ..$ className : chr \"GO_BiologicalProcess\" #> ..$ schemaClass : chr \"GO_BiologicalProcess\" #> $ literatureReference:List of 7 #> ..$ :List of 11 #> ..$ :List of 11 #> ..$ :List of 11 #> ..$ :List of 11 #> ..$ :List of 11 #> ..$ :List of 11 #> ..$ :List of 11 #> $ orthologousEvent :List of 14 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> $ reviewed :List of 1 #> ..$ :List of 5 #> $ species :List of 1 #> ..$ :List of 8 #> $ summation :List of 1 #> ..$ :List of 5 #> $ reviewStatus :List of 6 #> ..$ dbId : int 9821382 #> ..$ displayName: chr \"five stars\" #> ..$ definition : chr \"externally reviewed\" #> ..$ name :List of 1 #> ..$ className : chr \"ReviewStatus\" #> ..$ schemaClass: chr \"ReviewStatus\" #> $ updateTrackers :List of 22 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> $ hasDiagram : logi TRUE #> $ hasEHLD : logi TRUE #> $ lastUpdatedDate : chr \"2022-06-09\" #> $ hasEvent :List of 4 #> ..$ :List of 16 #> ..$ :List of 17 #> ..$ :List of 17 #> ..$ :List of 16 #> $ schemaClass : chr \"Pathway\" #> $ className : chr \"Pathway\" ## 3 You can compare it with the webpage of R-HSA-202939 entry: # https://reactome.org/content/detail/R-HSA-202939 ## 1 query a protein Entry protein <- rba_reactome_query(ids = 66247, enhanced = TRUE) ## 2 As always we use str() to inspect the output's structure str(protein, 1) #> List of 27 #> $ dbId : int 66247 #> $ displayName : chr \"UniProt:P25942-1 CD40\" #> $ modified :List of 6 #> $ databaseName : chr \"UniProt\" #> $ identifier : chr \"P25942\" #> $ name :List of 1 #> $ otherIdentifier :List of 119 #> $ url : chr \"http://purl.uniprot.org/uniprot/P25942-1\" #> $ crossReference :List of 29 #> $ referenceDatabase :List of 8 #> $ physicalEntity :List of 1 #> $ checksum : chr \"BC8776EC2C4A5680\" #> $ comment :List of 1 #> $ description :List of 1 #> $ geneName :List of 2 #> $ isSequenceChanged : logi FALSE #> $ keyword :List of 17 #> $ secondaryIdentifier:List of 8 #> $ sequenceLength : int 277 #> $ species : int 48887 #> $ chain :List of 2 #> $ referenceGene :List of 11 #> $ referenceTranscript:List of 4 #> $ variantIdentifier : chr \"P25942-1\" #> $ isoformParent :List of 1 #> $ className : chr \"ReferenceIsoform\" #> $ schemaClass : chr \"ReferenceIsoform\" ## 3 You can compare it with the webpage of R-HSA-202939 entry: # https://reactome.org/content/detail/R-HSA-202939"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"find-cross-reference-ids-in-reactome","dir":"Articles","previous_headings":"Reactome contents services","what":"Find Cross-Reference IDs in Reactome","title":"2.E: Reactome & rbioapi","text":"can see second example usage used Reactome’s dbID 66247 query CD40 protein. obtain first place? can use rba_reactome_xref map cross-reference (external) IDs Reactome IDs.","code":"## 1 We Supply HGNC ID to find what is the corresponding database ID in Reactome xref_protein <- rba_reactome_xref(\"CD40\") ## 2 As always use str() to inspect the output's structure str(xref_protein, 1) #> List of 19 #> $ dbId : int 66247 #> $ displayName : chr \"UniProt:P25942-1 CD40\" #> $ databaseName : chr \"UniProt\" #> $ identifier : chr \"P25942\" #> $ name :List of 1 #> $ otherIdentifier :List of 1 #> $ url : chr \"http://purl.uniprot.org/uniprot/P25942-1\" #> $ checksum : chr \"BC8776EC2C4A5680\" #> $ comment :List of 1 #> $ description :List of 1 #> $ geneName :List of 1 #> $ isSequenceChanged : logi FALSE #> $ keyword :List of 1 #> $ secondaryIdentifier:List of 1 #> $ sequenceLength : int 277 #> $ chain :List of 1 #> $ variantIdentifier : chr \"P25942-1\" #> $ className : chr \"ReferenceIsoform\" #> $ schemaClass : chr \"ReferenceIsoform\""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"map-cross-reference-ids-to-reactome","dir":"Articles","previous_headings":"Reactome contents services","what":"Map Cross-Reference IDs to Reactome","title":"2.E: Reactome & rbioapi","text":"cross-reference topic, another useful resource. Using rba_reactome_mapping can find Reactome pathways reactions include external ID:","code":"## 1 Again, consider CD40 protein: xref_mapping <- rba_reactome_mapping(id = \"CD40\", resource = \"hgnc\", map_to = \"pathways\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"see-also-in-functions-manuals","dir":"Articles","previous_headings":"","what":"See also in Functions’ manuals","title":"2.E: Reactome & rbioapi","text":"still rbioapi f Reactome content functions covered vignette. brief overview, see functions’ manual detailed guides examples.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"retrieve-reactome-database-information","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"Retrieve Reactome Database information","title":"2.E: Reactome & rbioapi","text":"rba_reactome_version(): Return current Reactome version rba_reactome_diseases(): Retrieve list disease annotated Reactome. rba_reactome_species(): Retrieve list species annotated Reactome.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"general-mapping-querying","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"General Mapping/Querying","title":"2.E: Reactome & rbioapi","text":"rba_reactome_query() rba_reactome_mapping() rba_reactome_xref()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"things-you-can-do-with-a-entities","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"Things you can do with a Entities","title":"2.E: Reactome & rbioapi","text":"reactome_complex_list(): Get list complexes molecule . rba_reactome_complex_subunits(): Get list subunits complex rba_reactome_participant_of(): Get list Reactome sets complexes entity (event, molecule, reaction, pathway etc.) participant . rba_reactome_entity_other_forms()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"things-you-can-do-with-events","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"Things you can do with Events","title":"2.E: Reactome & rbioapi","text":"rba_reactome_event_ancestors() rba_reactome_participants() rba_reactome_pathways_events() rba_reactome_event_ancestors() rba_reactome_orthology() rba_reactome_event_hierarchy(): Retrieve full event hierarchy species.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"pathways","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"Pathways","title":"2.E: Reactome & rbioapi","text":"rba_reactome_pathways_low() rba_reactome_pathways_events() rba_reactome_pathways_top()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"interactors","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"Interactors","title":"2.E: Reactome & rbioapi","text":"rba_reactome_interactors_psicquic() rba_reactome_interactors_static()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"peaple","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"People","title":"2.E: Reactome & rbioapi","text":"rba_reactome_people_name() rba_reactome_people_id()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"export-diagrams-and-events","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"Export diagrams and events","title":"2.E: Reactome & rbioapi","text":"rba_reactome_exporter_diagram() rba_reactome_exporter_overview() rba_reactome_exporter_reaction() rba_reactome_exporter_event()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.E: Reactome & rbioapi","text":"cite Reactome (Please see https://reactome.org/cite): Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Fabregat , Korninger F, Viteri G, Sidiropoulos K, Marin-Garcia P, Ping P, Wu G, Stein L, D’Eustachio P, Hermjakob H. Reactome graph database: Efficient access complex pathway data. PLoS Comput Biol. 2018 Jan 29;14(1):e1005968. doi: 10.1371/journal.pcbi.1005968. eCollection 2018 Jan. PubMed PMID: 29377902. Fabregat , Sidiropoulos K, Viteri G, Marin-Garcia P, Ping P, Stein L, D’Eustachio P, Hermjakob H. Reactome diagram viewer: data structures strategies boost performance. Bioinformatics. 2018 Apr 1;34(7):1208-1214. doi: 10.1093/bioinformatics/btx752. PubMed PMID: 29186351. Fabregat , Sidiropoulos K, Viteri G, Forner O, Marin-Garcia P, Arnau V, D’Eustachio P, Stein L, Hermjakob H. Reactome pathway analysis: high-performance -memory approach. BMC Bioinformatics. 2017 Mar 2;18(1):142. doi: 10.1186/s12859-017-1559-2. PubMed PMID: 28249561. Wu G, Haw R. Functional Interaction Network Construction Analysis Disease Discovery. Methods Mol Biol. 2017;1558:235-253. doi: 10.1007/978-1-4939-6783-4_11. PubMed PMID: 28150241. cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.E: Reactome & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.E: Reactome & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] httr_1.4.7 cli_3.6.3 knitr_1.49 rlang_1.1.4 #> [5] xfun_0.49 textshaping_0.4.1 jsonlite_1.8.9 DT_0.33 #> [9] htmltools_0.5.8.1 ragg_1.3.3 sass_0.4.9 rmarkdown_2.29 #> [13] crosstalk_1.2.1 evaluate_1.0.1 jquerylib_0.1.4 fastmap_1.2.0 #> [17] yaml_2.3.10 lifecycle_1.0.4 compiler_4.4.2 fs_1.6.5 #> [21] htmlwidgets_1.6.4 systemfonts_1.1.0 digest_0.6.37 R6_2.5.1 #> [25] curl_6.0.1 magrittr_2.0.3 bslib_0.8.0 tools_4.4.2 #> [29] pkgdown_2.1.1 cachem_1.1.0 desc_1.4.3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.F: STRING & rbioapi","text":"STRING comprehensive database protein-protein interactions (PPI) version 11.0, covers 24,584,628 proteins 5,090 organisms. Directly quoting paper: STRING database aims collect, score integrate publicly available sources protein–protein interaction information, complement computational predictions. goal achieve comprehensive objective global network, including direct (physical) well indirect (functional) interactions. (source: Szklarczyk, Damian, et al. “STRING v11: protein–protein association networks increased coverage, supporting functional discovery genome-wide experimental datasets.” Nucleic acids research 47.D1 (2019): D607-D613. )","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"note-about-species-argument","dir":"Articles","previous_headings":"","what":"Note about species argument","title":"2.F: STRING & rbioapi","text":"can find argument named “species” every rbioapi STRING function. Providing species argument mandatory, recommended STRING API’s documentation always specify species. exception input proteins’ vector length 100; cases, species argument required. Otherwise, calling function without providing species produce ERROR.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"map-your-ids-to-string-ids","dir":"Articles","previous_headings":"","what":"Map your IDs to STRING IDs","title":"2.F: STRING & rbioapi","text":"Although STRING API resources handle recognize variety identifiers, recommended first map IDs STRING IDs using rbioapi STRING functions.","code":"## 1 We create a variable with our genes' NCBI IDs proteins <- c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\",\"CDK1\",\"KIF23\", \"PLK1\",\"RAC2\",\"RACGAP1\",\"RHOA\",\"RHOB\", \"PHF14\", \"RBM3\") ## 2 Now we map our protein IDs proteins_mapped <- rba_string_map_ids(ids = proteins, species = 9606) ## 3 What we need and will use for the rest of this vignette is the `stringId` column"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"get-interaction-network-of-a-protein-set","dir":"Articles","previous_headings":"","what":"Get interaction network of a protein set","title":"2.F: STRING & rbioapi","text":"can retrieve list interactions proteins set along STRING annotations interaction. may filter results using required_score network_type arguments. See ‘values’ section rba_string_interactions_network function’s manual information returned columns.","code":"int_net <- rba_string_interactions_network(ids = proteins_mapped, species = 9606, required_score = 500)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"get-interaction-partners-of-a-protein-set","dir":"Articles","previous_headings":"","what":"Get interaction partners of a protein set","title":"2.F: STRING & rbioapi","text":"last example, obtained interaction proteins among , wanted get list every protein interact protein(s)? , can use rba_string_interaction_partners:","code":"## Although we supply only one protein ID here (CD40 protein), you can provide a vector of proteins as the input int_partners <- rba_string_interaction_partners(ids = \"9606.ENSP00000361359\", species = 9606, required_score = 900)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"get-network-image-of-a-protein-set","dir":"Articles","previous_headings":"","what":"Get network image of a protein set","title":"2.F: STRING & rbioapi","text":"Let’s go back interaction network. must seen STRING webpages, STRING plots interaction network proteins many customizations available. can also STRING API services. rba_string_network_image function flexible variety options; see function’s manual. Network images - Example 1 Network images - Example 2","code":"## Example 1: graph_1 <- rba_string_network_image(ids = proteins_mapped, image_format = \"image\", species = 9606, save_image = FALSE, required_score = 500, network_flavor = \"confidence\") ## Example 2: graph_2 <- rba_string_network_image(ids = proteins_mapped, image_format = \"image\", species = 9606, save_image = FALSE, required_score = 500, add_color_nodes = 5, add_white_nodes = 5, network_flavor = \"actions\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"enrichment-using-string","dir":"Articles","previous_headings":"","what":"Enrichment using STRING","title":"2.F: STRING & rbioapi","text":"STRING let perform two types enrichments. See STRING’s paper information.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"functional-enrichment","dir":"Articles","previous_headings":"Enrichment using STRING","what":"Functional enrichment","title":"2.F: STRING & rbioapi","text":"first type conventional type, statistically tests supplied gene sets sets annotation. Currently, STRING supports Gene Ontology, KEGG pathways, UniProt Keywords, PubMed publications, Pfam domains, InterPro domains, SMART domains. (source). usual, inspect output using str() function. can see , enrichment results category can found returned list’s elements. Let us see “KEGG” results example. , can see terms KEGG pathways database -represented: Please Note: services supported rbioapi also provide -representation analysis tools. Please see vignette article rbioapi: -Representation (Enrichment) Analysis R (link documentation site) -depth review.","code":"enriched <- rba_string_enrichment(ids = proteins_mapped, species = 9606) str(enriched, max.level = 1) #> List of 14 #> $ COMPARTMENTS :'data.frame': 25 obs. of 10 variables: #> $ Component :'data.frame': 17 obs. of 10 variables: #> $ DISEASES :'data.frame': 11 obs. of 10 variables: #> $ Function :'data.frame': 12 obs. of 10 variables: #> $ InterPro :'data.frame': 3 obs. of 10 variables: #> $ KEGG :'data.frame': 45 obs. of 10 variables: #> $ Keyword :'data.frame': 14 obs. of 10 variables: #> $ NetworkNeighborAL:'data.frame': 5 obs. of 10 variables: #> $ PMID :'data.frame': 100 obs. of 10 variables: #> $ Process :'data.frame': 148 obs. of 10 variables: #> $ RCTM :'data.frame': 59 obs. of 10 variables: #> $ SMART :'data.frame': 1 obs. of 10 variables: #> $ TISSUES :'data.frame': 12 obs. of 10 variables: #> $ WikiPathways :'data.frame': 46 obs. of 10 variables:"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"functional-enrichment-plot","dir":"Articles","previous_headings":"Enrichment using STRING","what":"Functional enrichment Plot","title":"2.F: STRING & rbioapi","text":"addition data frame, can also get plot summarizing enrichment results. API endpoint supports extensive customization plot; please refer rba_string_enrichment_image() function’s manual detailed instructions. perform exact enrichment analysis done , retrieve plot results. Visualization enrichment analysis results","code":"graph_3 <- rba_string_enrichment_image(ids = proteins_mapped, species = 9606, category = \"KEGG\", image_format = \"image\", save_image = FALSE, group_by_similarity = 0.6)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"protein-protein-interaction-enrichment","dir":"Articles","previous_headings":"Enrichment using STRING","what":"Protein-protein interaction enrichment","title":"2.F: STRING & rbioapi","text":"Even without incorporating annotation data, STRING can calculate proteins functionally related. Briefly, STRING accomplishes comparing interactions’ distribution protein-set interactions’ distribution proteome. Read STRING’s paper information.","code":"rba_string_enrichment_ppi(ids = proteins_mapped, species = 9606) #> $number_of_nodes #> [1] 14 #> #> $number_of_edges #> [1] 40 #> #> $average_node_degree #> [1] 5.71 #> #> $local_clustering_coefficient #> [1] 0.694 #> #> $expected_number_of_edges #> [1] 19 #> #> $p_value #> [1] 1.35e-05"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"get-functional-annotations","dir":"Articles","previous_headings":"","what":"Get functional annotations","title":"2.F: STRING & rbioapi","text":"seen , STRING maps proteins multiple annotation sources. can obtain annotation associated proteins without performing enrichment analysis retrieving just significant portion.","code":"annotations <- rba_string_annotations(ids = \"9606.ENSP00000269305\", species = 9606) ## This function returns large results, so the results was not shown in this vignette."},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"see-also-in-functions-manuals","dir":"Articles","previous_headings":"","what":"See also in Functions’ manuals","title":"2.F: STRING & rbioapi","text":"rbioapi STRING functions covered vignette, please check manuals: rba_string_homology_intra() rba_string_homology_inter() rba_string_version()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.F: STRING & rbioapi","text":"cite STRING (Please see https://string-db.org/cgi/?footer_active_subpage=references): Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.F: STRING & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.F: STRING & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] httr_1.4.7 cli_3.6.3 knitr_1.49 rlang_1.1.4 #> [5] xfun_0.49 png_0.1-8 textshaping_0.4.1 jsonlite_1.8.9 #> [9] DT_0.33 htmltools_0.5.8.1 ragg_1.3.3 sass_0.4.9 #> [13] rmarkdown_2.29 grid_4.4.2 crosstalk_1.2.1 evaluate_1.0.1 #> [17] jquerylib_0.1.4 fastmap_1.2.0 yaml_2.3.10 lifecycle_1.0.4 #> [21] compiler_4.4.2 fs_1.6.5 htmlwidgets_1.6.4 systemfonts_1.1.0 #> [25] digest_0.6.37 R6_2.5.1 curl_6.0.1 magrittr_2.0.3 #> [29] bslib_0.8.0 tools_4.4.2 pkgdown_2.1.1 cachem_1.1.0 #> [33] desc_1.4.3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.G: UniProt & rbioapi","text":"Directly quoting UniProt: Universal Protein Resource (UniProt) comprehensive resource protein sequence annotation data. UniProt databases UniProt Knowledgebase (UniProtKB), UniProt Reference Clusters (UniRef), UniProt Archive (UniParc). UniProt consortium host institutions EMBL-EBI, SIB PIR committed long-term preservation UniProt databases. (source: https://www.uniprot.org/help/)","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"search-vs-retrieve","dir":"Articles","previous_headings":"","what":"Search vs Retrieve","title":"2.G: UniProt & rbioapi","text":"rbioapi UniProt functions two variants. one retrieve data using proper accession, second one (_search suffix) search using combination arguments. first demonstrate using example, provide list functions rbioapi. Suppose interested Human CD40 ligand protein, know ’s UniProt accession “P29965”. can simply following: equivalent page UniProt accession (UniProtKB - P29965). didn’t know UniProt accession? simply want perform search using certain parameters? can use function _search suffix: equivalent ‘advanced search’ UniProt web portal. See function rba_uniprot_proteins_search’s manual information. Remember *_search functions, required fill every argument, can use combination arguments see fit build search query. applications *_search variants limited title ‘search’ implies. functions also retrieve search hits response; Thus can use mass-retrieving. see “argument” section functions’ manuals, see many arguments accept vector values. consider following examples:","code":"## 1 We can retrieve CD40 protein's information by qurying it's UniProt accession: cd40 <- rba_uniprot_proteins(accession = \"P29965\") ## 2 We use str() to inspect our object's structure str(cd40, 1) #> List of 13 #> $ accession : chr \"P29965\" #> $ id : chr \"CD40L_HUMAN\" #> $ proteinExistence: chr \"Evidence at protein level\" #> $ info :List of 4 #> $ organism :List of 3 #> $ protein :List of 4 #> $ gene :'data.frame': 1 obs. of 2 variables: #> $ comments :'data.frame': 12 obs. of 10 variables: #> $ features :'data.frame': 64 obs. of 9 variables: #> $ dbReferences :'data.frame': 133 obs. of 4 variables: #> $ keywords :'data.frame': 14 obs. of 1 variable: #> $ references :'data.frame': 25 obs. of 3 variables: #> $ sequence :List of 5 ## 1 From the available arguments, we fill only those which we think is pertinent cd40_search <- rba_uniprot_proteins_search(protein = \"CD40 ligand\", organism = \"human\", reviewed = TRUE) ## 2 As always, we use str() to inspect our object's structure str(cd40_search, 2) #> List of 1 #> $ P29965:List of 13 #> ..$ accession : chr \"P29965\" #> ..$ id : chr \"CD40L_HUMAN\" #> ..$ proteinExistence: chr \"Evidence at protein level\" #> ..$ info :List of 4 #> ..$ organism :List of 3 #> ..$ protein :List of 4 #> ..$ gene :List of 1 #> ..$ comments :List of 12 #> ..$ features :List of 64 #> ..$ dbReferences :List of 133 #> ..$ keywords :List of 14 #> ..$ references :List of 25 #> ..$ sequence :List of 5 ## 1 As the simplest scenario, we can retrieve multiple proteins in one call multi_prs1 <- rba_uniprot_proteins_search(accession = c(\"P04637\", \"P38398\", \"P24941\", \"P60953\", \"P06493\", \"Q02241\")) ## As always, we use str() to inspect our object's structure str(multi_prs1, 1) #> List of 6 #> $ P60953:List of 14 #> $ P24941:List of 14 #> $ P04637:List of 14 #> $ P06493:List of 14 #> $ Q02241:List of 14 #> $ P38398:List of 14 ## 2 Or alternatively, search using Gene names, also we want to exclude isoforms and only retrieve swiss-prot entries multi_prs2 <- rba_uniprot_proteins_search(gene = c(\"KIF23\", \"BRCA1\", \"TP53\", \"CDC42\"), reviewed = TRUE, taxid = 9606, isoform = 0) str(multi_prs2, 1) #> List of 29 #> $ Q9ULZ0:List of 14 #> $ Q02241:List of 14 #> $ P38398:List of 14 #> $ Q12888:List of 14 #> $ Q9HCN2:List of 14 #> $ P04637:List of 14 #> $ Q9Y2B4:List of 13 #> $ Q8IXH6:List of 14 #> $ Q53FA7:List of 14 #> $ A1A5B4:List of 14 #> $ Q9NS56:List of 14 #> $ Q96A56:List of 14 #> $ O14683:List of 14 #> $ Q96S44:List of 14 #> $ Q8NBR0:List of 14 #> $ Q13625:List of 14 #> $ Q7L0Q8:List of 14 #> $ Q5VT25:List of 14 #> $ Q9UKI2:List of 14 #> $ Q6NZY7:List of 14 #> $ Q00587:List of 14 #> $ O14613:List of 14 #> $ Q6DT37:List of 14 #> $ Q9H3Q1:List of 14 #> $ Q07960:List of 14 #> $ Q9NRR8:List of 14 #> $ Q9NRR3:List of 14 #> $ P60953:List of 14 #> $ Q9Y5S2:List of 14 ## 3 Search for every proteins with chemokines keyword multi_prs3 <- rba_uniprot_proteins_search(keyword = \"chemokines\") str(multi_prs3, 1) #> List of 17 #> $ P09703:List of 15 #> $ P0DTM9:List of 14 #> $ Q6SW98:List of 15 #> $ P33854:List of 14 #> $ P0DSV7:List of 15 #> $ P19063:List of 14 #> $ P16849:List of 15 #> $ P69332:List of 15 #> $ P24766:List of 15 #> $ Q98314:List of 15 #> $ P69333:List of 15 #> $ P07562:List of 14 #> $ F5HF62:List of 14 #> $ P34016:List of 14 #> $ P21064:List of 14 #> $ P0DSV8:List of 15 #> $ F5HBX1:List of 14 ## 4 Search for every protein of \"SARS-CoV-2\" virus in Swiss-Prot multi_prs4 <- rba_uniprot_proteins_search(organism = \"SARS-CoV-2\", reviewed = TRUE) str(multi_prs4, 1) #> List of 17 #> $ P0DTD3 :List of 14 #> $ P0DTC6 :List of 14 #> $ P0DTG0 :List of 13 #> $ P0DTC7 :List of 14 #> $ P0DTC2 :List of 14 #> $ P0DTC8 :List of 14 #> $ P0DTC4 :List of 14 #> $ A0A663DJA2:List of 14 #> $ P0DTC9 :List of 14 #> $ P0DTC5 :List of 14 #> $ P0DTC3 :List of 14 #> $ P0DTD8 :List of 14 #> $ P0DTD2 :List of 14 #> $ P0DTF1 :List of 13 #> $ P0DTD1 :List of 14 #> $ P0DTC1 :List of 13 #> $ P0DTG1 :List of 13"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"functions-with-star-search-variant","dir":"Articles","previous_headings":"","what":"Functions with *_search variant","title":"2.G: UniProt & rbioapi","text":"search variants limited . list function retrieve search variants. See manuals detailed guides examples. rba_uniprot_proteins() & rba_uniprot_proteins_search() rba_uniprot_features() & rba_uniprot_features_search() rba_uniprot_variation() & rba_uniprot_variation_search() rba_uniprot_proteomics() & rba_uniprot_proteomics_search() rba_uniprot_antigens() & rba_uniprot_antigens_search() rba_uniprot_epitope() & rba_uniprot_epitope_search() rba_uniprot_rna_edit() & rba_uniprot_rna_edit_search() rba_uniprot_proteomes() & rba_uniprot_proteomes_search() rba_uniprot_ptm() & rba_uniprot_ptm_search() rba_uniprot_mutagenesis() & rba_uniprot_mutagenesis_search() rba_uniprot_proteomics_hpp() & rba_uniprot_proteomics_hpp_search() rba_uniprot_proteomics_non_ptm() & rba_uniprot_proteomics_non_ptm_search() rba_uniprot_proteomics_ptm() & rba_uniprot_proteomics_ptm_search() rba_uniprot_genecentric() & rba_uniprot_genecentric_search() rba_uniprot_uniparc() & rba_uniprot_uniparc_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"uniprot-functions-categories","dir":"Articles","previous_headings":"","what":"UniProt functions categories","title":"2.G: UniProt & rbioapi","text":"UniProt API endpoints organized 5 group. categories rbioapi functions correspond one. See functions’ manuals details.","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"proteins-proteins","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"Proteins:","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_proteins() rba_uniprot_proteins_search() rba_uniprot_proteins_crossref()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"proteins-features","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"Features","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_features() rba_uniprot_features_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"proteins-variation","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"Variation","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_variation() rba_uniprot_variation_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"antigens","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"Antigens","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_antigens() rba_uniprot_antigens_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"epitopes","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"Epitopes","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_epitope() rba_uniprot_epitope_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"mutagenesis","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"Mutagenesis","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_mutagenesis() rba_uniprot_mutagenesis_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"rna-editing","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"RNA-Editing","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_rna_edit() rba_uniprot_rna_edit_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"proteomics","dir":"Articles","previous_headings":"UniProt functions categories","what":"Proteomics","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_proteomics_species() rba_uniprot_proteomics_hpp() rba_uniprot_proteomics_hpp_search() rba_uniprot_proteomics_non_ptm() rba_uniprot_proteomics_non_ptm_search() rba_uniprot_proteomics_ptm() rba_uniprot_proteomics_ptm_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"proteomes","dir":"Articles","previous_headings":"UniProt functions categories","what":"Proteomes","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_proteomes() rba_uniprot_proteomes_search() rba_uniprot_genecentric() rba_uniprot_genecentric_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"taxonomy","dir":"Articles","previous_headings":"UniProt functions categories","what":"Taxonomy","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_taxonomy() rba_uniprot_taxonomy_lca() rba_uniprot_taxonomy_lineage() rba_uniprot_taxonomy_name() rba_uniprot_taxonomy_path() rba_uniprot_taxonomy_relationship()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"coordinates","dir":"Articles","previous_headings":"UniProt functions categories","what":"Coordinates","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_coordinates() rba_uniprot_coordinates_search() rba_uniprot_coordinates_location() rba_uniprot_coordinates_sequence() rba_uniprot_genome_coordinates_sequence()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"uniparc","dir":"Articles","previous_headings":"UniProt functions categories","what":"UniParc","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_uniparc() rba_uniprot_uniparc_search() rba_uniprot_uniparc_bestguess() rba_uniprot_uniparc_sequence()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.G: UniProt & rbioapi","text":"cite UniProt (Please see https://www.uniprot.org/help/publications): UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.G: UniProt & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.G: UniProt & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] digest_0.6.37 desc_1.4.3 R6_2.5.1 fastmap_1.2.0 #> [5] xfun_0.49 cachem_1.1.0 knitr_1.49 htmltools_0.5.8.1 #> [9] rmarkdown_2.29 lifecycle_1.0.4 cli_3.6.3 sass_0.4.9 #> [13] pkgdown_2.1.1 textshaping_0.4.1 jquerylib_0.1.4 systemfonts_1.1.0 #> [17] compiler_4.4.2 httr_1.4.7 tools_4.4.2 ragg_1.3.3 #> [21] curl_6.0.1 evaluate_1.0.1 bslib_0.8.0 yaml_2.3.10 #> [25] jsonlite_1.8.9 rlang_1.1.4 fs_1.6.5 htmlwidgets_1.6.4"},{"path":"https://rbioapi.moosa-r.com/authors.html","id":null,"dir":"","previous_headings":"","what":"Authors","title":"Authors and Citation","text":"Moosa Rezwani. Author, maintainer.","code":""},{"path":"https://rbioapi.moosa-r.com/authors.html","id":"citation","dir":"","previous_headings":"","what":"Citation","title":"Authors and Citation","text":"Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":"@Article{, title = {rbioapi: User-Friendly R Interface to Biologic Web Services' API}, author = {Moosa Rezwani and Ali Akbar Pourfathollah and Farshid Noorbakhsh}, journal = {Bioinformatics}, volume = {38}, number = {10}, pages = {2952-2953}, year = {2022}, month = {03}, issn = {1367-4803}, doi = {10.1093/bioinformatics/btac172}, }"},{"path":"https://rbioapi.moosa-r.com/index.html","id":"rbioapi-user-friendly-r-interface-to-biologic-web-services-api","dir":"","previous_headings":"","what":"User-Friendly R Interface to Biologic Web Services' API","title":"User-Friendly R Interface to Biologic Web Services' API","text":"Moosa Rezwani 2023-07-27","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/index.html","id":"what-does-rbioapi-do","dir":"","previous_headings":"","what":"What does rbioapi do?","title":"User-Friendly R Interface to Biologic Web Services' API","text":"Currently fully supports Enrichr, JASPAR, miEAA, PANTHER, Reactome, STRING, UniProt! goal rbioapi provide user-friendly consistent interface biological databases services: way insulates user technicalities using web services API creates unified easy--use interface biological medical web services. rbioapi, need technical knowledge web services API learn work new package every biologic service database. ongoing project; New databases services added periodically. Feel free suggest databases services often use.","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"what-is-supported-by-rbioapi","dir":"","previous_headings":"","what":"What is Supported by rbioapi?","title":"User-Friendly R Interface to Biologic Web Services' API","text":"rbioapi dedicated Biological Medical databases web services. Currently, rbioapi supports covers every API resources following services: (alphabetical order): CRAN (Stable) version: (https://cran.r-project.org/package=rbioapi) Enrichr (rbioapi vignette article) (new) JASPAR (rbioapi vignette article) (new) miEAA (rbioapi vignette article) PANTHER (rbioapi vignette article) Reactome (rbioapi vignette article) STRING (rbioapi vignette article) UniProt (rbioapi vignette article) Github (Developmental) version: (https://github.com/moosa-r/rbioapi/): currently none services dedicated vignette article. However, article, write general framework rbioapi. Make sure check vignette article service learn use . Note : rbioapi ongoing project. New databases services implemented periodically order gradually make package comprehensive possible. see often using certain database/service? Feel free suggest database/service creating issue GitHub repository. appreciate suggestions.","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"how-to-install","dir":"","previous_headings":"","what":"How to install?","title":"User-Friendly R Interface to Biologic Web Services' API","text":"can install stable release version rbioapi CRAN : However, CRAN version released every 1-2 months, can install recent (development) version GitHub : Now, can load package:","code":"install.packages(\"rbioapi\") install.packages(\"remotes\") remotes::install_github(\"moosa-r/rbioapi\") library(rbioapi)"},{"path":"https://rbioapi.moosa-r.com/index.html","id":"naming-conventions","dir":"","previous_headings":"","what":"Naming conventions","title":"User-Friendly R Interface to Biologic Web Services' API","text":"make namespace organized, functions named following pattern: example, rba_string_version() call STRING’s version resource. Thus, version, rbioapi function one following naming schema: rba_enrichr_* rba_jaspar_* rba_mieaa_* rba_panther_* rba_reactome_* rba_string_* rba_uniprot_* three exceptions: rba_options(), rba_connection_test(), rba_pages(); helper functions. later.","code":"rba_[service_name]_[resource_name] rba_string_version() #> Retrieving the STRING database version and address used by rbioapi. #> $string_version #> [1] \"11.5\" #> #> $stable_address #> [1] \"https://version-11-5.string-db.org\""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"changing-the-options","dir":"","previous_headings":"","what":"Changing the options","title":"User-Friendly R Interface to Biologic Web Services' API","text":"provide control, multiple options implemented. See manual rba_options() function full description available options. short, options govern rbioapi’s connection servers (e.g. timeout, retry) options modify experience rbioapi (e.g. verbose, diagnostics, save_file). two ways may use change option. Also, can get table available rbioapi options current values calling rba_options()without argument: Now, let us consider ways can alter settings:","code":"rba_options() #> rbioapi_option current_value allowed_value #> 1 diagnostics FALSE Logical (TRUE/FALSE) #> 2 dir_name rbioapi Character #> 3 progress FALSE Logical (TRUE/FALSE) #> 4 retry_max 0 Numeric (0 or greater) #> 5 retry_wait 10 Numeric (0 or greater) #> 6 save_file FALSE Logical (TRUE/FALSE) #> 7 skip_error TRUE Logical (TRUE/FALSE) #> 8 timeout 30 Numeric (0.1 or greater) #> 9 verbose TRUE Logical (TRUE/FALSE)"},{"path":"https://rbioapi.moosa-r.com/index.html","id":"change-the-option-globally","dir":"","previous_headings":"","what":"Change the option globally","title":"User-Friendly R Interface to Biologic Web Services' API","text":"Changing option globally means rest R session, rbioapi function respect changed option. , use rba_options(). argument function corresponds certain option; Thus running function desired new values, globally alter rbioapi option. example:","code":"rba_options(save_file = TRUE) ## From now on, the raw file of server's response will be saved to your working directory. rba_options(verbose = FALSE) ## From now on, the package will be quiet."},{"path":"https://rbioapi.moosa-r.com/index.html","id":"change-the-option-only-within-a-function-call","dir":"","previous_headings":"","what":"Change the option only within a function call","title":"User-Friendly R Interface to Biologic Web Services' API","text":"can pass additional arguments rbioapi function using “ellipsis” (familiar … dot dot dot!). Meaning can call function additional arguments ‘option = value’ pair. way, changes options confined within particular function call. example:","code":"## Save the server's raw response file: x <- rba_reactome_species(only_main = TRUE, save_file = \"reactome_species.json\") ## Also, in the case of connection failure, retry up to 10 times: x <- rba_reactome_species(only_main = TRUE, save_file = \"reactome_species.json\", retry_max = 10) ## Run these codes in your own R session to see the difference. ## show internal diagnostics boring details x <- rba_uniprot_proteins_crossref(db_id = \"CD40\", db_name = \"HGNC\", diagnostics = TRUE) ## The next function you call, will still use the default rbioapi options x <- rba_uniprot_proteins_crossref(db_id = \"CD40\", db_name = \"HGNC\")"},{"path":"https://rbioapi.moosa-r.com/index.html","id":"connection-test","dir":"","previous_headings":"","what":"Connection test","title":"User-Friendly R Interface to Biologic Web Services' API","text":"second exception functions’ naming schema rba_connection_test(). Run simple function check connection supported services/databases. encounter errors using rbioapi, kindly run function make sure internet connection servers fine.","code":"rba_connection_test(print_output = TRUE) #> Checking Your connection to the Databases currently supported by rbioapi: #> --->>> Internet : #> +++ Connected to the Internet. #> --->>> Enrichr : #> +++ The server is responding. #> --->>> Ensembl : #> +++ The server is responding. #> --->>> JASPAR : #> +++ The server is responding. #> --->>> miEAA : #> +++ The server is responding. #> --->>> PANTHER : #> +++ The server is responding. #> --->>> Reactome Content Service : #> +++ The server is responding. #> --->>> Reactome Analysis Service : #> +++ The server is responding. #> --->>> STRING : #> +++ The server is responding. #> --->>> UniProt : #> +++ The server is responding."},{"path":"https://rbioapi.moosa-r.com/index.html","id":"iterating-over-paginated-results","dir":"","previous_headings":"","what":"Iterating over paginated results","title":"User-Friendly R Interface to Biologic Web Services' API","text":"API resources return paginated responses. particularly common API resources return potentially large responses. rbioapi, cases, arguments “page_number” (default value 1) -API resource allows- “page_size”. save time, may use rba_pages(). function iterate pages specified. Take rba_uniprot_taxonomy_name example. function allows search taxonomic nodes UniProt. response can potentially huge size, UniProt returns paginated response. example, search nodes contain “adenovirus”, large number hits: can see, server returned first page response, retrieve pages, make separate calls change “page_number” argument within call, simply use rba_pages() demonstrated : can see, done : Wrap function call qoute() enter input rba_pages(). Replace argument want iterate , string format: “pages:start:end”. example, supplied page_number = “pages:1:3” get responses pages 1 3.","code":"adeno <- rba_uniprot_taxonomy_name(name = \"adenovirus\", search_type = \"contain\", page_number = 1) str(adeno, max.level = 2) #> List of 2 #> $ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ taxonomyId : int [1:200] 10509 10510 10511 10512 10513 10514 10515 10519 10521 10522 ... #> ..$ mnemonic : chr [1:200] \"9ADEN\" \"ADEB3\" \"ADEB7\" \"9ADEN\" ... #> ..$ scientificName: chr [1:200] \"Mastadenovirus\" \"Bovine adenovirus B serotype 3\" \"Bovine adenovirus 7\" \"Canine adenovirus 1\" ... #> ..$ rank : chr [1:200] \"genus\" \"no rank\" \"no rank\" \"no rank\" ... #> ..$ superregnum : chr [1:200] \"V\" \"V\" \"V\" \"V\" ... #> ..$ hidden : logi [1:200] FALSE TRUE TRUE TRUE TRUE TRUE ... #> ..$ commonName : chr [1:200] NA \"BAdV-3\" \"BAdV-7\" NA ... #> ..$ synonym : chr [1:200] NA \"Mastadenovirus bos3\" NA NA ... #> $ pageInfo :List of 3 #> ..$ resultsPerPage: int 200 #> ..$ currentPage : int 1 #> ..$ totalRecords : int 985 adeno_pages = rba_pages(quote(rba_uniprot_taxonomy_name(name = \"adenovirus\", search_type = \"contain\", page_number = \"pages:1:3\"))) ## You can inspect the structure of the response: str(adeno_pages, max.level = 2) #> List of 3 #> $ page_1:List of 2 #> ..$ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ pageInfo :List of 3 #> $ page_2:List of 2 #> ..$ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ pageInfo :List of 3 #> $ page_3:List of 2 #> ..$ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ pageInfo :List of 3"},{"path":"https://rbioapi.moosa-r.com/index.html","id":"how-and-what-to-cite","dir":"","previous_headings":"","what":"How and what to cite?","title":"User-Friendly R Interface to Biologic Web Services' API","text":"rbioapi interface databases services. Thus, used rbioapi published research, addition kindly citing rbioapi, make sure fully properly cite databases/services used. Suggested citations added functions’ manuals, “references” section; Nevertheless, user’s responsibility check proper citations properly cite database/services used.","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"how-to-cite-rbioapi","dir":"","previous_headings":"","what":"How to cite rbioapi","title":"User-Friendly R Interface to Biologic Web Services' API","text":"Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"how-to-cite-the-databases-and-web-services","dir":"","previous_headings":"","what":"How to cite the databases and web services","title":"User-Friendly R Interface to Biologic Web Services' API","text":"cite Enrichr. (See Enrichr website) cite JASPAR. (See JASPAR website) cite miEAA. (See miEAA website) cite PANTHER. (See PANTHER website) cite Reactome. (See Reactome website) cite STRING. (See STRING website) cite UniProt. (See UniProt website)","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"code-of-conduct","dir":"","previous_headings":"","what":"Code of conduct","title":"User-Friendly R Interface to Biologic Web Services' API","text":"package, rbioapi, unofficial interface implementation associated, endorsed, officially connected way original databases web services. creators maintainers rbioapi independent entities official relationship databases web services. using rbioapi, remember querying data web services; please considerate. Never flood server requests, need download unreasonably large volumes data, directly downloading databases supplied services may better alternative. see rate-limited server (HTTP 429 Many Requests response status code), know sending requests server interprets normal behavior, please seek methods use Sys.sleep() requests.","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"what-next","dir":"","previous_headings":"","what":"What next?","title":"User-Friendly R Interface to Biologic Web Services' API","text":"supported service dedicated vignette article. Make sure check . Enrichr JASPAR miEAA PANTHER Reactome STRING UniProt also adding vignette articles focusing tasks workflows: rbioapi: Enrichment (-Representation) Analysis R","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"design-philosophy-of-rbioapi","dir":"","previous_headings":"","what":"Design philosophy of rbioapi","title":"User-Friendly R Interface to Biologic Web Services' API","text":"learn design philosophy concepts behind developing rbioapi, please read paper Bioinformatics: rbioapi: user-friendly R interface biologic web services’ API","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"links","dir":"","previous_headings":"","what":"Links","title":"User-Friendly R Interface to Biologic Web Services' API","text":"article rbioapi documentation site Functions references rbioapi documentation site","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"session-info","dir":"","previous_headings":"","what":"Session info","title":"User-Friendly R Interface to Biologic Web Services' API","text":"","code":"#> R version 4.3.1 (2023-06-16 ucrt) #> Platform: x86_64-w64-mingw32/x64 (64-bit) #> Running under: Windows 11 x64 (build 22621) #> #> Matrix products: default #> #> #> locale: #> [1] LC_COLLATE=English_United States.utf8 #> [2] LC_CTYPE=English_United States.utf8 #> [3] LC_MONETARY=English_United States.utf8 #> [4] LC_NUMERIC=C #> [5] LC_TIME=English_United States.utf8 #> #> time zone: Europe/Brussels #> tzcode source: internal #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.7.9 #> #> loaded via a namespace (and not attached): #> [1] digest_0.6.33 R6_2.5.1 fastmap_1.1.1 xfun_0.39 #> [5] knitr_1.43 htmltools_0.5.5 rmarkdown_2.23 cli_3.6.1 #> [9] compiler_4.3.1 httr_1.4.6 rstudioapi_0.15.0 tools_4.3.1 #> [13] curl_5.0.1 evaluate_0.21 yaml_2.3.7 rlang_1.1.1 #> [17] jsonlite_1.8.7"},{"path":"https://rbioapi.moosa-r.com/reference/rba_connection_test.html","id":null,"dir":"Reference","previous_headings":"","what":"Test if the Supported Services Are Responding — rba_connection_test","title":"Test if the Supported Services Are Responding — rba_connection_test","text":"Run function test internet connectivity device current status supported Services.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_connection_test.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Test if the Supported Services Are Responding — rba_connection_test","text":"","code":"rba_connection_test(print_output = TRUE, diagnostics = FALSE)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_connection_test.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Test if the Supported Services Are Responding — rba_connection_test","text":"print_output (Logical) (default = TRUE) Send tests' output console? diagnostics (Logical) (default = FALSE) Show diagnostics detailed messages internal information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_connection_test.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Test if the Supported Services Are Responding — rba_connection_test","text":"Connection test supported servers displayed console results invisibly returned list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_connection_test.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Test if the Supported Services Are Responding — rba_connection_test","text":"function attempts send simple query supported services. service successfully responded, informed success message; , content error reported . Please run function encounter errors using rbioapi. Also, need contact support, kindly call function 'diagnostic = TRUE' include output messages support request.","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_connection_test.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Test if the Supported Services Are Responding — rba_connection_test","text":"","code":"# \\donttest{ rba_connection_test() # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":null,"dir":"Reference","previous_headings":"","what":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"function provides convenient one-step wrapper performing enrichment analysis given gene list using Enrichr. simplifies process internally calling necessary functions correct order. See details section information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"","code":"rba_enrichr( gene_list, description = NULL, gene_set_library = \"all\", regex_library_name = TRUE, organism = \"human\", background_genes = NULL, progress_bar = TRUE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"gene_list character vector Entrez gene symbols test genes. description (optional) description associated uploaded gene-set Enrichr servers. gene_set_library One : \"\" select available Enrichr gene-set libraries. gene-set library name. can retrieve available options given species using rba_enrichr_libs. regex_library_name = TRUE, partially-matching name regex pattern correspond one Enrichr library names. regex_library_name logical: TRUE (default) supplied gene_set_library considered regex pattern. FALSE, gene_set_library considered exact match. organism (default = \"human\") model organism version Enrichr use? Available options : \"human\", (H. sapiens & M. musculus), \"fly\" (D. melanogaster), \"yeast\" (S. cerevisiae), \"worm\" (C. elegans) \"fish\" (D. rerio). background_genes character vector Entrez gene symbols background genes. progress_bar logical: (default = TRUE) multiple Enrichr libraries selected, progress bar displayed? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"list containing data frames enrichment results supplied gene-list selected Enrichr libraries.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"function call rba_enrichr_*** functions following order: (necessary) Call rba_enrichr_libs obtain list available libraries Enrichr given organism. Call rba_enrichr_add_list upload gene-list obtain 'user list ID'. (necessary) Call rba_enrichr_add_background upload background gene-list obtain 'background list ID'. Call rba_enrichr_enrich perform enrichment analysis gene-list one multiple Enrichr libraries","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"\"GET https://maayanlab.cloud/Enrichr/datasetStatistics\" \"POST https://maayanlab.cloud/Enrichr/addList\" \"POST https://maayanlab.cloud/speedrichr/api/addList\" \"POST https://maayanlab.cloud/speedrichr/api/addbackground\" \"GET https://maayanlab.cloud/Enrichr/enrich\" \"POST https://maayanlab.cloud/speedrichr/api/backgroundenrich\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"","code":"if (FALSE) { # \\dontrun{ rba_enrichr(gene_list = c(\"TP53\", \"TNF\", \"EGFR\")) } # } # \\donttest{ rba_enrichr(gene_list = c(\"TP53\", \"TNF\", \"EGFR\"), gene_set_library = \"GO_Molecular_Function_2017\", regex_library_name = FALSE) # } # \\donttest{ rba_enrichr(gene_list = c(\"TP53\", \"TNF\", \"EGFR\"), gene_set_library = \"go\", regex_library_name = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":null,"dir":"Reference","previous_headings":"","what":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"addition main gene list, can also submit background gene list Enrichr. gene list can used later compute statistics enrichment analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"","code":"rba_enrichr_add_background(background_genes, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"background_genes character vector Entrez gene symbols background genes. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"list unique IDs uploaded background gene list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"Please note rba_enrichr provides one-step convenient way automatically handle required function calls needed perform gene set enrichment analysis Enrichr.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"\"POST https://maayanlab.cloud/speedrichr/api/addbackground\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"","code":"# \\donttest{ my_background_genes <- c( \"NSUN3\", \"POLRMT\", \"NLRX1\", \"SFXN5\", \"ZC3H12C\", \"SLC25A39\", \"ARSG\", \"DEFB29\", \"PCMTD2\", \"ACAA1A\", \"LRRC1\", \"2810432D09RIK\", \"SEPHS2\", \"SAC3D1\", \"TMLHE\", \"LOC623451\", \"TSR2\", \"PLEKHA7\", \"GYS2\", \"ARHGEF12\", \"HIBCH\", \"LYRM2\", \"ZBTB44\", \"ENTPD5\", \"RAB11FIP2\", \"LIPT1\", \"INTU\", \"ANXA13\", \"KLF12\", \"SAT2\", \"GAL3ST2\", \"VAMP8\", \"FKBPL\", \"AQP11\", \"TRAP1\", \"PMPCB\", \"TM7SF3\", \"RBM39\", \"BRI3\", \"KDR\", \"ZFP748\", \"NAP1L1\", \"DHRS1\", \"LRRC56\", \"WDR20A\", \"STXBP2\", \"KLF1\", \"UFC1\", \"CCDC16\", \"9230114K14RIK\", \"RWDD3\", \"2610528K11RIK\") rba_enrichr_add_background(background_genes = my_background_genes) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":null,"dir":"Reference","previous_headings":"","what":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"function uploads gene list Enrichr retrieves unique 'user list ID' required performing enrichment analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"","code":"rba_enrichr_add_list( gene_list, description = NULL, organism = \"human\", speedrichr = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"gene_list character vector Entrez gene symbols test genes. description (optional) description associated uploaded gene-set Enrichr servers. organism (default = \"human\") model organism version Enrichr use? Available options : \"human\", (H. sapiens & M. musculus), \"fly\" (D. melanogaster), \"yeast\" (S. cerevisiae), \"worm\" (C. elegans) \"fish\" (D. rerio). speedrichr logical (default = FALSE) Set TRUE use gene list background list; otherwise, set FALSE. available human libraries. Refer details section information. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"list unique IDs uploaded gene list. `userListId` ID required later steps.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"Enrichr uses separate APIs analysis without background gene list. Set `speedrichr = TRUE` gene list used background gene list; otherwise, set FALSE. Gene lists submitted `speedrichr = TRUE` can analyzed background set, submitted `speedrichr = FALSE` can analyzed without one. Currently, background-based enrichment supported human libraries. Please note rba_enrichr provides one-step convenient way automatically handle required function calls needed perform gene set enrichment analysis Enrichr.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"\"POST https://maayanlab.cloud/Enrichr/addList\" \"POST https://maayanlab.cloud/speedrichr/api/addList\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"","code":"# \\donttest{ rba_enrichr_add_list(gene_list = c(\"TP53\", \"TNF\", \"EGFR\"), description = \"tumoral genes\", speedrichr = FALSE) # } # \\donttest{ rba_enrichr_add_list(gene_list = c(\"RAG1\", \"RAG2\", \"DNTT\", \"LIG4\", \"ARTEMIS\"), description = \"TCR rearrangment\", speedrichr = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Enrichr Enrichment Results — rba_enrichr_enrich","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"function retrieves enrichment analysis results supplied `user_list_id` one multiple Enrichr libraries.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"","code":"rba_enrichr_enrich( user_list_id, gene_set_library = \"all\", regex_library_name = TRUE, organism = \"human\", background_id = NULL, progress_bar = TRUE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"user_list_id ID returned uploading gene list using rba_enrichr_add_list, `speedrichr` set TRUE FALSE depending whether intend analyze gene list without background gene list, respectively. gene_set_library One : \"\" select available Enrichr gene-set libraries. gene-set library name. can retrieve available options given species using rba_enrichr_libs. regex_library_name = TRUE, partially-matching name regex pattern correspond one Enrichr library names. regex_library_name logical: TRUE (default) supplied gene_set_library considered regex pattern. FALSE, gene_set_library considered exact match. organism (default = \"human\") model organism version Enrichr use? Available options : \"human\", (H. sapiens & M. musculus), \"fly\" (D. melanogaster), \"yeast\" (S. cerevisiae), \"worm\" (C. elegans) \"fish\" (D. rerio). `background_id` provided, available option \"human\". background_id ID returned uploading background gene list using rba_enrichr_add_background progress_bar logical: (default = TRUE) multiple Enrichr libraries selected, progress bar displayed? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"list containing data frames enrichment results supplied gene-list selected Enrichr libraries.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"`background_id` supplied, function interact speedrichr API. case, `user_list_id` must obtained rba_enrichr_add_list call `speedrichr` parameter set `TRUE`. Additionally, feature available \"human\" organism. Please note rba_enrichr provides one-step convenient way automatically handle required function calls needed perform gene set enrichment analysis Enrichr.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"\"GET https://maayanlab.cloud/Enrichr/enrich\" \"POST https://maayanlab.cloud/speedrichr/api/backgroundenrich\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"","code":"if (FALSE) { # \\dontrun{ rba_enrichr_enrich(user_list_id = \"11111\") } # } if (FALSE) { # \\dontrun{ rba_enrichr_enrich(user_list_id = \"11111\", gene_set_library = \"GO_Molecular_Function_2017\", regex_library_name = FALSE) } # } if (FALSE) { # \\dontrun{ rba_enrichr_enrich(user_list_id = \"11111\", gene_set_library = \"go\", regex_library_name = TRUE) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":null,"dir":"Reference","previous_headings":"","what":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"function search gene retrieve list Enrichr Terms contains gene.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"","code":"rba_enrichr_gene_map(gene, categorize = FALSE, organism = \"human\", ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"gene character: Entrez gene symbol. categorize logical: category information included? organism (default = \"human\") model organism version Enrichr use? Available options : \"human\", (H. sapiens & M. musculus), \"fly\" (D. melanogaster), \"yeast\" (S. cerevisiae), \"worm\" (C. elegans) \"fish\" (D. rerio). ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"nested list containing search results supplied gene.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"\"GET https://maayanlab.cloud/Enrichr/genemap\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"","code":"# \\donttest{ rba_enrichr_gene_map(gene = \"p53\") # } # \\donttest{ rba_enrichr_gene_map(gene = \"p53\", categorize = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":null,"dir":"Reference","previous_headings":"","what":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"function retrieves list libraries available Enrichr along associated statistics. library represents collection gene sets can used enrichment analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"","code":"rba_enrichr_libs(organism = \"human\", store_in_options = TRUE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"organism (default = \"human\") model organism version Enrichr use? Available options : \"human\", (H. sapiens & M. musculus), \"fly\" (D. melanogaster), \"yeast\" (S. cerevisiae), \"worm\" (C. elegans) \"fish\" (D. rerio). store_in_options logical: (default = TRUE) list available Enrichr libraries saved global option? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"data frame names available library Enrichr statistics.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"default, function save library names global option (\"rba_enrichr_libs\") Enrichr functions internally require names Enrichr libraries. call function per R session argument 'store_in_options = TRUE' using rba_enrichr_enrich rba_enrichr. However, explicitly call , rbioapi automatically execute function background needed. Please note rba_enrichr provides one-step convenient way automatically handle required function calls needed perform gene set enrichment analysis Enrichr.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"\"GET https://maayanlab.cloud/Enrichr/datasetStatistics\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"","code":"# \\donttest{ rba_enrichr_libs() # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":null,"dir":"Reference","previous_headings":"","what":"View an Uploaded Gene List — rba_enrichr_view_list","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"Retrieve list uploaded genes given 'user list ID'.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"","code":"rba_enrichr_view_list( user_list_id, organism = \"human\", speedrichr = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"user_list_id user list ID returned uploading gene list using rba_enrichr_add_list organism (default = \"human\") model organism version Enrichr use? Available options : \"human\", (H. sapiens & M. musculus), \"fly\" (D. melanogaster), \"yeast\" (S. cerevisiae), \"worm\" (C. elegans) \"fish\" (D. rerio). speedrichr logical (default = FALSE) upload gene list speedrichr API? (.e. intend use gene list along background gene list?) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"list containing genes description associated supplied user_list_id.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"\"GET https://maayanlab.cloud/Enrichr/view\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"","code":"if (FALSE) { # \\dontrun{ rba_enrichr_view_list(user_list_id = 11111) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":null,"dir":"Reference","previous_headings":"","what":"List collections available in JASPAR — rba_jaspar_collections","title":"List collections available in JASPAR — rba_jaspar_collections","text":"JASPAR organizes matrix profiles collections. Using function, can retrieve list available collections JASPAR release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List collections available in JASPAR — rba_jaspar_collections","text":"","code":"rba_jaspar_collections(release = 2024, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List collections available in JASPAR — rba_jaspar_collections","text":"release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List collections available in JASPAR — rba_jaspar_collections","text":"data frame collections' names URLs.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List collections available in JASPAR — rba_jaspar_collections","text":"\"GET https://jaspar.elixir./api/v1/collections/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List collections available in JASPAR — rba_jaspar_collections","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List collections available in JASPAR — rba_jaspar_collections","text":"","code":"# \\donttest{ rba_jaspar_collections(release = 2024) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":null,"dir":"Reference","previous_headings":"","what":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"Using function can list matrix profiles available collection JASPAR release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"","code":"rba_jaspar_collections_matrices( collection, release = 2024, only_last_version = FALSE, search = NULL, order = NULL, page_size = 1000, page = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"collection JASPAR Collection's name. See JASPAR Collections information. accepted values : \"CORE\", \"CNE\", \"PHYLOFACTS\", \"SPLICE\", \"POLII\", \"FAM\", \"PBM\", \"PBM_HOMEO\", \"PBM_HLH\", \"UNVALIDATED\". release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. only_last_version Logical: (default = FALSE) TRUE, latest version matrix profile returned. search Character: search term. order Character: character string vector character strings field names used order results. Providing multiple field names supported. can alsoa use prefix \"-\" field name indicate reverse ordering. page_size Numeric: (default = 1000) resource returns paginated results. maximum numbers results want retrieve per page? Accepted values 1 1000. page Numeric: page results retrieve? accepted values depend page size number results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"list contains data frame information matrix profiles available collection.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"results paginated. can control page's size number function's arguments. Also, can use rba_pages automatically iterate multiple pages.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"\"GET https://jaspar.elixir./api/v1/collections/{collection}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"","code":"# \\donttest{ rba_jaspar_collections_matrices(collection = \"CORE\", release = 2024, page_size = 100, page = 2) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":null,"dir":"Reference","previous_headings":"","what":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"Using function can retrieve Position Frequency Matrices (PFM) associated matrix profile Identifier along details annotations. base ID (.e. without version suffix) supplied, latest version returned.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"","code":"rba_jaspar_matrix(matrix_id, file_format = NULL, save_to = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"matrix_id Character: matrix profile Identifier. \"base_id.version\" naming schema. file_format Character: Instead returning R object, can directly download profile matrix file format. Supported formats : \"yaml\", \"jaspar\", \"transfac\", \"meme\" \"pfm\" save_to NULL Character: NULL: (file_format supplied) Save file automatically-generated path. Character string: valid file directory path save file . ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"list contains PFM along details annotations. file_format supplied, un-parsed character string file's content.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"\"GET https://jaspar.elixir./api/v1/matrix/{matrix_id}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"","code":"# \\donttest{ rba_jaspar_matrix(\"MA0600.2\") # } if (FALSE) { # \\dontrun{ rba_jaspar_matrix(matrix_id = \"MA0600.2\", file_format = \"meme\", save_to = \"my_matrix.meme\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"can use function list JASPAR matrix profiles match search query, run function without arguments return list every matrix profile available latest release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"","code":"rba_jaspar_matrix_search( term = NULL, tf_name = NULL, tf_class = NULL, tf_family = NULL, tax_group = NULL, tax_id = NULL, data_type = NULL, collection = NULL, release = 2024, only_last_version = FALSE, order = NULL, page_size = 1000, page = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"term Character: search term. tf_name Character: Transcription factor names (Case-sensitive). tf_class Character: Transcription factor class tf_family Character: Transcription factor family tax_group Character: Taxonomic group. Use rba_jaspar_taxons get list supported Taxonomic groups. tax_id Numeric: NCBI taxonomic Identifier species. Use rba_jaspar_species get list supported Species. data_type Character: Type data (.e Methodology used matrix construction). example: \"ChIP-seq\", \"PBM\" collection Character: JASPAR matrix profile collection name. USE rba_jaspar_collections get list collection names. release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. only_last_version Logical: (default = FALSE) TRUE, latest version matrix profile returned. order Character: character string vector character strings field names used order results. Providing multiple field names supported. can also use prefix \"-\" field name indicate reverse ordering. page_size Numeric: (default = 1000) resource returns paginated results. maximum numbers results want retrieve per page? Accepted values 1 1000. page Numeric: page results retrieve? accepted values depend page size number results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"list contains data frame matrix profiles' information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. results paginated. can control page's size number function's arguments. Also, can use rba_pages automatically iterate multiple pages.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"\"GET https://jaspar.elixir./api/v1/api/v1/matrix/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"","code":"# \\donttest{ rba_jaspar_matrix_search(term = \"FOX\") rba_jaspar_matrix_search(tf_name = \"FOXP3\") rba_jaspar_matrix_search(tf_name = \"FOXP3\", only_last_version = TRUE) rba_jaspar_matrix_search(tf_class = \"Zipper-Type\") rba_jaspar_matrix_search(tax_group = \"insects\") rba_jaspar_matrix_search(page_size = 100) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":null,"dir":"Reference","previous_headings":"","what":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"Since JASPAR release 2010, matrix profiles versioned; , matrix profile Identifier \"base_id.version\" naming schema. Using function can retrieve list matrix profiles associated base (stable) ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"","code":"rba_jaspar_matrix_versions(base_id, order = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"base_id Character: base (stable) Identifier. matrix profile identifier \"base_id.version\" naming schema order Character: character string vector character strings field names used order results. Providing multiple field names supported. can also use prefix \"-\" field name indicate reverse ordering. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"data frame matrix profiles' versions information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"\"GET https://jaspar.elixir./api/v1/matrix/{base_id}/versions/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"","code":"# \\donttest{ rba_jaspar_matrix_versions(\"MA0600\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":null,"dir":"Reference","previous_headings":"","what":"Get information about JASPAR database releases — rba_jaspar_releases","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"release number supplied, function return details release. Otherwise, function called without \"release\" argument, list JASPAR database releases returned.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"","code":"rba_jaspar_releases(release_number = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"release_number Numeric: JASPAR database release number information's retrieve? left NULL (default), list JASPAR database releases returned. Available options 1 8. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"list contains JASPAR database releases' information details particular release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"\"GET https://jaspar.elixir./api/v1/releases/\" \"GET https://jaspar.elixir./api/v1/releases/{release_number}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"","code":"# \\donttest{ rba_jaspar_releases() rba_jaspar_releases(7) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":null,"dir":"Reference","previous_headings":"","what":"Get binding sites of a matrix profile — rba_jaspar_sites","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"Use function retrieve list transcription factor binding sites associated matrix profile.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"","code":"rba_jaspar_sites(matrix_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"matrix_id Character: matrix profile Identifier. \"base_id.version\" naming schema. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"list contains data frame binding sites information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"\"GET https://jaspar.elixir./api/v1/sites/{matrix_id}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"","code":"# \\donttest{ rba_jaspar_sites(\"MA0600.1\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":null,"dir":"Reference","previous_headings":"","what":"List available species in JASPAR — rba_jaspar_species","title":"List available species in JASPAR — rba_jaspar_species","text":"JASPAR organizes matrix profiles multiple species six taxonomic groups. Use function retrieve list available species JASPAR database release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List available species in JASPAR — rba_jaspar_species","text":"","code":"rba_jaspar_species(release = 2024, search = NULL, order = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List available species in JASPAR — rba_jaspar_species","text":"release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. search Character: search term. order Character: character string vector character strings field names used order results. Providing multiple field names supported. can also use prefix \"-\" field name indicate reverse ordering. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List available species in JASPAR — rba_jaspar_species","text":"data frame information available species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List available species in JASPAR — rba_jaspar_species","text":"\"GET https://jaspar.elixir./api/v1/species/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List available species in JASPAR — rba_jaspar_species","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List available species in JASPAR — rba_jaspar_species","text":"","code":"# \\donttest{ rba_jaspar_species(release = 2024) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":null,"dir":"Reference","previous_headings":"","what":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"JASPAR curates matrix profiles multiple species six taxonomic groups. Using function can list matrix profiles available JASPAR release species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"","code":"rba_jaspar_species_matrices( tax_id, release = 2024, only_last_version = FALSE, search = NULL, order = NULL, page_size = 1000, page = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"tax_id Numeric: NCBI taxonomic Identifier species. Use rba_jaspar_species get list supported Species. release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. only_last_version Logical: (default = FALSE) TRUE, latest version matrix profile returned. search Character: search term. order Character: character string vector character strings field names used order results. Providing multiple field names supported. can also use prefix \"-\" field name indicate reverse ordering. page_size Numeric: (default = 1000) resource returns paginated results. maximum numbers results want retrieve per page? Accepted values 1 1000. page Numeric: page results retrieve? accepted values depend page size number results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"list contains data frame information matrix profiles available species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"results paginated. can control page's size number function's arguments. Also, can use rba_pages automatically iterate multiple pages.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"\"GET https://jaspar.elixir./api/v1/species/{tax_id}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"","code":"# \\donttest{ rba_jaspar_species_matrices(tax_id = 9606, page_size = 100) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":null,"dir":"Reference","previous_headings":"","what":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"JASPAR organizes matrix profiles multiple species six taxonomic groups. Use function retrieve list available taxonomic groups JASPAR database release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"","code":"rba_jaspar_taxons(release = 2024, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"data frame information available species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"\"GET https://jaspar.elixir./api/v1/taxon/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"","code":"# \\donttest{ rba_jaspar_taxons(release = 2024) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":null,"dir":"Reference","previous_headings":"","what":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"JASPAR organizes matrix profiles multiple species six taxonomic groups. Using function can list matrix profiles available JASPAR release taxonomic group.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"","code":"rba_jaspar_taxons_matrices( tax_group, release = 2024, only_last_version = FALSE, search = NULL, order = NULL, page_size = 1000, page = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"tax_group Character: Taxonomic group. Use rba_jaspar_taxons get list supported Taxonomic groups. release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. only_last_version Logical: (default = FALSE) TRUE, latest version matrix profile returned. search Character: search term. order Character: character string vector character strings field names used order results. Providing multiple field names supported. can also use prefix \"-\" field name indicate reverse ordering. page_size Numeric: (default = 1000) resource returns paginated results. maximum numbers results want retrieve per page? Accepted values 1 1000. page Numeric: page results retrieve? accepted values depend page size number results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"list contains data frame information matrix profiles available taxonomic group.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"results paginated. can control page's size number function's arguments. Also, can use rba_pages automatically iterate multiple pages.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"\"GET https://jaspar.elixir./api/v1/taxon/{tax_group}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"","code":"# \\donttest{ rba_jaspar_taxons_matrices(tax_group = \"plants\", page_size = 100) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":null,"dir":"Reference","previous_headings":"","what":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"Using function can retrieve details annotations Transcription Factor flexible models (TFFMs) associated TFFM ID. base ID (.e. without version suffix) supplied, latest version returned.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"","code":"rba_jaspar_tffm(tffm_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"tffm_id Character: TF flexible model (TFFM) Identifier. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"list contains TFFM's information annotations.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"\"GET https://jaspar.elixir./api/v1/fttm/{tffm_id}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"","code":"# \\donttest{ rba_jaspar_tffm(\"TFFM0056.3\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"can use function list JASPAR TF flexible models (TFFMs) match search query, run function without arguments return list every matrix profile available latest release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"","code":"rba_jaspar_tffm_search( term = NULL, release = 2024, tax_group = NULL, search = NULL, order = NULL, page_size = 1000, page = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"term Character: search term. release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. tax_group Character: Taxonomic group. Use rba_jaspar_taxons get list supported Taxonomic groups. search Character: search term. order Character: character string vector character strings field names used order results. Providing multiple field names supported. can also use prefix \"-\" field name indicate reverse ordering. page_size Numeric: (default = 1000) resource returns paginated results. maximum numbers results want retrieve per page? Accepted values 1 1000. page Numeric: page results retrieve? accepted values depend page size number results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"list contains data frame information query hits' TFFMs.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. results paginated. can control page's size number function's arguments. Also, can use rba_pages automatically iterate multiple pages.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"\"GET https://jaspar.elixir./api/v1/api/v1/tffm/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"","code":"# \\donttest{ rba_jaspar_tffm_search(term = \"FOX\") rba_jaspar_tffm_search(tax_group = \"insects\") rba_jaspar_tffm_search(page_size = 100) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"Combination species miRNA type, pre-defined categories groups supported. Use function retrieve list supported categories given combination Species miRNA type.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"","code":"rba_mieaa_cats(mirna_type, species, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"mirna_type Type miRNA accession. either \"mature\" \"precursor\". species Fully partially matching Scientific name, abbreviation NCBI taxon ID one following species: \"Homo sapiens\", \"hsa\" 9606 \"Mus musculus\", \"mmu\" 10090 \"Rattus norvegicus\", \"rno\" 10116 \"Arabidopsis thaliana\", \"ath\" 3702 \"Bos taurus\", \"bta\" 9913 \"Caenorhabditis elegans\", \"cel\" 6239 \"Drosophila melanogaster\", \"dme\" 7227 \"Danio rerio\", \"dre\" 7955 \"Gallus gallus\", \"gga\" 9031 \"Sus scrofa\", \"ssc\" 9823 ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"named character vector supported categories supplied input combination.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"\"GET https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/v1/enrichment_categories/{species}/{mirna_type}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"","code":"# \\donttest{ rba_mieaa_cats(\"mature\", \"Homo sapiens\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":null,"dir":"Reference","previous_headings":"","what":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"miRBase miRNA accession refer either mature precursor miRNAs. (see: uniform system microRNA annotation). Use function mature miRNA accession corresponding miRNA accessions vice versa.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"","code":"rba_mieaa_convert_type( mirna, input_type, only_unique = FALSE, simple_output = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"mirna vector miRNA accessions converted. input_type Type supplied miRNA accession. either \"mature\" \"precursor\". only_unique (logical) miRBase precursor mature miRNA accessions uniquely mapped. (.e. may get one results given accession). set TRUE retrieve unique mappings. (default = FALSE) simple_output (logical) FALSE (default), result two-columned data frame input output accessions. Otherwise, TRUE, output miRNA accessions returned. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"Depending arguments, data frame character vectors containing miRNA accessions output version.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"\"POST https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/v1/mirna_precursor_converter/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"","code":"# \\donttest{ Sys.sleep(1) # to prevent 429 error during R CMD check rba_mieaa_convert_type(mirna = c(\"hsa-miR-20b-5p\", \"hsa-miR-144-5p\"), input_type = \"mature\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":null,"dir":"Reference","previous_headings":"","what":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"miEAA works miRBASE v22 accession. Using function can convert set mature precursor miRNA accession two given miRBase versions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"","code":"rba_mieaa_convert_version( mirna, mirna_type, input_version, output_version, simple_output = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"mirna vector miRNA accessions converted. mirna_type Type supplied miRNA accession. either \"mature\" \"precursor\". input_version (numeric) miRBase version supplied miRNA accessions. output_version (numeric) version miRNA accessions converted? simple_output (logical) FALSE (default), result two-columned data frame input output accessions. Otherwise, TRUE, output miRNA accessions returned. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"Depending arguments, data frame character vectors containing miRNA accessions output version.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"\"POST https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/v1/mirbase_converter/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"","code":"# \\donttest{ Sys.sleep(1) # to prevent 429 error during R CMD check rba_mieaa_convert_version(mirna = c(\"hsa-miR-20b-5p\", \"hsa-miR-144-5p\"), mirna_type = \"mature\", input_version = 22, output_version = 16) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":null,"dir":"Reference","previous_headings":"","what":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"function wrapper multiple function calls necessary perform enrichment analysis given miRNA list using miEAA. see details section information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"","code":"rba_mieaa_enrich( test_set, mirna_type, test_type, species, categories = NULL, p_adj_method = \"fdr\", independent_p_adj = TRUE, sig_level = 0.05, min_hits = 2, ref_set = NULL, sort_by = \"p_adjusted\", sort_asc = TRUE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"test_set character vector mature precursor miRBase miRNA accessions. Note miRBase v22 miRNA accession accepted. can use rba_mieaa_convert_version convert accessions miRBase v22. list entirely consisted either mature precursor miRNA accession. mixture accepted. mirna_type Type supplied miRNA accession. either \"mature\" \"precursor\". test_type analysis perform. can either \"ORA\" 'Representation Analysis' \"GSEA\" miRNA (Gene) 'Set Enrichment Analysis'. Note GSEA, list sorted beforehand based criterion. species Fully partially matching Scientific name, abbreviation NCBI taxon ID one following species: \"Homo sapiens\", \"hsa\" 9606 \"Mus musculus\", \"mmu\" 10090 \"Rattus norvegicus\", \"rno\" 10116 \"Arabidopsis thaliana\", \"ath\" 3702 \"Bos taurus\", \"bta\" 9913 \"Caenorhabditis elegans\", \"cel\" 6239 \"Drosophila melanogaster\", \"dme\" 7227 \"Danio rerio\", \"dre\" 7955 \"Gallus gallus\", \"gga\" 9031 \"Sus scrofa\", \"ssc\" 9823 categories one multiple Category names used miRNA set enrichment analysis. Note Available categories varies based chosen specie supplied miRNA type mature precursor. Use rba_mieaa_cats retrieve list available category names given specie miRNA type. supply NULL, analysis performed available categories. p_adj_method P-value adjustment method used. one : \"none\", \"fdr\" (default), \"bonferroni\", \"\", \"hochberg\", \"holm\" \"hommel\" independent_p_adj (logical) scope level p-value adjustment; TRUE (default), categories considered independent p-value adjusted separately category. FALSE, p-value adjusted collectively categories. sig_level (numeric) significance threshold adjusted P-value. values equal greater threshold dropped results. min_hits (numeric) many miRNA sub-category supplied test-list included results? (default 2) ref_set (Optional) applicable test_type \"ORA\". character vector used reference (background universe) set p-value calculations. sort_by column name result's table based . one : \"category\", \"subcategory\", \"enrichment\", \"p_value\", \"p_adjusted\" (default), \"q_value\" \"observed\" . sort_asc (logical) TRUE, results sorted ascending order. FALSE, results sorted descending order. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"data frame enrichment analysis results.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"function call rba_mieaa_*** functions following order: Call rba_mieaa_enrich_submit Submit enrichment analysis request miEAA servers, using supplied miRNA lists arguments. job successfully submitted, call rba_mieaa_enrich_status every 5 seconds, check status running server-side job whether analysis job finished results available. Call rba_mieaa_enrich_results retrieve results enrichment analysis. See function's manual details.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"\"GET https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"","code":"if (FALSE) { # \\dontrun{ rba_mieaa_enrich(test_set = c(\"hsa-miR-20b-5p\", \"hsa-miR-144-5p\", \"hsa-miR-17-5p\", \"hsa-miR-20a-5p\"), mirna_type = \"mature\", test_type = \"ORA\", species = 9606, categories = \"miRPathDB_GO_Biological_process_mature\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":null,"dir":"Reference","previous_headings":"","what":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"submitted enrichment analysis request finished (check using rba_mieaa_enrich_status), can retrieve results using function.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"","code":"rba_mieaa_enrich_results(job_id, sort_by = \"p_adjusted\", sort_asc = TRUE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"job_id job-id (character string) submitted enrichment analysis. sort_by column name result's table based . one : \"category\", \"subcategory\", \"enrichment\", \"p_value\", \"p_adjusted\" (default), \"q_value\" \"observed\" . sort_asc (logical) TRUE, results sorted ascending order. FALSE, results sorted descending order. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"data frame enrichment analysis results.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"Note using rba_mieaa_enrich convenient way automatically perform required function calls perform enrichment analysis input miRNA-set using miEAA.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"\"GET https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/v1/results/{job_id}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"","code":"if (FALSE) { # \\dontrun{ rba_mieaa_enrich_results(\"f52d1aef-6d3d-4d51-9020-82e68fe99012\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":null,"dir":"Reference","previous_headings":"","what":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"submitted enrichment analysis (using rba_mieaa_enrich_submit) retrieved job-id, can use function check status job. Status value equal 100 means requested analysis finished may retrieve results using rba_mieaa_enrich_results.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"","code":"rba_mieaa_enrich_status(job_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"job_id job-id (character string) submitted enrichment analysis. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"list containing status value analysis corresponds supplied job-id.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"Note using rba_mieaa_enrich convenient way automatically perform required function calls perform enrichment analysis input miRNA-set using miEAA.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"\"GET https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/v1/job_status/{job_id}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"","code":"if (FALSE) { # \\dontrun{ Sys.sleep(1) # to prevent 429 error during R CMD check rba_mieaa_enrich_status(\"f52d1aef-6d3d-4d51-9020-82e68fe99012\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":null,"dir":"Reference","previous_headings":"","what":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"Using function can submit request miEAA servers perform -representation GSEA Analysis given set miRNA identifiers. see \"arguments\" section information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"","code":"rba_mieaa_enrich_submit( test_set, mirna_type, test_type, species = \"hsa\", categories = NULL, p_adj_method = \"fdr\", independent_p_adj = TRUE, sig_level = 0.05, min_hits = 2, ref_set = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"test_set character vector mature precursor miRBase miRNA accessions. Note miRBase v22 miRNA accession accepted. can use rba_mieaa_convert_version convert accessions miRBase v22. list entirely consisted either mature precursor miRNA accession. mixture accepted. mirna_type Type supplied miRNA accession. either \"mature\" \"precursor\". test_type analysis perform. can either \"ORA\" 'Representation Analysis' \"GSEA\" miRNA (Gene) 'Set Enrichment Analysis'. Note GSEA, list sorted beforehand based criterion. species Fully partially matching Scientific name, abbreviation NCBI taxon ID one following species: \"Homo sapiens\", \"hsa\" 9606 \"Mus musculus\", \"mmu\" 10090 \"Rattus norvegicus\", \"rno\" 10116 \"Arabidopsis thaliana\", \"ath\" 3702 \"Bos taurus\", \"bta\" 9913 \"Caenorhabditis elegans\", \"cel\" 6239 \"Drosophila melanogaster\", \"dme\" 7227 \"Danio rerio\", \"dre\" 7955 \"Gallus gallus\", \"gga\" 9031 \"Sus scrofa\", \"ssc\" 9823 categories one multiple Category names used miRNA set enrichment analysis. Note Available categories varies based chosen specie supplied miRNA type mature precursor. Use rba_mieaa_cats retrieve list available category names given specie miRNA type. supply NULL, analysis performed available categories. p_adj_method P-value adjustment method used. one : \"none\", \"fdr\" (default), \"bonferroni\", \"\", \"hochberg\", \"holm\" \"hommel\" independent_p_adj (logical) scope level p-value adjustment; TRUE (default), categories considered independent p-value adjusted separately category. FALSE, p-value adjusted collectively categories. sig_level (numeric) significance threshold adjusted P-value. values equal greater threshold dropped results. min_hits (numeric) many miRNA sub-category supplied test-list included results? (default 2) ref_set (Optional) applicable test_type \"ORA\". character vector used reference (background universe) set p-value calculations. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"list contains submitted job's ID URL manually check job status.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"Note using rba_mieaa_enrich convenient way automatically perform required function calls perform enrichment analysis input miRNA-set using miEAA.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"\"POST https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/v1/enrichment_analysis/{species}/{type}/{test}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"","code":"# \\donttest{ Sys.sleep(1) # to prevent 429 error during R CMD check rba_mieaa_enrich_submit(test_set = c(\"hsa-miR-20b-5p\", \"hsa-miR-144-5p\"), mirna_type = \"mature\", test_type = \"GSEA\", species = 9606, categories = NULL) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_options.html","id":null,"dir":"Reference","previous_headings":"","what":"Set rbioapi Global Options — rba_options","title":"Set rbioapi Global Options — rba_options","text":"safe way change rbioapi's global options behavior. see \"arguments\" section available options. Note limited changing options globally, can include option names values '...' argument rbioapi function alter option(s) function call; e.g. example_function(x, diagnostics = TRUE, timeout = 300). Alternatively, can call function arguments, .e. rba_options(), retrieve data frame available rbioapi options current values.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_options.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Set rbioapi Global Options — rba_options","text":"","code":"rba_options( diagnostics = NULL, dir_name = NULL, retry_max = NULL, retry_wait = NULL, progress = NULL, save_file = NULL, skip_error = NULL, timeout = NULL, verbose = NULL )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_options.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Set rbioapi Global Options — rba_options","text":"diagnostics (Logical) (default = FALSE) Show diagnostics detailed messages internal information. dir_name (character) (default = \"rbioapi\") package needs generate file path save server's response, directory name created working directory save files. retry_max (Numeric) (default = 0) many times rbioapi retry case 5xx server responses, errors related server internet connectivity? retry_wait (Numeric) (default = 10) Time seconds wait next retry case internet connection server problems. progress (Logical) (default = FALSE) progress bar displayed? save_file (Logical character) (default = FALSE) Either: TRUE: case, raw server's response file automatically saved proper file path. use \"dir_name\" argument change file's parent directory. FALSE: (default) automatically save server's response file. Character: (changing option via \"...\" functions call) valid file path save server's response file function calling. skip_error (Logical) (default = FALSE R interactive mode, TRUE otherwise) TRUE, code execution stopped case errors (anything HTTP status 200 server); Instead error message returned function's output. However, FALSE, case error, code execution halted error message issued. timeout (Numeric) (default = 30) maximum time seconds willing wait server response giving stopping function execution. verbose (Logical) (Default = TRUE) Generate short informative messages.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_options.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Set rbioapi Global Options — rba_options","text":"called without argument, Data frame available options information; Called argument, Return NULL Alters option globally.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_options.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Set rbioapi Global Options — rba_options","text":"function validates supplied changes, please change rbioapi options using function avoid directly editing .","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_options.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Set rbioapi Global Options — rba_options","text":"","code":"rba_options() if (FALSE) { # \\dontrun{ rba_options(verbose = FALSE) } # } if (FALSE) { # \\dontrun{ rba_options(save_file = TRUE) } # } if (FALSE) { # \\dontrun{ rba_options(diagnostics = TRUE, progress = TRUE) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_pages.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Multiple Pages of a Paginated Resource — rba_pages","title":"Get Multiple Pages of a Paginated Resource — rba_pages","text":"resources return paginated results, meaning make separate calls page. Using function, can iterate 100 pages. Just supply rbioapi function change page argument \"pages:start_page:end_page\", example \"pages:1:5\".","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_pages.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Multiple Pages of a Paginated Resource — rba_pages","text":"","code":"rba_pages(input_call, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_pages.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Multiple Pages of a Paginated Resource — rba_pages","text":"input_call quoted call. supply regular rbioapi function call, two differences: : Wrap quote() around . meaning: quote(rba_example()) : Set argument corresponds page number \"pages:start_page:end_page\", example \"pages:1:5\". See \"examples\" section learn . ... Experimental internal options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_pages.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Multiple Pages of a Paginated Resource — rba_pages","text":"named list element corresponds request's page.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_pages.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Multiple Pages of a Paginated Resource — rba_pages","text":"prevent flooding server, 1 second delay calls, also user iterate 100 pages. function also override skip_error option always set TRUE. means case server response error (e.g. requesting pages exist) error message returned instead halting function's execution.","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_pages.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Multiple Pages of a Paginated Resource — rba_pages","text":"","code":"# \\donttest{ rba_pages(input_call = quote(rba_uniprot_taxonomy(ids = 189831, hierarchy = \"siblings\", page_size = 50, page_number = \"pages:1:5\"))) # } # \\donttest{ rba_pages(input_call = quote(rba_uniprot_taxonomy_name(name = \"adenovirus\", field = \"scientific\", search_type = \"contain\", page_size = 200, page_number = \"pages:1:5\", verbose = FALSE))) # } # \\donttest{ rba_pages(input_call = quote(rba_panther_info(what = \"families\", families_page = \"pages:9:11\"))) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":null,"dir":"Reference","previous_headings":"","what":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"Use PANTHER services perform -representation enrichment analysis. can either provide character vector gene IDs -representation analysis, data frame gene IDs expression analysis. Please refer details section information statistical analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"","code":"rba_panther_enrich( genes, organism, annot_dataset, test_type = NULL, correction = \"FDR\", cutoff = NULL, ref_genes = NULL, ref_organism = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"genes Either character vector data frame. Depending parameter, analysis type determined. Character vector: character vector supplied, -representation analysis performed using either Fisher's exact test (default), binomial. Data frame: data.frame supplied, statistical enrichment test performed using Mann-Whitney U (Wilcoxon Rank-Sum) test. data frame two columns: first column character vector gene identifiers second column numerical vector expression values. cases, maximum 10000 genes can supplied. gene identifiers can : Ensemble gene ID, Ensembl protein ID, Ensembl transcript ID, Entrez gene ID, gene symbol, NCBI GI, HGNC ID, International protein index ID, NCBI UniGene ID, UniProt accession UniProt ID. organism (numeric) NCBI taxon ID. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. annot_dataset PANTHER dataset ID test input . run rba_panther_info argument '= \"datasets\"' get list PANTHER's supported datasets. Note enter \"id\" dataset, label (e.g. entering \"biological_process\" incorrect, rather enter \"GO:0008150\"). test_type statistical test type calculate p values. performing -representation analysis (.e. `genes` parameter character vector), valid values \"FISHER\" (default) \"BINOMIAL\". performing statistical enrichment analysis (.e. `genes` parameter data.frame), valid value \"Mann-Whitney\" correction p value correction method. either \"FDR\" (default), \"BONFERRONI\" \"NONE\". cutoff (Numeric) (Optional) threshold filter results. correction \"FDR\", threshold applied fdr column's values; otherwise, threshold applied p value column. ref_genes (Optional, valid genes character vector) character vector genes used test's background (reference/universe) gene set. value supplied, genes specified organism used. maximum length supported IDs 'genes' argument. ref_organism (Optional, valid genes character vector) 'ref_genes' used, can specify organisms correspond supplied IDs 'ref_genes' argument. see 'organism' argument supported values. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"list parameters results. analysis successful, results data frame returned \"results\" element within list. Otherwise, error message returned \"search$error\" element returned list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"-representation Test: assesses whether specific gene sets represented input gene list differently expected chance. uses Fisher's exact test Binomial test calculate p-values. Fisher's exact test determines probability observing gene counts category based hypergeometric distribution; binomial test compares observed proportion genes category expected proportion based reference list. significant p-value indicates -representation -representation gene set. Statistical Enrichment Test: statistical enrichment test uses Mann-Whitney U (Wilcoxon Rank-Sum) test assess expression values associated genes specific category differ significantly overall distribution input list. non-parametric test first ranks numerical values computes whether expression values randomly drawn overall distribution values. small p-value indicates numerical values genes category significantly different background distribution, thus non-random patterns. Please note starting rbioapi version 0.8.2, can supply gene expression data frame perform statistical enrichment analysis. earlier versions, character vector gene IDs possible, thus -representation analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"\"POST https://www.pantherdb.org/services/oai/pantherdb/enrich/overrep\" \"POST https://www.pantherdb.org/services/oai/pantherdb/enrich/statenrich\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"","code":"# \\donttest{ rba_panther_enrich( genes = c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\", \"CDK1\", \"KIF23\", \"PLK1\", \"RAC2\", \"RACGAP1\"), organism = 9606, annot_dataset = \"GO:0008150\", cutoff = 0.01 ) # } # \\donttest{ expression_df <- data.frame( genes = c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\", \"CDK1\", \"KIF23\", \"PLK1\", \"RAC2\", \"RACGAP1\"), expr = runif(10, 0, 100) ) rba_panther_enrich( genes = expression_df, organism = 9606, annot_dataset = \"GO:0008150\" ) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":null,"dir":"Reference","previous_headings":"","what":"Get PANTHER Families and Sub-Families — rba_panther_family","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"Using function, can retrieve Orthologs, MSA Tree topology information given PANTHER family.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"","code":"rba_panther_family(id, what, target_organisms = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"id Panther family id. retrieve? One : \"ortholog\": Orthologs ('LDO' least diverged 'O' diverged). \"msa\": Multiple Sequence Alignment Information, \"tree\": Tree topology nodes attributes. target_organisms (numeric) NCBI taxon ID(s) filter results. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"trees list otherwise data frame requested family's information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"\"GET https://www.pantherdb.org/services/oai/pantherdb/familyortholog\" \"GET https://www.pantherdb.org/services/oai/pantherdb/familymsa\" \"GET https://www.pantherdb.org/services/oai/pantherdb/treeinfo\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"","code":"# \\donttest{ rba_panther_family(\"PTHR10000\", what = \"ortholog\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":null,"dir":"Reference","previous_headings":"","what":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"Using function can search retrieve homolog given gene(s).","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"","code":"rba_panther_homolog(genes, organism, type = \"P\", target_organisms = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"genes Character vector genes identifiers maximum length 10 one seq_pos supplied. Can : Ensemble gene ID, Ensemble protein ID, Ensemble transcript ID, Entrez gene ID, gene symbol, NCBI GI, HGNC ID, International protein index ID, NCBI UniGene ID, UniProt accession /UniProt ID. organism (numeric) NCBI taxon ID organism supplied genes. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. type Homolog types return. either \"P\" (default) paralogs, \"X\" horizontal gene transfer \"LDX\" diverged horizontal gene transfer. target_organisms (numeric) NCBI taxon ID(s) filter results. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. Paralog, target organism organism ; Otherwise, target organism different input organism. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"dataframe homologs information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"\"GET https://www.pantherdb.org/services/oai/pantherdb/ortholog/homologOther\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"","code":"# \\donttest{ rba_panther_homolog(\"OR4F5\", organism = 9606, type = \"P\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":null,"dir":"Reference","previous_headings":"","what":"Get PANTHER database Information — rba_panther_info","title":"Get PANTHER database Information — rba_panther_info","text":"Using function can retrieve list available organisms, annotation datasets, families, pathways supported PANTHER.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get PANTHER database Information — rba_panther_info","text":"","code":"rba_panther_info(what, organism_chr_loc = FALSE, families_page = 1, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get PANTHER database Information — rba_panther_info","text":"information retrieve? one : \"organisms\": Retrieve supported organisms PANTHER. \"datasets\": Retrieve available annotation datasets. \"families\" Retrieve available family IDs. \"species_tree\" Retrieve PANThER's species tree. \"pathways\" Retrieve available pathway IDs. organism_chr_loc (Logical) ('= \"organisms\"') TRUE, organisms chromosome location returned. FALSE (default) every organisms returned. families_page (Numeric) ('= \"families\"') Family information long, results paginated. Use argument define page retrieve. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get PANTHER database Information — rba_panther_info","text":"families species tree, list otherwise data frame pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get PANTHER database Information — rba_panther_info","text":"\"GET https://www.pantherdb.org/services/oai/pantherdb/supportedgenomes\" \"GET https://www.pantherdb.org/services/oai/pantherdb/supportedannotdatasets\" \"GET https://www.pantherdb.org/services/oai/pantherdb/supportedpantherfamilies\" \"GET https://www.pantherdb.org/services/oai/pantherdb/supportedpantherpathways\" \"GET https://www.pantherdb.org/services/oai/pantherdb/speciestree\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get PANTHER database Information — rba_panther_info","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get PANTHER database Information — rba_panther_info","text":"","code":"# \\donttest{ rba_panther_info(what = \"organisms\") # } # \\donttest{ rba_panther_info(what = \"families\", families_page = 4) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":null,"dir":"Reference","previous_headings":"","what":"Map A Gene-set to PANTHER Database — rba_panther_mapping","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"Using function, can search genes PANTHER database retrieve attributes annotations associated genes.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"","code":"rba_panther_mapping(genes, organism, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"genes Character vector genes identifiers maximum length 1000. Can : Ensemble gene ID, Ensemble protein ID, Ensemble transcript ID, Entrez gene ID, gene symbol, NCBI GI, HGNC ID, International protein index ID, NCBI UniGene ID, UniProt accession /UniProt ID. organism (numeric) NCBI taxon ID. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"list containing unmapped inputs mapped genes pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"\"GET https://www.pantherdb.org/services/oai/pantherdb/geneinfo\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"","code":"# \\donttest{ rba_panther_mapping(genes = c(\"Cd40\", 7124, \"ENSG00000203747\", \"P33681\"), organism = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":null,"dir":"Reference","previous_headings":"","what":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"Using function can search retrieve orthologs given gene(s), optionally return corresponding position target organisms' protein sequences.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"","code":"rba_panther_ortholog( genes, organism, type = \"all\", target_organisms = NULL, seq_pos = NULL, include_msa = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"genes Character vector genes identifiers maximum length 10 one seq_pos supplied. Can : Ensemble gene ID, Ensemble protein ID, Ensemble transcript ID, Entrez gene ID, gene symbol, NCBI GI, HGNC ID, International protein index ID, NCBI UniGene ID, UniProt accession /UniProt ID. organism (numeric) NCBI taxon ID organism supplied genes. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. type Ortholog types return. either \"\" (default) \"LDO\" return least diverged orthologs. target_organisms (numeric) NCBI taxon ID(s) filter results. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. seq_pos (Numeric) position protein's sequence supplied gene. range protein's length. include_msa (Logical) sequence position supplied, MSA (Multiple Sequence Alignment) information included results? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"data frame Orthologs information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"\"POST https://www.pantherdb.org/services/oai/pantherdb/ortholog/matchortho\" \"POST https://www.pantherdb.org/services/oai/pantherdb/ortholog/homologpos\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"","code":"# \\donttest{ rba_panther_ortholog(\"CD40\", organism = 9606, type = \"LDO\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":null,"dir":"Reference","previous_headings":"","what":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"information, see: TreeGrafter: phylogenetic tree-based annotation proteins Gene Ontology terms annotations","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"","code":"rba_panther_tree_grafter(protein_seq, target_organisms = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"protein_seq character string protein's sequence. Maximum allowed sequence length 50kb. target_organisms (numeric) NCBI taxon ID(s) filter results. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"list containing PANTHER tree topology information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"\"GET https://www.pantherdb.org/services/oai/pantherdb/graftsequence\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"","code":"# \\donttest{ rba_panther_tree_grafter(\"MKVLWAALLVTFLAGCQAKVEQAVETE\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":null,"dir":"Reference","previous_headings":"","what":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"Using function, can perform Reactome Analysis convenient way. Analysis Type chosen depending supplied input: supply vector single-columned table, \"-Representation\" analysis performed. supply multi-column table, first column molecules identifiers rest numeral expression values, \"Expression\" analysis performed. See details section accepted input types format.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"","code":"rba_reactome_analysis( input, input_format = NULL, projection = TRUE, interactors = FALSE, species = NULL, sort_by = \"ENTITIES_PVALUE\", order = \"ASC\", resource = \"TOTAL\", p_value = 1, include_disease = TRUE, min = NULL, max = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"input vector, data frame, matrix local file path URL points data. See \"Details section\" information organize supply input. input_format (Optional) function automatically identify supplied input's format. case unexpected issues want explicit, set argument one : \"table\": supplied data frame matrix input. \"vector\": supplied simple vector (numeric character) input. \"file\": supplied local file path pointing correctly-formatted text file. \"url\": supplied URL pointing correctly-formatted text file. projection Logical (default = TRUE) non-human identifiers projected human equivalents? (using Reactome orthology data) interactors Logical (default = FALSE) IntAct interaction data used increase analysis background? species Numeric Character: NCBI Taxonomy identifier (Human 9606), species name (e.g. \"Homo sapiens\") Reactome DbId (e.g Homo sapiens 48887). See rba_reactome_species Reactome Data Schema: Entries: Species. Note supply species parameter projection parameter TRUE. sort_by Sort result based column? available choices : \"NAME\", \"TOTAL_ENTITIES\", \"TOTAL_INTERACTORS\", \"TOTAL_REACTIONS\", \"FOUND_ENTITIES\", \"FOUND_INTERACTORS\", \"FOUND_REACTIONS\", \"ENTITIES_RATIO\", \"ENTITIES_PVALUE\", \"ENTITIES_FDR\" \"REACTIONS_RATIO\" order Sort Order. Can either \"ASC\" (default) \"DESC\". resource Filter results based resource. Default \"TOTAL\", available choices : \"TOTAL\", \"UNIPROT\", \"ENSEMBL\", \"CHEBI\", \"IUPHAR\", \"MIRBASE\", \"NCBI_PROTEIN\", \"EMBL\", \"COMPOUND\", \"ENTITIES_FDR\" \"PUBCHEM_COMPOUND\". p_value Set P value threshold. results P value equal less supplied threshold returned. (default = 1, Meaning P value filtering) include_disease Logical (default = TRUE) disease pathways included results? min (numeric) Minimum number entities pathways included results. max (numeric) Maximum number entities pathways included results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"List containing results information analysis. Note can use token returned \"summary\" sub-list results (.e. results$summary$token) retrieve results later Reactome analysis functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"can supply table vector input numerous formats: R object can data frame, matrix simple vector. path local text file device contains molecules data. (file formatted correctly, see .) URL pointing text file web contains molecules data. (file formatted correctly, see . supply text file (local file path URL), TSV (Tab-Separated Values) format; Column names start \"#\" character. Note providing file \"-Representation\" analysis (.e. Single columned-data) header line optional used 'Sample Name', otherwise required. Also, form \"summary\" element function's output, can see Reactome Interpreted input subsequently type analysis performed. strict criteria type molecules Identifiers, Reactome Map IDs internal database entities. Nevertheless, can check identifiers found \"identifiersNotFound\" element function's output. Analysis, Reactome associate token analysis. can later used function requires token (e.g retrieve analysis results, download pdf). Note Reactome store token 7 days. can download full results rba_reactome_analysis_download, re-import anytime reactome (using rba_reactome_analysis_import) generate new token.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"\"POST https://reactome.org/AnalysisService/identifiers/form\" \"POST https://reactome.org/AnalysisService/identifiers/url\" \"POST https://reactome.org/AnalysisService/identifiers/form/projection\" \"POST https://reactome.org/AnalysisService/identifiers/url/projection\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_analysis(input = c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\")) } # } if (FALSE) { # \\dontrun{ rba_reactome_analysis(input = \"c:/rbioapi/genes.txt\") } # } if (FALSE) { # \\dontrun{ rba_reactome_analysis(input = \"https://qazwsx.com/genes.txt\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":null,"dir":"Reference","previous_headings":"","what":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"Based \"request\" argument, can download different analysis results data associated given token.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"","code":"rba_reactome_analysis_download( token, request, save_to = NULL, resource = \"TOTAL\", ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"token token associated previous Reactome analysis. request download? one : \"found_ids\": Download CSV file containing found user-supplied identifiers analysis associated supplied token resource. \"not_found_ids\"\" Download CSV file containing user-supplied Identifiers found analysis associated supplied token. \"pathways\": Download CSV file containing Pathway analysis results analysis associated supplied token resource. \"results\": Download JSON file containing complete analysis results associated supplied token. \"results_gz\" \"results\", output compress (gzipped). save_to NULL Character: NULL: Save file automatically-generated path. Character string: valid file path save file . resource (request \"found_ids\" \"pathways\") Filter results based resource. Default \"TOTAL\", available choices :\"TOTAL\", \"UNIPROT\", \"ENSEMBL\", \"CHEBI\", \"IUPHAR\", \"MIRBASE\", \"NCBI_PROTEIN\", \"EMBL\", \"COMPOUND\", \"ENTITIES_FDR\" \"PUBCHEM_COMPOUND\". ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"NULL, CSV,JSON Gzipped JSON file saved disk based input.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"Token associated Reactome analysis results kept Reactome least 7 days. can locate rba_reactome_analysis's output, sub-list named \"summary\" (.e. results$summary$token). Use rba_reactome_analysis_pdf save full report PDF format.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"GET https://reactome.org/AnalysisService/download/{token}/entities/ found/{resource}/{filename}.csv\" GET https://reactome.org/AnalysisService/download/{token}/entities/ notfound/{filename}.csv\" GET https://reactome.org/AnalysisService/download/{token}/pathways/ {resource}/{filename}.csv\" GET https://reactome.org/AnalysisService/download/{token}/result.json\" GET https://reactome.org/AnalysisService/download/{token}/result.json.gz\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_analysis_download(token = \"MjAyMDEwMTYwMTI3MTNfMjY1MjM\", request = \"found_ids\", save_to = \"found_ids.csv\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":null,"dir":"Reference","previous_headings":"","what":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"JSON file analysis results (obtained via rba_reactome_analysis_download result argument set \"results\", \"results_gz\"), can import results back Reactome retrieve token. useful want use Reactome services require token token token expired (.e. 7 days passed analysis).","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"","code":"rba_reactome_analysis_import(input, input_format = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"input local file path URL points -optionally gzipped- JSON file. input_format (Optional) function automatically identify supplied input's format. case unexpected issues want explicit, set argument one : \"file\": supplied local file path pointing JSON file. \"url\": supplied URL pointing JSON file. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"list containing new token information imported results.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"\"GET https://reactome.org/AnalysisService/import/\" \"GET https://reactome.org/AnalysisService/import/form\" \"GET https://reactome.org/AnalysisService/import/url\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_analysis_import(\"c:/rbioapi/res.json\") } # } if (FALSE) { # \\dontrun{ rba_reactome_analysis_import(\"https://qaz.com/res.json.gz\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":null,"dir":"Reference","previous_headings":"","what":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"Use function map molecule identifiers different species Reactome Identifiers.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"","code":"rba_reactome_analysis_mapping( input, input_format = NULL, projection = TRUE, interactors = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"input vector, local file path URL points identifiers list. input_format (Optional) function automatically identify supplied input's format. case unexpected issues want explicit, set argument one : \"vector\": supplied simple vector (numeric character) input. \"file\": supplied local file path pointing correctly-formatted text file. \"url\": supplied URL pointing correctly-formatted text file. projection Logical (default = TRUE) non-human identifiers projected human equivalents? (using Reactome orthology data) interactors Logical (default = FALSE) IntAct interaction data included? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"List containing identifiers IDS resources mapped .","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"\"GET https://reactome.org/AnalysisService/mapping\" \"GET https://reactome.org/AnalysisService/mapping/form\" \"GET https://reactome.org/AnalysisService/mapping/form/projection\" \"GET https://reactome.org/AnalysisService/mapping\" \"GET https://reactome.org/AnalysisService/mapping/url\" \"GET https://reactome.org/AnalysisService/mapping/url/projection\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_analysis_mapping(c(\"Q8SQ34\", \"cd40\")) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":null,"dir":"Reference","previous_headings":"","what":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"Use function save detailed report previous analysis ( done rba_reactome_analysis). need supply 'token' associated previous analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"","code":"rba_reactome_analysis_pdf( token, species, save_to = NULL, number = 25, resource = \"TOTAL\", diagram_profile = \"Modern\", analysis_profile = \"Standard\", fireworks_profile = \"Barium Lithium\", ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"token token associated previous Reactome analysis. species Numeric Character: NCBI Taxonomy identifier (Human Taxonomy ID 9606.) species name (e.g. \"Homo sapiens\"). See rba_reactome_species Reactome Data Schema: Entries: Species. save_to NULL Character: NULL: Save file automatically-generated path. Character string: valid file path save file . number Numeric: Maximum number reported pathways. greater 50. resource Filter results based resource. Default \"TOTAL\", available choices : \"TOTAL\", \"UNIPROT\", \"ENSEMBL\", \"CHEBI\", \"IUPHAR\", \"MIRBASE\", \"NCBI_PROTEIN\", \"EMBL\", \"COMPOUND\", \"ENTITIES_FDR\" \"PUBCHEM_COMPOUND\". diagram_profile Color profile diagrams, either \"Modern\" (default) \"Standard\". analysis_profile Color profile analysis, one : \"Standard\" (default), \"Strosobar\" \"Copper Plus\". fireworks_profile Color profile overview diagram, one : \"Copper\", \"Copper Plus\", \"Barium Lithium\" \"calcium salts\". ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"NULL, PDF file saved disk.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"Token associated Reactome analysis results kept Reactome least 7 days. can locate rba_reactome_analysis's output, sub-list named \"summary\" (.e. results$summary$token). Note Reactome store token 7 days. can download full results rba_reactome_analysis_download, re-import anytime reactome (using rba_reactome_analysis_import) generate new token. Use rba_reactome_analysis_download save results formats.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"\"GET https://reactome.org/AnalysisService/report/{token}/{species}/ {filename}.pdf\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_analysis_pdf(token = \"MjAyMDEwMTYwMTI3MTNfMjY1MjM%3D\", species = 9606, save_to = \"my_analysis.pdf\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":null,"dir":"Reference","previous_headings":"","what":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"Use function Compare human's manually-curated pathways computationally inferred pathways (orthologous) species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"","code":"rba_reactome_analysis_species( species_dbid, sort_by = \"ENTITIES_PVALUE\", order = \"ASC\", resource = \"TOTAL\", p_value = 1, min = NULL, max = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"species_dbid Numeric: Reactome DbId (e.g Mus musculus 48892) species want compare Homo sapiens. See rba_reactome_species Reactome Data Schema: Entries: Species. sort_by Sort result based column? available choices : \"NAME\", \"TOTAL_ENTITIES\", \"TOTAL_INTERACTORS\", \"TOTAL_REACTIONS\", \"FOUND_ENTITIES\", \"FOUND_INTERACTORS\", \"FOUND_REACTIONS\", \"ENTITIES_RATIO\", \"ENTITIES_PVALUE\", \"ENTITIES_FDR\" \"REACTIONS_RATIO\" order Sort Order. Can either \"ASC\" (default) \"DESC\". resource Filter results based resource. Default \"TOTAL\", available choices : \"TOTAL\", \"UNIPROT\", \"ENSEMBL\", \"CHEBI\", \"IUPHAR\", \"MIRBASE\", \"NCBI_PROTEIN\", \"EMBL\", \"COMPOUND\", \"ENTITIES_FDR\" \"PUBCHEM_COMPOUND\". p_value Set P value threshold. results P value equal less supplied threshold returned. (default = 1, Meaning P value filtering) min (numeric) Minimum number entities pathways included results. max (numeric) Maximum number entities pathways included results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"List results comparison.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"Reactome incorporate manually curated human reactions PANTHER's protein homology data Computationally infer events eukaryotic species. version 73 (11 June 2020), using orthology-based approach, Homo sapiens events projected 18,654 orthologous pathways ( 81,835 orthologous proteins) 15 non-human species. See Reactome Computationally Inferred Events information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"\"GET https://reactome.org/AnalysisService/species/homoSapiens/{species}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"","code":"# \\donttest{ rba_reactome_analysis_species(species_dbid = 48892) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":null,"dir":"Reference","previous_headings":"","what":"Return the Results Associated with a Token — rba_reactome_analysis_token","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"Use token generated Reactome analysis (via rba_reactome_analysis) Retrieve analysis results. output format identical returned object rba_reactome_analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"","code":"rba_reactome_analysis_token( token, species, sort_by = \"ENTITIES_PVALUE\", order = \"ASC\", resource = \"TOTAL\", p_value = NULL, include_disease = TRUE, min = NULL, max = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"token token associated previous Reactome analysis. species Numeric Character: NCBI Taxonomy identifier (Human 9606), species name (e.g. \"Homo sapiens\") Reactome DbId (e.g Homo sapiens 48887). See rba_reactome_species Reactome Data Schema: Entries: Species. sort_by Sort result based column? available choices : \"NAME\", \"TOTAL_ENTITIES\", \"TOTAL_INTERACTORS\", \"TOTAL_REACTIONS\", \"FOUND_ENTITIES\", \"FOUND_INTERACTORS\", \"FOUND_REACTIONS\", \"ENTITIES_RATIO\", \"ENTITIES_PVALUE\", \"ENTITIES_FDR\" \"REACTIONS_RATIO\" order Sort Order. Can either \"ASC\" (default) \"DESC\". resource Filter results based resource. Default \"TOTAL\", available choices : \"TOTAL\", \"UNIPROT\", \"ENSEMBL\", \"CHEBI\", \"IUPHAR\", \"MIRBASE\", \"NCBI_PROTEIN\", \"EMBL\", \"COMPOUND\", \"ENTITIES_FDR\" \"PUBCHEM_COMPOUND\". p_value Set P value threshold. results P value equal less supplied threshold returned. (default = 1, Meaning P value filtering) include_disease Logical (default = TRUE) disease pathways included results? min (numeric) Minimum number entities pathways included results. max (numeric) Maximum number entities pathways included results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"List containing results information analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"Analysis, Reactome associate token analysis. can later used function requires token (e.g retrieve analysis results, download pdf). Note Reactome store token 7 days. can download full results rba_reactome_analysis_download, re-import anytime reactome (using rba_reactome_analysis_import) generate new token.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"\"GET https://reactome.org/AnalysisService/token/{token}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_analysis_token(token = \"MjAyMDEwMTYwMTI3MTNfMjY1MjM\", species = 9606) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Complexes That Include a Molecule — rba_reactome_complex_list","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"function retrieve list complexes include supplied molecule component.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"","code":"rba_reactome_complex_list(id, resource, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"id Molecule's external Identifier resource resource supplied ID? see: Reactome External Identifiers ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"Data frame row complex containing supplied molecule columns pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"\"GET https://reactome.org/ContentService/data/complexes/{resource}/ {identifier}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"","code":"# \\donttest{ rba_reactome_complex_list(id = \"3845\", resource = \"NCBI Gene\") # } # \\donttest{ rba_reactome_complex_list(id = \"P00533\", resource = \"UniProt\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":null,"dir":"Reference","previous_headings":"","what":"Get a Complex's Subunits — rba_reactome_complex_subunits","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"function return list subunits participants supplied complex.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"","code":"rba_reactome_complex_subunits(complex_id, exclude_structures = FALSE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"complex_id Reactome stable Identifier complex. exclude_structures (logical) contained complexes entity sets excluded results? (default = FALSE) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"Data frame row subunit supplied complex columns pertinent information subunit.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"Subunits returned recursively; means subunit complex, subunit complex also returned results.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"\"GET https://reactome.org/ContentService/data/complex/{id}/subunits\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"","code":"# \\donttest{ rba_reactome_complex_subunits(complex_id = \"R-HSA-5674003\", exclude_structures = FALSE) # } # \\donttest{ rba_reactome_complex_subunits(complex_id = \"R-HSA-109783\", exclude_structures = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":null,"dir":"Reference","previous_headings":"","what":"Reactome Diseases — rba_reactome_diseases","title":"Reactome Diseases — rba_reactome_diseases","text":"function Retrieve list diseases disease DOIDs annotated Reactome.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Reactome Diseases — rba_reactome_diseases","text":"","code":"rba_reactome_diseases(doid = FALSE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Reactome Diseases — rba_reactome_diseases","text":"doid (logical) Return disease DOIDs instead diseases? (default = FALSE) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Reactome Diseases — rba_reactome_diseases","text":"Data frame containing disease annotation available Reactome. doid set TRUE, DOID info returned instead.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Reactome Diseases — rba_reactome_diseases","text":"\"GET https://reactome.org/ContentService/data/diseases\" \"GET https://reactome.org/ContentService/data/diseases/doid\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Reactome Diseases — rba_reactome_diseases","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Reactome Diseases — rba_reactome_diseases","text":"","code":"# \\donttest{ rba_reactome_diseases() # } # \\donttest{ rba_reactome_diseases(doid = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"function retrieve list containing forms supplied Physical Entity ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"","code":"rba_reactome_entity_other_forms(entity_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"entity_id Reactome's entity ID. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"Data frame row forms supplied Entity ID columns pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"According Reactome API documentation, \"forms Physical Entities share Reference Entity identifier, e.g. PTEN H93R R-HSA-2318524 PTEN C124R R-HSA-2317439 two forms PTEN.\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"\"GET https://reactome.org/ContentService/data/entity/{id}/otherForms\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"","code":"# \\donttest{ rba_reactome_entity_other_forms(\"R-HSA-199420\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"Along Reactome's events hierarchy, function retrieve events beginning supplied event \"Top level Pathway\". see \"Details section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"","code":"rba_reactome_event_ancestors(event_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"event_id Reactome event's identifier. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"List every element Data frame listing supplied event along ancestor events. given event can part one pathway hierarchy, list may contain multiple data frames.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"Reactome's definition, Events building blocks biological processes two main classes: \"Pathway\" \"Reaction-like events\". events organized hierarchical structure; event child parent another event; hierarchy always begin \"Top level pathway\" event. Also note given event part one hierarchies.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"\"GET https://reactome.org/ContentService/data/event/{id}/ancestors\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"","code":"# \\donttest{ rba_reactome_event_ancestors(\"R-HSA-5673001\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"function retrieve full Events hierarchy supplied species. Directly species, child element \"top Level Pathway\". can traverse events tree following \"children\" element.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"","code":"rba_reactome_event_hierarchy(species, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"species Numeric Character: NCBI Taxonomy identifier (Human Taxonomy ID 9606.) species name (e.g. \"Homo sapiens\"). See rba_reactome_species Reactome Data Schema: Entries: Species. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"List representation species's events hierarchy described \"Details section\".","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"Reactome's definition, Events building blocks biological processes two main classes: \"Pathway\" \"Reaction-like events\". events organized hierarchical structure; event child parent another event; hierarchy always begin \"Top level pathway\" event. Also note given event part one hierarchies.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"\"GET https://reactome.org/ContentService/data/eventsHierarchy/{species}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"","code":"if (FALSE) { # \\dontrun{ #very large response! rba_reactome_event_hierarchy(\"Homo sapiens\") } # } if (FALSE) { # \\dontrun{ #very large response! rba_reactome_event_hierarchy(9606) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":null,"dir":"Reference","previous_headings":"","what":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"function called two scenarios: create_document = FALSE: retrieve image event's Diagram. create_document = TRUE: retrieve PDF document event's diagram image additional information. see \"Details section\" information","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"","code":"rba_reactome_exporter_diagram( event_id, save_to = NULL, create_document = FALSE, resource = \"TOTAL\", diagram_profile = \"Modern\", analysis_profile = \"Standard\", token = NULL, exp_column = NULL, document_level = 1, output_format = \"png\", image_quality = 5, flag_element = NULL, flg_interactors = TRUE, sel = NULL, title = TRUE, margin = 15, ehld = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"event_id Reactome event's identifier. save_to NULL Character: NULL: Save file automatically-generated path. Character string: valid file path save file . create_document logical: Create PDF document instead image? ( default = FALSE) resource analysis resource results overlaid top given pathways overview, diagram_profile Color profile diagrams, either \"Modern\" (default) \"Standard\". analysis_profile Color profile analysis, one : \"Standard\" (default), \"Strosobar\" \"Copper Plus\" token analysis Token results overlaid top given pathways overview. see: rba_reactome_analysis. exp_column numeric: (token supplied) Specify expression column overlay. document_level numeric: (\"create_document\" TRUE) 0 (default) event's children included PDF document. Set 1 include event's children. output_format (\"create_document\" FALSE) Image format saved diagram. Can one : png (default), jpeg, svg gif. image_quality Numeric: (\"create_document\" FALSE), number ranging 1 10. 1 lowest quality 10 highest (default = 5). flag_element (\"create_document\" FALSE) gene name, protein ID, chemical ID Reactome ID diagram's element flagged. flg_interactors Logical: (\"create_document\" FALSE) interactor considered flagging diagram element? (default = TRUE) sel (\"create_document\" FALSE) CSV line highlighting element(s) selection diagram. title Logical: (\"create_document\" FALSE) pathway name displayed image? (default = TRUE) margin Numeric: (\"create_document\" FALSE) number ranging 0 20 set image's margin. (default = 15) ehld logical: (\"create_document\" FALSE) \"Enhanced High Level Diagram\" considered? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"NULL, Based inputs, image PDF file saved disk.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"function called create_document = FALSE: result image format supplied \"output_format\" argument. supplied event ID refers pathway, image's content pathways diagram. supplied event ID refers sub-pathway reaction event, parent pathway's diagram exported, reaction sub-pathway's events highlighted. Note export image reaction-like event separately, use rba_reactome_exporter_reaction. function called create_document = TRUE: PDF document contain image event's diagram following information events: Summation, Literature references, Edit history type, location, compartments diseases. note call function \"document level = 1\", information supplied event's children also included.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"\"GET https://reactome.org/ContentService/exporter/diagram/{identifier} .{ext}\" \"GET https://reactome.org/ContentService/exporter/document/event/ {identifier}.pdf\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_exporter_diagram(event_id = \"R-HSA-177929\", create_document = FALSE) } # } if (FALSE) { # \\dontrun{ rba_reactome_exporter_diagram(event_id = \"R-HSA-6787403\", create_document = FALSE) } # } if (FALSE) { # \\dontrun{ rba_reactome_exporter_diagram(event_id = \"R-HSA-177929\", create_document = TRUE) } # } if (FALSE) { # \\dontrun{ rba_reactome_exporter_diagram(event_id = \"R-HSA-177929\", output_format = \"svg\", save_to = \"reactome_event_diagram.svg\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":null,"dir":"Reference","previous_headings":"","what":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"function export supplied Reactome Event (Pathway Reaction) SBGN (Systems Biology Graphical Notation) SBML (Systems Biology Markup Language)","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"","code":"rba_reactome_exporter_event(event_id, output_format, save_to = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"event_id Reactome event's database IDs (DbId) Stable IDs (StId). output_format Either \"sbgn\" \"sbml\". save_to NULL Character: NULL: Save file automatically-generated path. Character string: valid file path save file . ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"NULL, According inputs, SBGN SBML file saved disk.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"\"GET https://reactome.org/ContentService/exporter/event/ {identifier}.sbgn\" \"GET https://reactome.org/ContentService/exporter/event/ {identifier}.sbml\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_exporter_event(event_id = \"R-HSA-177929\", output_format = \"sbgn\", save_to = \"R-HSA-177929.sbgn\") } # } if (FALSE) { # \\dontrun{ rba_reactome_exporter_event(event_id = \"R-HSA-177929\", output_format = \"sbgn\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":null,"dir":"Reference","previous_headings":"","what":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"function Save Pathway Overview supplied specie image file.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"","code":"rba_reactome_exporter_overview( species, output_format = \"png\", save_to = NULL, image_quality = 5, flag_element = NULL, flg_interactors = TRUE, sel = NULL, title = TRUE, margin = 15, diagram_profile = \"Copper\", token = NULL, resource = \"TOTAL\", exp_column = NULL, coverage = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"species Numeric Character: NCBI Taxonomy identifier (Human Taxonomy ID 9606.) species name (e.g. \"Homo sapiens\"). See rba_reactome_species Reactome Data Schema: Entries: Species. output_format Images format, Can one : png (default), jpeg, svg gif. save_to NULL Character: NULL: Save file automatically-generated path. Character string: valid file path save file . image_quality Numeric: number ranging 1 10. 1 lowest quality 10 highest (default = 5). flag_element Gene name, protein ID, chemical ID Reactome ID diagram's element flagged. flg_interactors Logical: interactor considered flagging diagram element? (default = TRUE) sel CSV line highlighting element(s) selection diagram. title Logical: pathway name displayed image? (default = TRUE) margin Numeric: number ranging 0 20 set image's margin. (default = 15) diagram_profile Color profile diagrams, one \"Copper\" (default), \"Copper Plus\", \"Barium Lithium\" \"calcium salts\". token analysis Token results overlaid top given pathways overview. see: rba_reactome_analysis. resource analysis resource results overlaid top given pathways overview. exp_column numeric: (token supplied) Specify expression column overlay. coverage Logical: analysis coverage values overlaid? (default = FALSE) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"NULL, Based inputs, image file saved disk.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"\"GET https://reactome.org/ContentService/exporter/fireworks/{species}.{ext}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_exporter_overview(species = 9606, output_format = \"svg\", save_to = \"human_pathways.svg\") } # } if (FALSE) { # \\dontrun{ rba_reactome_exporter_overview(species = 9606, token = 123456789) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":null,"dir":"Reference","previous_headings":"","what":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"function Save Reactome event class \"ReactionLikeEvent\" image file.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"","code":"rba_reactome_exporter_reaction( event_id, save_to = NULL, output_format = \"png\", resource = \"TOTAL\", diagram_profile = \"Modern\", analysis_profile = \"Standard\", token = NULL, exp_column = NULL, image_quality = 5, flag_element = NULL, flg_interactors = TRUE, sel = NULL, title = TRUE, margin = 15, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"event_id Reactome Reaction-like event's identifier. save_to NULL Character: NULL: Save file automatically-generated path. Character string: valid file path save file . output_format Images format, Can one : png (default), jpeg, svg gif. resource analysis resource results overlaid top given pathways overview. diagram_profile Color profile diagrams, one \"Copper\" (default), \"Copper Plus\", \"Barium Lithium\" \"calcium salts\". analysis_profile Color profile analysis, one : \"Standard\" (default), \"Strosobar\" \"Copper Plus\". token analysis Token results overlaid top given pathways overview. see: rba_reactome_analysis. exp_column numeric: (token supplied) Specify expression column overlay. image_quality Numeric: number ranging 1 10. 1 lowest quality 10 highest (default = 5). flag_element Gene name, protein ID, chemical ID Reactome ID diagram's element flagged. flg_interactors Logical: interactor considered flagging diagram element? (default = TRUE) sel CSV line highlighting element(s) selection diagram. title Logical: pathway name displayed image? (default = TRUE) margin Numeric: number ranging 0 20 set image's margin. (default = 15) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"NULL, Based inputs, image file saved disk.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"Note function save Reaction-like event separately parent pathway context. overlay Reaction parent pathway, use rba_reactome_exporter_diagram.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"\"GET https://reactome.org/ContentService/exporter/reaction/ {identifier}.{ext}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_exporter_diagram(event_id = \"R-HSA-6787403\", create_document = FALSE) } # } if (FALSE) { # \\dontrun{ rba_reactome_exporter_diagram(event_id = \"R-HSA-6787403\", output_format = \"svg\", save_to = \"reactome_reacion_image.svg\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":null,"dir":"Reference","previous_headings":"","what":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"can call function two scenarios: 1- retrieve information available PSICQUIC resources, call function without providing argument; .e rba_reactome_interactors_psicquic(). 2-retrieve list interactors specific protein(s), fill function's arguments.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"","code":"rba_reactome_interactors_psicquic( proteins = NULL, resource = NULL, details = TRUE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"proteins Proteins retrieve PSICQUIC interactors. resource PSICQUIC resource supplied proteins. Call rba_reactome_interactors_psicquic() without argument get available options. details Logical: TRUE (default) detailed list interactors returned. FALSE, summary available interactors returned. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"Depending input, list containing detailed summary PSICQUIC interactions data frame registered PSICQUIC resources.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"\"POST https://reactome.org/ContentService/interactors/psicquic/molecules/ {resource}/details\" \"POST https://reactome.org/ContentService/interactors/psicquic/molecules/ {resource}/summary\" \"GET https://reactome.org/ContentService/interactors/psicquic/resources\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"","code":"# \\donttest{ rba_reactome_interactors_psicquic() # } # \\donttest{ rba_reactome_interactors_psicquic(proteins = c(\"TP53\", \"MYC\"), resource = \"BioGrid\", details = FALSE) # } # \\donttest{ rba_reactome_interactors_psicquic(proteins = c(\"TP53\", \"MYC\"), resource = \"BioGrid\", details = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"Reactome maintain locally host version IntAct(Static) interactions database. Using function, can retrieve IntAct information protein(s) two scenarios: endpoint = \"details\" \"summary\": Retrieve detailed/summary information supplied protein accession(s) IntAct database. endpoint = \"pathway\", Retrieve list Reactome pathways include supplied protein accession. Pathways class \"TopLevelPathway\" excluded.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"","code":"rba_reactome_interactors_static( proteins, endpoint = \"details\", only_diagrammed = FALSE, species = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"proteins Uniprot proteins accession(s). endpoint = \"pathway\", single protein accession can supplied. endpoint Can one : \"details\": return detailed information supplied protein(s) accession. \"summary\": return summary supplied protein(s) accession \"pathway\": return list pathways containing interacting molecules (excluding TopLevelPathway class). only_diagrammed Logical: (\"endpoint = \"pathway\") TRUE, pathways without diagram excluded. (default = FALSE) species \"endpoint = \"pathway\", scientific name species search pathways. See rba_reactome_species Reactome Data Schema: Entries: Species. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"List content varies based supplied \"endpoint\" argument.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"\"POST https://reactome.org/ContentService/interactors/static/ molecules/details\" \"POST https://reactome.org/ContentService/interactors/static/ molecules/summary\" \"GET https://reactome.org/ContentService/interactors/static/ molecules/pathways\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"","code":"# \\donttest{ rba_reactome_interactors_static(proteins = \"Q9BXM7-1\", endpoint = \"pathways\", species = \"Homo sapiens\") # } # \\donttest{ rba_reactome_interactors_static(proteins = c(\"Q9BXM7-1\", \"Q13501\"), endpoint = \"details\") # } # \\donttest{ rba_reactome_interactors_static(proteins = c(\"Q9BXM7-1\", \"Q13501\"), endpoint = \"summary\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":null,"dir":"Reference","previous_headings":"","what":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"providing external identifier given resource, can retrieve list pathways/reactions include supplied ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"","code":"rba_reactome_mapping(id, resource, map_to, species = \"Homo sapiens\", ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"id Molecule's external Identifier resource resource supplied ID? see: Reactome External Identifiers map_to Either \"pathways\" \"reactions\". species Numeric Character: NCBI Taxonomy identifier (Human 9606), species name (e.g. \"Homo sapiens\") Reactome DbId (e.g Homo sapiens 48887). See rba_reactome_species Reactome Data Schema: Entries: Species. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"Data frame row pathway/reaction columns pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"\"GET https://reactome.org/ContentService/data/mapping/{resource}/ {identifier}/pathways\" \"GET https://reactome.org/ContentService/data/mapping/{resource}/ {identifier}/reactions\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"","code":"# \\donttest{ rba_reactome_mapping(id = \"PTEN\", resource = \"UniProt\", map_to = \"reactions\", species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"Reactome incorporate manually curated human reactions PANTHER's protein homology data Computationally infer events eukaryotic species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"","code":"rba_reactome_orthology(event_ids, species_dbid, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"event_ids Human Reactome event ID(s) retrieve orthologous events. species_dbid Reactome database ID (DbId) target species. (e.g Mus musculus 48892). See rba_reactome_species Reactome Data Schema: Entries: Species. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"List containing found Orthologous event(s) supplied species pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"version 73 (11 June 2020), using orthology-based approach, Homo sapiens events projected 18,654 orthologous pathways ( 81,835 orthologous proteins) 15 non-human species. See Reactome Computationally Inferred Events information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"\"POST https://reactome.org/ContentService/data/orthologies/ids/ species/{speciesId}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"","code":"# \\donttest{ rba_reactome_orthology(event_ids = c(\"R-HSA-6799198\", \" R-HSA-72764\"), species_dbid = 49633) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"function retrieve list complexes sets supplied entity ID participates (e.g. complex component, reaction output).","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"","code":"rba_reactome_participant_of(entity_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"entity_id Reactome's entity ID. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"List Reactome database Entities supplied ID participant .","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"\"GET https://reactome.org/ContentService/data/entity/{id}/componentOf\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"","code":"# \\donttest{ rba_reactome_participant_of(entity_id = \"R-HSA-199420\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Participants of a Reactome Event — rba_reactome_participants","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"Participating molecules Reactome comprises set 'Physical Entity' 'Reference Entities' class objects. Use function retrieve , 'Physical Entity' 'Reference Entities' participants given event.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"","code":"rba_reactome_participants( event_id, only_physical_entities = FALSE, only_reference_entities = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"event_id Reactome event's database ID (DbId) Stable ID (StId). only_physical_entities Logical: TRUe, participating 'Physical Entities' returned. only_reference_entities Logical: TRUe, participating 'Reference Entities' returned. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"List participant supplied Event ID. Data frame physical 'Reference Entities' requested.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"'Physical Entity' Instance include individual molecule, multi-molecular complex set molecule forming group based characteristics. single molecule can different 'Physical Entity' instances based associated attributes. example, IgK Ig kappa chain, two 'Physical Entity' instances; one, ID \"R-HSA-197041\" refers secreted antibody protein extra-cellular region; second one ID \"R-HSA-2038819\" refers plasma-membrane-integrated form antibody protein. make possible link multiple 'Physical Entity' instances molecule, Reactome uses data class named \"'Reference Entities'\" correspond invariant attribute molecule. example, -mentioned 'Physical Entities' see 'Reference Entities' named \"UniProt:P01834 IGKC. See Reactome Data Model information data model Physical Entities.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"\"GET https://reactome.org/ContentService/data/participants/{id}\" \"GET https://reactome.org/ContentService/data/participants/{id}/ participatingPhysicalEntities\" \"GET https://reactome.org/ContentService/data/participants/{id}/ referenceEntities\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"","code":"# \\donttest{ rba_reactome_participants(\"R-HSA-5682012\") # } # \\donttest{ rba_reactome_participants(\"R-HSA-5682012\", only_physical_entities = TRUE) # } # \\donttest{ rba_reactome_participants(\"R-HSA-5682012\", only_reference_entities = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"Reactome Event comprised events (meaning, pathway include pathways ). Use function recursively return events reside downstream supplied event ID ( attribute events).","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"","code":"rba_reactome_pathways_events(event_id, attribute_name = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"event_id Reactome event's database ID (DbId) Stable ID (StId). attribute_name attribute events returned instead whole events. see Reactome Data Schema: Event available options. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"Data frame row contained event columns event's attributes. \"attribute_name\" argument supplied, character vector returned.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"Reactome's definition, Events building blocks biological processes two main classes: \"Pathway\" \"Reaction-like events\". events organized hierarchical structure; event child parent another event; hierarchy always begin \"Top level pathway\" event. Also note given event part one hierarchies.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"\"GET https://reactome.org/ContentService/data/pathway/{id}/ containedEvents\" \"GET https://reactome.org/ContentService/data/pathway/{id}/ containedEvents/{attributeName}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"","code":"# \\donttest{ rba_reactome_pathways_events(event_id = \"R-HSA-5673001\") # } # \\donttest{ rba_reactome_pathways_events(event_id = \"R-HSA-5673001\", attribute_name = \"displayName\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":null,"dir":"Reference","previous_headings":"","what":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"Use function search event hierarchy retrieve list lower level pathways (non TopLevelPathway class) contain given 'Physical Entity' Event. See \"Arguments section\" modify search.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"","code":"rba_reactome_pathways_low( entity_id, with_diagram = FALSE, all_forms = FALSE, species = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"entity_id entity exist pathways. with_diagram Logical: include pathways diagram? all_forms Logical: variants supplied entity_id considered? (e.g. molecule different compartment, secretory form etc.) see rba_reactome_participants's \"Details section\" learn Reactome classifies molecules. species (optional) Numeric Character: confine search specific species providing NCBI Taxonomy identifier (Human Taxonomy ID 9606) species name (e.g. \"Homo sapiens\"). See rba_reactome_species Reactome Data Schema: Entries: Species. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"Data frame row pathway contains supplied entity columns pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"\"GET https://reactome.org/ContentService/data/pathways/low/entity/{id}\" \"GET https://reactome.org/ContentService/data/pathways/low/diagram/ entity/{id}\" \"GET https://reactome.org/ContentService/data/pathways/low/diagram/ entity/{id}/allForms\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"","code":"# \\donttest{ rba_reactome_pathways_low(entity_id = \"R-HSA-199420\") # } # \\donttest{ rba_reactome_pathways_low(entity_id = \"R-HSA-199420\", with_diagram = TRUE) # } # \\donttest{ rba_reactome_pathways_low(entity_id = \"R-HSA-199420\", with_diagram = TRUE, all_forms = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"function Return list pathways class \"TopLevelPathway\" annotated supplied species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"","code":"rba_reactome_pathways_top(species, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"species Numeric Character: NCBI Taxonomy identifier (Human Taxonomy ID 9606.) species name (e.g. \"Homo sapiens\"). See rba_reactome_species Reactome Data Schema: Entries: Species. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"Data frame row Top Level Pathway columns pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"Reactome's Events hierarchy specie begin pathways class \"TopLevelPathway\" (e.g. \"Immune System\", \"Metabolism proteins\"). event's hierarchy tree, TopLevelPathway events (e.g. \"Adaptive immune system\", \"Innate immune system\"). Based chosen pathway, hierarchy tree typically goes .","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"\"GET https://reactome.org/ContentService/data/pathways/top/{species}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"","code":"# \\donttest{ rba_reactome_pathways_top(species = 9606) # } # \\donttest{ rba_reactome_pathways_top(species = \"Saccharomyces cerevisiae\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":null,"dir":"Reference","previous_headings":"","what":"A person by his identifiers — rba_reactome_people_id","title":"A person by his identifiers — rba_reactome_people_id","text":"person identifiers","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"A person by his identifiers — rba_reactome_people_id","text":"","code":"rba_reactome_people_id( person_id, authored_pathways = FALSE, publications = FALSE, attribute_name = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"A person by his identifiers — rba_reactome_people_id","text":"person_id Reactome database ID (DbId) ORCHID ID authored_pathways Logical: return Pathway list authored person? (default = FALSE) publications Logical: return publications list authored person? (Defalt = FALSE) attribute_name (optional) Reactome person attribute return . see Reactome Data Schema: person available options. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"A person by his identifiers — rba_reactome_people_id","text":"List containing requested informations supplied person.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"A person by his identifiers — rba_reactome_people_id","text":"\"GET https://reactome.org/ContentService\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"A person by his identifiers — rba_reactome_people_id","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"A person by his identifiers — rba_reactome_people_id","text":"","code":"# \\donttest{ rba_reactome_people_id(\"391309\") # } # \\donttest{ rba_reactome_people_id(person_id = \"391309\", authored_pathways = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Persons Information by Name — rba_reactome_people_name","title":"Get Persons Information by Name — rba_reactome_people_name","text":"Using function can query people partially matching exact name retrieve list matching people Reactome.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Persons Information by Name — rba_reactome_people_name","text":"","code":"rba_reactome_people_name(person_name, exact_match = FALSE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Persons Information by Name — rba_reactome_people_name","text":"person_name first last name person exact_match Logical: supplied name considered exact match? (default = FALSE) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Persons Information by Name — rba_reactome_people_name","text":"List element search hit contains person's information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Persons Information by Name — rba_reactome_people_name","text":"\"GET https://reactome.org/ContentService/data/people/name/{name}\" \"GET https://reactome.org/ContentService/data/people/name/{name}/exact\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Persons Information by Name — rba_reactome_people_name","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Persons Information by Name — rba_reactome_people_name","text":"","code":"# \\donttest{ rba_reactome_people_name(\"Jupe\") # } # \\donttest{ rba_reactome_people_name(\"Steve Jupe\", exact_match = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":null,"dir":"Reference","previous_headings":"","what":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"Using Comprehensive function, can Retrieve object Reactome knowledge-base","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"","code":"rba_reactome_query( ids, enhanced = FALSE, map = FALSE, attribute_name = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"ids single Multiple database IDs (DbId), Stable IDs (StId) mixture . enhanced Logical: (Default = FALSE) 'TRUE' information supplied entry returned. (can set argument 'TRUE' supply single ID). map (Default = FALSE) supplied IDs mapped? argument considered supply multiple IDs. (e.g. supply previous version stable identifiers.) attribute_name (Optional) Return Attribute supplied Database Object. (can use argument supply single ID) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"List containing query outputs.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"\"POST https://reactome.org/ContentService/data/query/ids\" \"POST https://reactome.org/ContentService/data/query/ids/map\" \"GET https://reactome.org/ContentService/data/query/{id}\" \"GET https://reactome.org/ContentService/data/query/enhanced/{id}\" \"GET https://reactome.org/ContentService/data/query/{id}/{attributeName}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"","code":"# \\donttest{ rba_reactome_query(ids = c(\"8953958\", \"11982506\", \"R-ALL-9649879\")) # } # \\donttest{ rba_reactome_query(ids = \"R-HSA-9656256\", enhanced = TRUE) # } # \\donttest{ rba_reactome_query(ids = \"8863054\", attribute_name = \"displayName\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Reactome Species — rba_reactome_species","title":"Get Reactome Species — rba_reactome_species","text":"Use function retrieve table Available species Reactome.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Reactome Species — rba_reactome_species","text":"","code":"rba_reactome_species(only_main = FALSE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Reactome Species — rba_reactome_species","text":"only_main Logical: set TRUE, return species either manually-curated computationally inferred pathways. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Reactome Species — rba_reactome_species","text":"Data frame row species columns pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Reactome Species — rba_reactome_species","text":"\"GET https://reactome.org/ContentService/data/species/\" \"GET https://reactome.org/ContentService/data/species/main\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Reactome Species — rba_reactome_species","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Reactome Species — rba_reactome_species","text":"","code":"# \\donttest{ rba_reactome_species() # } # \\donttest{ rba_reactome_species(only_main = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":null,"dir":"Reference","previous_headings":"","what":"The version number of current database — rba_reactome_version","title":"The version number of current database — rba_reactome_version","text":"Returns current version Reactome database.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"The version number of current database — rba_reactome_version","text":"","code":"rba_reactome_version(...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"The version number of current database — rba_reactome_version","text":"... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"The version number of current database — rba_reactome_version","text":"Character string containing version Reactome database.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"The version number of current database — rba_reactome_version","text":"\"GET https://reactome.org/ContentService/data/database/version\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"The version number of current database — rba_reactome_version","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"The version number of current database — rba_reactome_version","text":"","code":"# \\donttest{ rba_reactome_version() # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":null,"dir":"Reference","previous_headings":"","what":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"Use function retrieve list Reactome ReferenceEntity associated supplied Cross Reference (.e. External) ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"","code":"rba_reactome_xref(xref_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"xref_id molecule's cross-reference (external) identifier. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"List containing ReferenceEntity corresponding supplied cross-reference (external) ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"Reactome cross-references external database's identifiers database Entries named ReferenceEntity, resembles invariant aspect molecule. Thus one--many relationship Reactome's ReferenceEntity object molecule's ID external databases, Reactome's terms called Cross Reference. See rba_reactome_participants's \"Details section\" learn Reactome classifies molecules.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"\"GET https://reactome.org/ContentService/references/mapping/{identifier}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"","code":"# \\donttest{ rba_reactome_xref(\"CD40\") # } # \\donttest{ rba_reactome_xref(\"ENSP00000361350\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":null,"dir":"Reference","previous_headings":"","what":"Retrieving Functional Annotation — rba_string_annotations","title":"Retrieving Functional Annotation — rba_string_annotations","text":"STRING cross-reference proteins several databases (see \"Details\" section). providing input set o proteins (optionally background universe protein set), can use function retrieve full set terms (annotations) pertinent input proteins database, among information term.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Retrieving Functional Annotation — rba_string_annotations","text":"","code":"rba_string_annotations( ids, species = NULL, allow_pubmed = FALSE, split_df = TRUE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Retrieving Functional Annotation — rba_string_annotations","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) allow_pubmed logical: (default = FALSE) PubMed usually assigns large number reference publications protein. order reduce output size, PubMed's results excluded results, unless stated otherwise setting argument TRUE. split_df (logical, default = TRUE), TRUE, instead one data frame, results different categories split multiple data frames based 'category'. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Retrieving Functional Annotation — rba_string_annotations","text":"data frame every row assigned terms columns terms category, description, number genes, pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Retrieving Functional Annotation — rba_string_annotations","text":"STRING currently maps retrieve enrichment results based Gene Ontology (GO), KEGG pathways, UniProt Keywords, PubMed publications, Pfam domains, InterPro domains, SMART domains. Note function return full list terms containing supplied proteins. perform enrichment retrieve enriched subset terms, use rba_string_enrichment.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Retrieving Functional Annotation — rba_string_annotations","text":"\"POST https://string-db.org/api/{output_format}/functional_annotation? identifiers={your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Retrieving Functional Annotation — rba_string_annotations","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Retrieving Functional Annotation — rba_string_annotations","text":"","code":"# \\donttest{ rba_string_annotations(ids = \"TP53\", species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":null,"dir":"Reference","previous_headings":"","what":"Getting Functional Enrichment — rba_string_enrichment","title":"Getting Functional Enrichment — rba_string_enrichment","text":"STRING cross-reference proteins several databases (see \"Details\" section). providing input set o proteins (optionally background universe protein set), can use function perform enrichment test retrieve list enriched terms database, among pertinent information term. Use rba_string_enrichment_image retrieve analysis results plot.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Getting Functional Enrichment — rba_string_enrichment","text":"","code":"rba_string_enrichment( ids, species = NULL, background = NULL, split_df = TRUE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Getting Functional Enrichment — rba_string_enrichment","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. Note one id supplied, STRING expands network 10 proteins. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) background character vector: set STRING protein IDs used statistical background (universe) computing P-value terms. STRING IDs acceptable. (See rba_string_map_ids map IDs.) split_df (logical, default = TRUE), TRUE, instead one data frame, results different categories split multiple data frames based 'category'. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Getting Functional Enrichment — rba_string_enrichment","text":"list data frames every row enriched terms p-value smaller 0.1 columns terms category, description, number genes, p-value, fdr pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Getting Functional Enrichment — rba_string_enrichment","text":"STRING currently maps retrieve enrichment results based Gene Ontology (GO), KEGG pathways, UniProt Keywords, PubMed publications, Pfam domains, InterPro domains, SMART domains. Note function return enriched terms pertinent proteins p-value lesser 0.1. retrieve full list terms -unfiltered enrichment p-values-, use rba_string_annotations.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Getting Functional Enrichment — rba_string_enrichment","text":"\"POST https://string-db.org/api/{output_format}/enrichment?identifiers= {your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Getting Functional Enrichment — rba_string_enrichment","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Getting Functional Enrichment — rba_string_enrichment","text":"","code":"# \\donttest{ rba_string_enrichment(ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":null,"dir":"Reference","previous_headings":"","what":"Get STRING Enrichment Plot — rba_string_enrichment_image","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"addition performing enrichment analysis, STRING allows also visualize analysis results. Use rba_string_enrichment retrieve analysis results data frame.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"","code":"rba_string_enrichment_image( ids, species, category = \"Process\", image_format = \"image\", save_image = TRUE, group_by_similarity = NULL, color_palette = \"mint_blue\", number_of_term_shown = 10, x_axis = \"signal\", ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. Note one id supplied, STRING expands network 10 proteins. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. category terms set use perform enrichment analysis. valid values (See details info): \"Process\" (default), \"Function\", \"Component\", \"Keyword\", \"KEGG\", \"RCTM\", \"HPO\", \"MPO\", \"DPO\", \"WPO\", \"ZPO\", \"FYPO\", \"Pfam\", \"SMART\", \"InterPro\", \"PMID\", \"NetworkNeighborAL\", \"COMPARTMENTS\", \"TISSUES\", \"DISEASES\", \"WikiPathways\" image_format one : \"image\": PNG image normal resolution. \"highres_image\": High-resolution PNG image. \"svg\": Scalable Vector Graphics image. save_image Logical Character: TRUE: Save image automatically-generated path. FALSE: save image, just return R object. Character string: valid file path save image . group_by_similarity Jackard index treshold visually group related terms. Valid values 0.1 1 increment 0.1. Default value NULL (.e. grouping). color_palette Color pallet code FDR values. Valid values : \"mint_blue\" (default), \"lime_emerald\", \"green_blue\", \"peach_purple\", \"straw_navy\", \"yellow_pink\" number_of_term_shown (default: 10) Maximum number results include plot. x_axis variable show x axis rank results based . Valid values : \"signal\" (default), \"strength\", \"FDR\", \"gene_count\" ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"plot summarizing enrichment results, can PNG SVG depending inputs.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"Available values category follow. Default value \"Process\". Process: Biological Process (Gene Ontology) Function: Molecular Function (Gene Ontology) Component: Cellular Component (Gene Ontology) Keyword: Annotated Keywords (UniProt) KEGG: KEGG Pathways RCTM: Reactome Pathways HPO: Human Phenotype (Monarch) MPO: Mammalian Phenotype Ontology (Monarch) DPO: Drosophila Phenotype (Monarch) WPO: C. elegans Phenotype Ontology (Monarch) ZPO: Zebrafish Phenotype Ontology (Monarch) FYPO: Fission Yeast Phenotype Ontology (Monarch) Pfam: Protein Domains (Pfam) SMART: Protein Domains (SMART) InterPro: Protein Domains Features (InterPro) PMID: Reference Publications (PubMed) NetworkNeighborAL: Local Network Cluster (STRING) COMPARTMENTS: Subcellular Localization (COMPARTMENTS) TISSUES: Tissue Expression (TISSUES) DISEASES: Disease-gene Associations (DISEASES) WikiPathways: WikiPathways","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"\"POST https://string-db.org/api/{output_format}/enrichmentfigure\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"","code":"if (FALSE) { # \\dontrun{ rba_string_enrichment( ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606) } # } if (FALSE) { # \\dontrun{ rba_string_enrichment( ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606, category = \"KEGG\") } # } if (FALSE) { # \\dontrun{ rba_string_enrichment( ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606, x_axis = \"strength\", number_of_term_shown = 20 ) } # } if (FALSE) { # \\dontrun{ rba_string_enrichment( ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606, color_palette = \"straw_navy\" ) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"Even annotation input proteins, STRING can Compare Given proteins interactions pattern background proteome-wide interaction distribution determine given set proteins functionally related.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"","code":"rba_string_enrichment_ppi( ids, species = NULL, required_score = NULL, background = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) required_score Numeric: minimum interaction score interaction included image. supplied, threshold applied STRING Based network. (low Confidence = 150, Medium Confidence = 400, High Confidence = 700, Highest confidence = 900) background character vector: set STRING protein IDs used background proteome. STRING IDs acceptable. (See rba_string_map_ids map IDs.) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"list protein-protein interaction enrichment results.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"\"POST https://string-db.org/api/{output_format}/ppi_enrichment?identifiers= {your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"","code":"# \\donttest{ rba_string_enrichment_ppi(ids = c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\", \"CDK1\", \"KIF23\", \"PLK1\", \"RAC2\", \"RACGAP1\"), species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"Using function, can retrieve highest Smith-Waterman bit scores among input proteins proteins every STRING species (e.g. closest homologous protein input protein species). Bit Scores serve similarity scores protein sequence; , according STRING documentations, proxy protein homology.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"","code":"rba_string_homology_inter(ids, species = NULL, species_b = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. species Numeric: NCBI Taxonomy identifier input proteins; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) species_b (optional) Numeric: one NCBI Taxonomy identifiers species limit closets homologous proteins search. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"data frame input proteins closest homologous proteins among (defined) STRING species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"Note function return highest similarity score hits given protein(s) closets homologous proteins species. retrieve similarity scores different proteins within species see rba_string_homology_intra. Similarity matrix imported -STRING- : Similarity Matrix Proteins (SIMAP)","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"\"POST https://string-db.org/api/{output-format}/homology_best? identifiers={your_identifiers}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"","code":"# \\donttest{ rba_string_homology_inter(ids = \"p53\", species = 9606, species_b = 7070) # } # \\donttest{ rba_string_homology_inter(ids = \"ENSP00000269305\", species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"Using function, can retrieve Smith-Waterman bit scores among proteins species. Bit Scores serve similarity scores protein sequence; , according STRING documentations, proxy protein homology.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"","code":"rba_string_homology_intra(ids, species = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"data frame bit scores supplied proteins self-hit. Reduce transferred data, STRING returns one half similarity matrix; pose problem similarity matrix symmetrical.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"Note function retrieve similarity scores different proteins \"within species\". Get similarity scores given protein closets homologous proteins species, see rba_string_homology_inter. Similarity matrix imported -STRING- : Similarity Matrix Proteins (SIMAP)","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"\"POST https://string-db.org/api/{output-format}/homology?identifiers= {your_identifiers}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"","code":"# \\donttest{ rba_string_homology_intra(ids = c(\"CDK1\", \"CDK2\"), species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":null,"dir":"Reference","previous_headings":"","what":"Get All STRING Interaction Partners — rba_string_interaction_partners","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"function retrieve STRING interactions include proteins one party interaction. (e.g. interaction proteins every STRING proteins.) Given size STRING database, function return long results. See \"Arguments\" section information filter interactions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"","code":"rba_string_interaction_partners( ids, species = NULL, required_score = NULL, network_type = \"functional\", limit = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) required_score Numeric: minimum interaction score interaction included image. supplied, threshold applied STRING Based network. (low Confidence = 150, Medium Confidence = 400, High Confidence = 700, Highest confidence = 900) network_type one : \"functional\": (default) edge's indicate physical functional associations. limit Limit number returned interaction partners per input proteins. (e.g. Number confident interaction partner return per input protein.) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"data frame row network interaction columns contains interactor information interaction scores.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"Note function retrieve interactions input proteins every STRING proteins. retrieve interaction among input protein-set, see rba_string_interactions_network.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"\"POST https://string-db.org/api/{output-format}/ interaction_partners?identifiers={your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"","code":"# \\donttest{ rba_string_interaction_partners(ids = c(\"9606.ENSP00000269305\", \"9606.ENSP00000398698\", \"9606.ENSP00000275493\"), network_type = \"functional\") # } # \\donttest{ rba_string_interaction_partners(ids = \"9606.ENSP00000269305\", species = 9606, required_score = 700) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":null,"dir":"Reference","previous_headings":"","what":"Get STRING Network Interactions — rba_string_interactions_network","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"function retrieve Sting interaction pairs among input protein ids, combined score separate score STRING score channels. can expand network defined size providing \"add_node\" parameter.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"","code":"rba_string_interactions_network( ids, species = NULL, required_score = NULL, add_nodes = NULL, network_type = \"functional\", use_query_labels = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"ids protein IDs. strongly recommended supply STRING IDs. See rba_string_map_ids information. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) required_score Numeric: minimum interaction score interaction included image. supplied, threshold applied STRING Based network. (low Confidence = 150, Medium Confidence = 400, High Confidence = 700, Highest confidence = 900) add_nodes Numeric: Number neighboring proteins added network. none supplied user, argument value depend number supplied \"ids\" argument: Single id: add_node set 10 retrieve interaction neighborhood input protein. Multiple ids: add_node set 0, thus output interactions input proteins. network_type one : \"functional\": (default) edge's indicate physical functional associations. \"physical\": edges indicate two proteins physical interaction parts complex. use_query_labels Logical: (Default = FALSE) Use names supplied 'ids' argument nodes labels instead STRING's default ones. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"data frame row network interaction columns contains interactor information interaction scores: stringId_A: STRING identifier (protein ) stringId_B:STRING identifier (protein B) preferredName_A: common protein name (protein ) preferredName_B: common protein name (protein B) ncbiTaxonId: NCBI taxon identifier score: combined score nscore: gene neighborhood score fscore: gene fusion score pscore: phylogenetic profile score ascore: co-expression score escore: experimental score dscore: database score tscore: textmining score","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"Note function return interactions set supplied proteins, , expand interaction network given parameters. retrieve list possible interacting proteins given input, see rba_string_interaction_partners.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"\"POST https://string-db.org/api/{output-format}/network?identifiers= {your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"","code":"# \\donttest{ rba_string_interactions_network(ids = c(\"9606.ENSP00000269305\", \"9606.ENSP00000398698\", \"9606.ENSP00000275493\"), network_type = \"functional\") # } # \\donttest{ rba_string_interactions_network(ids = c(\"9606.ENSP00000269305\", \"9606.ENSP00000398698\", \"9606.ENSP00000275493\"), species = 9606, add_nodes = 10) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":null,"dir":"Reference","previous_headings":"","what":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"function Calls STRING's API Convert set identifiers STRING Identifiers. Although can call STRING services variety common identifiers, recommended STRING's documentations first map Protein/genes IDs STRING IDs proceed STRING's functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"","code":"rba_string_map_ids(ids, species = NULL, echo_query = FALSE, limit = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"ids Common gene/protein Identifier(s) mapped. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) echo_query (default = FALSE) Include input IDs column results. limit (Numeric, Optional) limit number matches per input ID. output sorted best matches first. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"data frame mapped STRING IDs pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"\"POST https://string-db.org/api/{output-format}/get_string_ids?identifiers= {your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"","code":"# \\donttest{ rba_string_map_ids(ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":null,"dir":"Reference","previous_headings":"","what":"Get STRING Network Image — rba_string_network_image","title":"Get STRING Network Image — rba_string_network_image","text":"Depending supplied single protein ID one protein ID, function produce static image interaction networks among input proteins /proteins. See \"Arguments\" section learn can modify network image.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get STRING Network Image — rba_string_network_image","text":"","code":"rba_string_network_image( ids, image_format = \"image\", save_image = TRUE, species = NULL, add_color_nodes = NULL, add_white_nodes = NULL, required_score = NULL, network_flavor = \"evidence\", network_type = \"functional\", hide_node_labels = FALSE, use_query_labels = FALSE, hide_disconnected_nodes = FALSE, hide_structure_pics = FALSE, flat_nodes = FALSE, node_labels_center = FALSE, node_labels_font_size = 12, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get STRING Network Image — rba_string_network_image","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. image_format one : \"image\": PNG image normal resolution. \"highres_image\": High-resolution PNG image. \"svg\": Scalable Vector Graphics image. save_image Logical Character: TRUE: Save image automatically-generated path. FALSE: save image, just return R object. Character string: valid file path save image . species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) add_color_nodes Numeric: number colored nodes (queried proteins first shell interactors) added. add_white_nodes Numeric: number white nodes (second shell interactors) added colored nodes. required_score Numeric (0 1000): minimum interaction score interaction included image. supplied, threshold applied STRING Based network. (low Confidence = 150, Medium Confidence = 400, High Confidence = 700, Highest confidence = 900) network_flavor style network edges, one : \"evidence\": (default) Line's color based type evidences support interaction. \"confidence\": Line's thickness indicator interaction's confidence score. \"action\": Line's Shape indicator interaction's predicted mode actions. network_type one : \"functional\": (default) edge's indicate physical functional associations. \"physical\": edges indicate two proteins physical interaction parts complex. hide_node_labels Logical: (Default = FALSE) Hide proteins names image use_query_labels Logical: (Default = FALSE) Use names supplied 'ids' argument nodes labels instead STRING's default ones. hide_disconnected_nodes Logical: (Default = FALSE) Hide proteins connected proteins image hide_structure_pics Logical: (Default = FALSE) Hide protein's structure picture inside bubbles flat_nodes Logical: (Default = FALSE) Make nodes design flat instead default 3D design node_labels_center Logical: (Default = FALSE) Position protein names labels center aligned nodes node_labels_font_size Numeric (5 50, Default = 12) Font size protein nodes labels ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get STRING Network Image — rba_string_network_image","text":"network images can PNG SVG depending inputs.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get STRING Network Image — rba_string_network_image","text":"\"POST https://string-db.org/api/{output-format}/network?identifiers= {your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get STRING Network Image — rba_string_network_image","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get STRING Network Image — rba_string_network_image","text":"","code":"if (FALSE) { # \\dontrun{ rba_string_network_image(ids = c(\"9606.ENSP00000269305\", \"9606.ENSP00000398698\", \"9606.ENSP00000275493\"), network_type = \"functional\", save_image = FALSE) } # } if (FALSE) { # \\dontrun{ rba_string_network_image(ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606, save_image = TRUE) } # } if (FALSE) { # \\dontrun{ rba_string_network_image(ids = \"9606.ENSP00000269305\", image_format = \"highres_image\", save_image = file.path(getwd(), \"TP53_network.png\")) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Current STRING Version — rba_string_version","title":"Get Current STRING Version — rba_string_version","text":"Get STRING version stable Address package currently uses.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Current STRING Version — rba_string_version","text":"","code":"rba_string_version(...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Current STRING Version — rba_string_version","text":"... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Current STRING Version — rba_string_version","text":"list STRING version stable address.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Current STRING Version — rba_string_version","text":"Note STRING releases new version approximately 2 years cycle. Nevertheless, insure reproducibility, STRING dedicates stable address release. Thus can always reproduce research results obtained via certain STRING version. version rbioapi returns outdated, Kindly contact .","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Current STRING Version — rba_string_version","text":"\"GET https://string-db.org/api/{output_format}/version\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Current STRING Version — rba_string_version","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Current STRING Version — rba_string_version","text":"","code":"# \\donttest{ rba_string_version() # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Antigens by UniProt Accession — rba_uniprot_antigens","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"UniProt maps Antigenic features different sources proteins' sequences. Using function, can retrieve Antigenic features map given UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"","code":"rba_uniprot_antigens(accession, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"accession UniProtKB primary secondary accession(s). ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"list containing Antigenic features supplied UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"\"GET https://www.ebi.ac.uk/proteins/api/antigen/{accession}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"","code":"# \\donttest{ rba_uniprot_antigens(\"P04626\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Antigens in UniProt — rba_uniprot_antigens_search","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"UniProt maps Antigenic (Antibody-binding) features different sources proteins' sequences. Using function, can search Antigenic sequences map UniProt proteins. may also refine search modifiers score etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"","code":"rba_uniprot_antigens_search( accession = NULL, antigen_sequence = NULL, antigen_id = NULL, ensembl_id = NULL, match_score = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. antigen_sequence Protein sequence antigenic site. antigen_id Human Protein Atlas (HPA) antigen ID. can supply 20 IDs. ensembl_id Ensembl Stable Transcript ID. can supply 20 IDs. match_score (Numeric) Minimum alignment score antigen sequence target protein sequence. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"list element correspond UniProt protein (search hit) Antigenic features organized \"features\" sub-list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/antigen\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"","code":"# \\donttest{ rba_uniprot_antigens_search(antigen_id = \"HPA001060\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"Using function can retrieve genomic Coordinates Protein either providing protein's UniProt accession ID cross-reference database (Ensembl, CCDC, HGNC RefSeq). supply either 'accession' alone 'db_type' 'db_id' together.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"","code":"rba_uniprot_coordinates(accession = NULL, db_type = NULL, db_id = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"accession UniProtKB primary secondary accession. db_type cross-reference database name, one : \"Ensembl\", \"CCDC\", \"HGNC\" \"RefSeq\". db_id Protein's ID cross-reference database ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"list genome coordinates supplied protein.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"information UniProt imports calculates genomic coordinates data, see: McGarvey, P. B., Nightingale, ., Luo, J., Huang, H., Martin, M. J., Wu, C., & UniProt Consortium (2019). UniProt genomic mapping deciphering functional effects missense variants. Human mutation, 40(6), 694–705. https://doi.org/10.1002/humu.23738","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"\"GET https://ebi.ac.uk/proteins/api/coordinates/{accession}\" \"GET https://ebi.ac.uk/proteins/api/coordinates/{dbtype}:{dbid}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"","code":"# \\donttest{ rba_uniprot_coordinates(accession = \"P25942\") # } # \\donttest{ rba_uniprot_coordinates(db_type = \"HGNC\", db_id = \"CD40\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"information UniProt imports calculates genomic coordinates data, see: McGarvey, P. B., Nightingale, ., Luo, J., Huang, H., Martin, M. J., Wu, C., & UniProt Consortium (2019). UniProt genomic mapping deciphering functional effects missense variants. Human mutation, 40(6), 694–705. https://doi.org/10.1002/humu.23738","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"","code":"rba_uniprot_coordinates_location( taxid, locations, in_range = TRUE, feature = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"taxid NIH-NCBI Taxon ID. locations genomic location formatted : chromosome:start-end. (e.g. \"Y:17100001-19600000\"). omit chromosome, interpreted chromosome (e.g. \"1-10000\"). in_range return proteins range. feature (logical) Get features? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"list containing UniProt proteins match supplied genomic location taxonomy ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"\"GET https://ebi.ac.uk/proteins/api/coordinates /{taxonomy}/{locations}/feature\" \"GET https://ebi.ac.uk/proteins/api/coordinates /{taxonomy}/{locations}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"","code":"# \\donttest{ rba_uniprot_coordinates_location(taxid = 9606, locations = \"Y:17100001-19600000\", in_range = TRUE) # } # \\donttest{ rba_uniprot_coordinates_location(taxid = 9606, locations = \"20:39000001\", in_range = FALSE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"Using function can retrieve genome coordinates given UniProt protein providing Genome location position range. can either supply 'g_position' alone supply 'g_start' 'g_end' together.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"","code":"rba_uniprot_coordinates_location_genome( taxid, chromosome, g_position = NULL, g_start = NULL, g_end = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. chromosome (Character Numeric): Chromosome name, e.g. 1, 20, X. g_position (numeric) Genome location position g_start (numeric) Genome location position start g_end (numeric) Genome location position end ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"Genome coordinates supplied proteins.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"information UniProt imports calculates genomic coordinates data, see: McGarvey, P. B., Nightingale, ., Luo, J., Huang, H., Martin, M. J., Wu, C., & UniProt Consortium (2019). UniProt genomic mapping deciphering functional effects missense variants. Human mutation, 40(6), 694–705. https://doi.org/10.1002/humu.23738","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"\"GET https://ebi.ac.uk/proteins/api/coordinates/glocation /{accession}:{pPosition}\" \"GET https://ebi.ac.uk/proteins/api/coordinates/glocation /{accession}:{pStart}-{pEnd}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"","code":"# \\donttest{ rba_uniprot_coordinates_location_genome( taxid = 9606, chromosome = 11, g_position = 36573305) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"Using function can retrieve genome coordinates given UniProt protein providing protein position position range. can either supply 'p_position' alone supply 'p_start' 'p_end' together.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"","code":"rba_uniprot_coordinates_location_protein( accession, p_position = NULL, p_start = NULL, p_end = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"accession UniProtKB primary secondary accession. p_position (numeric) Protein sequence position p_start (numeric) Protein sequence position start p_end (numeric) Protein sequence position end ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"Genome coordinates supplied proteins.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"information UniProt imports calculates genomic coordinates data, see: McGarvey, P. B., Nightingale, ., Luo, J., Huang, H., Martin, M. J., Wu, C., & UniProt Consortium (2019). UniProt genomic mapping deciphering functional effects missense variants. Human mutation, 40(6), 694–705. https://doi.org/10.1002/humu.23738","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"\"GET https://ebi.ac.uk/proteins/api/coordinates/location /{accession}:{pPosition}\" \"GET https://ebi.ac.uk/proteins/api/coordinates/location /{accession}:{pStart}-{pEnd}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"","code":"# \\donttest{ rba_uniprot_coordinates_location_protein(accession = \"P25942\", p_position = 1) # } # \\donttest{ rba_uniprot_coordinates_location_protein(accession = \"P25942\", p_start = 1, p_end = 277) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"Use function search genomic coordinates UniProt entries. may also refine search modifiers chromosome, taxon id etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"","code":"rba_uniprot_coordinates_search( accession = NULL, chromosome = NULL, ensembl_id = NULL, gene = NULL, protein = NULL, taxid = NULL, location = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. chromosome chromosome name, \"X\", \"Y\", 1, 20, etc. can supply 20 values. ensembl_id Ensembl Stable gene ID, transcript ID translation ID. can supply 20 IDs. gene UniProt gene name(s). can supply 20 gene names. protein UniProt protein name taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. location Genome location range \"58205437-58219305\" ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"List element corresponds one UniProt entity returned search query. element sub-list containing protein's coordinates information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. information UniProt imports calculates genomic coordinates data, see: McGarvey, P. B., Nightingale, ., Luo, J., Huang, H., Martin, M. J., Wu, C., & UniProt Consortium (2019). UniProt genomic mapping deciphering functional effects missense variants. Human mutation, 40(6), 694–705. https://doi.org/10.1002/humu.23738","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"\"GET https://ebi.ac.uk/proteins/api/coordinates\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"","code":"# \\donttest{ rba_uniprot_coordinates_search(taxid = 9606, chromosome = \"y\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope.html","id":null,"dir":"Reference","previous_headings":"","what":"Retrieve Epitopes by Accession — rba_uniprot_epitope","title":"Retrieve Epitopes by Accession — rba_uniprot_epitope","text":"Use function retrieve epitope annotations linked UniProt entry.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Retrieve Epitopes by Accession — rba_uniprot_epitope","text":"","code":"rba_uniprot_epitope(accession, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Retrieve Epitopes by Accession — rba_uniprot_epitope","text":"accession UniProtKB primary secondary accession. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Retrieve Epitopes by Accession — rba_uniprot_epitope","text":"list containing UniProt epitope features details given accession.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Retrieve Epitopes by Accession — rba_uniprot_epitope","text":"\"GET https://www.ebi.ac.uk/proteins/api/epitope/accession\"","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Retrieve Epitopes by Accession — rba_uniprot_epitope","text":"","code":"# \\donttest{ rba_uniprot_epitope(accession = \"P36222\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniProt Epitopes — rba_uniprot_epitope_search","title":"Search UniProt Epitopes — rba_uniprot_epitope_search","text":"Use function search epitope data associated UniProt entities, using various criteria UniProt accession, epitope sequence, IEDB ID, match score.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniProt Epitopes — rba_uniprot_epitope_search","text":"","code":"rba_uniprot_epitope_search( accession = NULL, epitope_sequence = NULL, iedb_id = NULL, match_score = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniProt Epitopes — rba_uniprot_epitope_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. epitope_sequence (Character) Epitope's proteins sequence iedb_id (Numeric) EIDB epitope Identifier(s). can supply 20 accession numbers. match_score Integer: Minimum alignment score antigen sequence target protein sequence. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniProt Epitopes — rba_uniprot_epitope_search","text":"List element corresponds one UniProt entity returned search query. element sub-list containing information UniProt entity.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniProt Epitopes — rba_uniprot_epitope_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/epitope\"","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniProt Epitopes — rba_uniprot_epitope_search","text":"","code":"# \\donttest{ rba_uniprot_epitope_search(accession = c(\"Q84ZX5\", \"P36222\")) # } # \\donttest{ rba_uniprot_epitope_search(epitope_sequence = \"DKKCIEWEKAQHGA\") # } # \\donttest{ rba_uniprot_epitope_search(iedb_id = 20354) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniProt protein sequence features by accession — rba_uniprot_features","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"Use function retrieve sequence annotations (features) protein UniProt accession.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"","code":"rba_uniprot_features( accession, types = NULL, categories = NULL, location = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"accession UniProtKB primary secondary accession. types Sequence annotation (Features) types. accepted values : \"INIT_MET\", \"SIGNAL\", \"PROPEP\", \"TRANSIT\", \"CHAIN\", \"PEPTIDE\", \"TOPO_DOM\", \"TRANSMEM\", \"DOMAIN\", \"REPEAT\", \"CA_BIND\", \"ZN_FING\", \"DNA_BIND\", \"NP_BIND\", \"REGION\", \"COILED\", \"MOTIF\", \"COMPBIAS\", \"ACT_SITE\", \"METAL\", \"BINDING\", \"SITE\", \"NON_STD\", \"MOD_RES\", \"LIPID\", \"CARBOHYD\", \"DISULFID\", \"CROSSLNK\", \"VAR_SEQ\", \"VARIANT\", \"MUTAGEN\", \"UNSURE\", \"CONFLICT\", \"NON_CONS\", \"NON_TER\", \"HELIX\", \"TURN\", \"STRAND\" /\"INTRAMEM\". can supply 20 types. categories Sequence annotation (Features) categories (subsection). accepted values : \"MOLECULE_PROCESSING\", \"TOPOLOGY\", \"SEQUENCE_INFORMATION\", \"STRUCTURAL\", \"DOMAINS_AND_SITES\", \"PTM\", \"VARIANTS\" /\"MUTAGENESIS\". can supply 8 categories. location (character) Filter features amino acid position sequence(s). Provide range character string format \"begin-end\", e.g. \"35-70\" ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"list can find given protein's sequence annotations sub-list named \"features\".","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"\"GET https://www.ebi.ac.uk/proteins/api/features/{accession}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"","code":"# \\donttest{ rba_uniprot_features(\"Q99616\") # } # \\donttest{ rba_uniprot_features(accession = \"Q99616\", types = \"DISULFID\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniProt protein sequence features — rba_uniprot_features_search","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"UniProt maintains sequence annotations (features) describe regions protein sequence. Using function, can search retrieve UniProt proteins' sequence annotations (features). may also refine search query variety modifiers.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"","code":"rba_uniprot_features_search( accession = NULL, gene = NULL, exact_gene = NULL, protein = NULL, reviewed = NULL, organism = NULL, taxid = NULL, categories = NULL, types = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. gene UniProt gene name(s). can supply 20 gene names. e.g. supply \"CD40\", \"CD40 ligand\" also included. exact_gene UniProt exact gene name(s). can supply 20 exact gene names. e.g. supply \"CD40\", \"CD40 ligand\" included results. protein UniProt protein name reviewed Logical: TRUE, return \"UniProtKB/Swiss-Prot\" (reviewed) entries; FALSE, return TrEMBL (un-reviewed) entries. organism Organism name. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. categories Sequence annotation (Features) categories (subsection). accepted values : \"MOLECULE_PROCESSING\", \"TOPOLOGY\", \"SEQUENCE_INFORMATION\", \"STRUCTURAL\", \"DOMAINS_AND_SITES\", \"PTM\", \"VARIANTS\" /\"MUTAGENESIS\". can supply 8 categories. types Sequence annotation (Features) types. accepted values : \"INIT_MET\", \"SIGNAL\", \"PROPEP\", \"TRANSIT\", \"CHAIN\", \"PEPTIDE\", \"TOPO_DOM\", \"TRANSMEM\", \"DOMAIN\", \"REPEAT\", \"CA_BIND\", \"ZN_FING\", \"DNA_BIND\", \"NP_BIND\", \"REGION\", \"COILED\", \"MOTIF\", \"COMPBIAS\", \"ACT_SITE\", \"METAL\", \"BINDING\", \"SITE\", \"NON_STD\", \"MOD_RES\", \"LIPID\", \"CARBOHYD\", \"DISULFID\", \"CROSSLNK\", \"VAR_SEQ\", \"VARIANT\", \"MUTAGEN\", \"UNSURE\", \"CONFLICT\", \"NON_CONS\", \"NON_TER\", \"HELIX\", \"TURN\", \"STRAND\" /\"INTRAMEM\". can supply 20 types. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"List element corresponds one UniProt entity returned search query. element sub-list containing information UniProt entity.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. UniProt Entries grouped two sections: Reviewed(Swiss-Prot): Manually annotated records information extracted literature curator-evaluated computational analysis. Unreviewed (TrEMBL): Computationally analyzed records await full manual annotation.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/features\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"","code":"# \\donttest{ rba_uniprot_features_search(accession = \"Q99616\") # } # \\donttest{ rba_uniprot_features_search(gene = \"cd40\") # } # \\donttest{ rba_uniprot_features_search(gene = \"cd40 ligand\") # } # \\donttest{ rba_uniprot_features_search(gene = \"cd40\", reviewed = TRUE) # } # \\donttest{ rba_uniprot_features_search(accession = \"Q99616\", categories = c(\"MOLECULE_PROCESSING\", \"TOPOLOGY\")) # } # \\donttest{ rba_uniprot_features_search(accession = \"Q99616\", types = \"DISULFID\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"Using function can retrieve gene-centrics data. information, see proteomes? Automatic gene-centric isoform mapping eukaryotic reference proteome entries..","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"","code":"rba_uniprot_genecentric(accession, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"accession UniProtKB primary secondary accession. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"list containing information Gene-Centric proteins.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"\"GET https://ebi.ac.uk/proteins/api/genecentric/{accession}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"","code":"# \\donttest{ rba_uniprot_genecentric(\"P29965\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"Using function can search UniProt available gene-centrics proteomes. information, see proteomes? Automatic gene-centric isoform mapping eukaryotic reference proteome entries. may also refine search modifiers upid, accession gene. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"","code":"rba_uniprot_genecentric_search(upid = NULL, accession = NULL, gene = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. gene unique gene identifier(s) found MOD, Ensembl, Ensembl Genomes, OLN, ORF UniProt Gene Name. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"list containing gene-centric proteins search hits.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"\"GET https://ebi.ac.uk/proteins/api/genecentric\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"","code":"# \\donttest{ rba_uniprot_genecentric_search(accession = \"P59594\") # } # \\donttest{ rba_uniprot_genecentric_search(gene = \"Spike\") # } # \\donttest{ rba_uniprot_genecentric_search(upid = \"UP000000354\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"UniProt describes effects mutations proteins' amino acid sequence biological properties protein, cell organism. Using function, can get Mutagenesis description mapped given UniProt protein.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"","code":"rba_uniprot_mutagenesis(accession, location = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"accession UniProtKB primary secondary accession(s). location valid amino acid range (e.g. 10-25) within sequence range given proein. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"list containing mutagenesis description supplied UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"\"GET https://www.ebi.ac.uk/proteins/api/mutagenesis/{accession}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"","code":"# \\donttest{ rba_uniprot_mutagenesis(accession = \"P0DTC2\", location = \"300-400\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"UniProt describes effects mutations proteins' amino acid sequence biological properties protein, cell organism. Using function, can search mutagenesis description UniProt proteins. may also refine search. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"","code":"rba_uniprot_mutagenesis_search( accession = NULL, taxid = NULL, db_id = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. db_id ID Cross-reference (external) database. can supply 20 values. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"list element correspond UniProt protein (search hit) mutagenesis description organized \"features\" sub-list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/mutagenesis\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"","code":"# \\donttest{ #search all mutations in COVID19 proteins rba_uniprot_mutagenesis_search(taxid = 2697049) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniProt entry by accession — rba_uniprot_proteins","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"Use function retrieve UniProt Entry UniProt accession. can also use \"isoform\" \"interaction\" arguments retrieve isoforms interactor proteins entry. Note one function call can set none one \"isoform\" \"interaction\" TRUE, .","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"","code":"rba_uniprot_proteins(accession, interaction = FALSE, isoforms = FALSE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"accession UniProtKB primary secondary accession. interaction Logical: (default = FALSE) retrieve interaction information supplied UniProt entity? isoforms Logical: (default = FALSE) retrieve isoforms supplied UniProt entity? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"list contains UniProt protein informations supplied accession.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"\"GET https://ebi.ac.uk/proteins/api/proteins/{accession}\" \"GET https://ebi.ac.uk/proteins/api/proteins/interaction/{accession}\" \"GET https://ebi.ac.uk/proteins/api/proteins/{accession}/isoforms\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"","code":"# \\donttest{ rba_uniprot_proteins(accession = \"P01730\") # } # \\donttest{ rba_uniprot_proteins(accession = \"P01730\", interaction = TRUE) # } # \\donttest{ rba_uniprot_proteins(accession = \"Q29983\", isoforms = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"UniProt Cross-Reference links protein Entities cross-reference (external) databases. Using function, can retrieve UniProt entity using external database name protein ID database.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"","code":"rba_uniprot_proteins_crossref( db_id, db_name, reviewed = NULL, isoform = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"db_id protein ID cross-reference (external) database. db_name cross-reference (external database) name. reviewed Logical: (Optional) TRUE, returns \"UniProtKB/Swiss-Prot\" (reviewed) entries; FALSE, returns TrEMBL (un-reviewed) entries. isoform Numeric: (Optional) two options: 0: Exclude isoforms. 1: Return isoforms . see: Alternative products ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"List element UniProt entity correspond supplied cross-reference database name ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteins/{dbtype}:{dbid}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"","code":"# \\donttest{ rba_uniprot_proteins_crossref(\"cd40\", \"hgnc\") # } # \\donttest{ rba_uniprot_proteins_crossref(\"cd40\", \"hgnc\", reviewed = TRUE) # } # \\donttest{ rba_uniprot_proteins_crossref(\"mica\", \"hgnc\", isoform = 0) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniProt entries — rba_uniprot_proteins_search","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"Using function, can search retrieve UniProt Knowledge-base (UniProtKB) protein entries using variety options. may also refine search modifiers sequence length, review status etc. See \"Arguments\" section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"","code":"rba_uniprot_proteins_search( accession = NULL, reviewed = NULL, isoform = NULL, go_term = NULL, keyword = NULL, ec = NULL, gene = NULL, exact_gene = NULL, protein = NULL, organism = NULL, taxid = NULL, pubmed = NULL, seq_length = NULL, md5 = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. reviewed Logical: TRUE, return \"UniProtKB/Swiss-Prot\" (reviewed) entries; FALSE, return TrEMBL (un-reviewed) entries. isoform Numeric: three options: 0: Exclude isoforms. 1: Return isoforms . 2: Return . see: Alternative products go_term Limit search entries associated supplied GO (Gene Ontology) term. can supply Either GO ID character string -partially fully- matching term. e.g. \"GO:0001776\" \"leukocyte homeostasis\". supply \"leukocyte\", term containing word included, e.g \"leukocyte chemotaxis\", \"leukocyte activation\". keyword Limit search entries contain supplied keyword. see: UniProt Keywords ec EC (Enzyme Commission) number(s). can supply 20 EC numbers. gene UniProt gene name(s). can supply 20 gene names. e.g. supply \"CD40\", \"CD40 ligand\" also included. exact_gene UniProt exact gene name(s). can supply 20 exact gene names. e.g. supply \"CD40\", \"CD40 ligand\" included results. protein UniProt protein name organism Organism name. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. pubmed Entries cite article supplied PubMed ID. seq_length exact sequence length (e.g. 150) range sequence lengths (e.g. \"130-158\"). md5 Sequence md5 value. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"List element corresponds one UniProt entity returned search query. element sub-list containing information UniProt entity.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.s UniProt Entries grouped two sections: Reviewed(Swiss-Prot): Manually annotated records information extracted literature curator-evaluated computational analysis. Unreviewed (TrEMBL): Computationally analyzed records await full manual annotation.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteins\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"","code":"# \\donttest{ rba_uniprot_proteins_search(accession = \"Q99616\") # } # \\donttest{ rba_uniprot_proteins_search(gene = \"cd40\") # } # \\donttest{ rba_uniprot_proteins_search(gene = \"cd40 ligand\") # } # \\donttest{ rba_uniprot_proteins_search(gene = \"cd40\", reviewed = TRUE) # } # \\donttest{ rba_uniprot_proteins_search(gene = \"cd40\", reviewed = TRUE, isoform = 1) # } # \\donttest{ rba_uniprot_proteins_search(keyword = \"Inhibition of host chemokines by virus\") # } # \\donttest{ rba_uniprot_proteins_search(keyword = \"chemokines\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":null,"dir":"Reference","previous_headings":"","what":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"UniProt collects annotates proteomes(Protein sets expressed organism). Using function can search UniProt available proteomes. see proteomes? information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"","code":"rba_uniprot_proteomes(upid, get_proteins = FALSE, reviewed = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. get_proteins logical: set FALSE (default) return information proteome supplied UPID, set TRUE also return proteins supplied proteome UPID. reviewed Logical: considered get_proteins TRUE. TRUE, return \"UniProtKB/Swiss-Prot\" (reviewed) proteins; FALSE, return TrEMBL (un-reviewed) entries. leave NULL want filter proteins based review status. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"list containing information proteome supplied UPID can contain proteomes protein entries based value get_proteins argument.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"\"GET https://ebi.ac.uk/proteins/api/proteomes/proteins/{upid}\" \"GET https://ebi.ac.uk/proteins/api/proteomes/{upid}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"","code":"# \\donttest{ rba_uniprot_proteomes(upid = \"UP000000354\") # } # \\donttest{ rba_uniprot_proteomes(upid = \"UP000000354\", get_proteins = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"UniProt collects annotates proteomes (Protein sets expressed organism). Using function can search UniProt available proteomes. see proteomes? information. may also refine search modifiers keyword, taxon id etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"","code":"rba_uniprot_proteomes_search( name = NULL, upid = NULL, taxid = NULL, keyword = NULL, xref = NULL, genome_acc = NULL, is_ref_proteome = NULL, is_redundant = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"name keyword proteome's name upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. keyword Limit search entries contain supplied keyword. see: UniProt Keywords xref Proteome cross-references Genome assembly ID Biosample ID. can supply 20 cross-reference IDs. genome_acc Genome accession associated proteome's components. is_ref_proteome (logical) TRUE, return reference proteomes; FALSE, returns non-reference proteomes; NULL (default), results filtered criteria see 'reference proteomes?' information. is_redundant (logical) TRUE, return redundant proteomes; FALSE, returns non-redundant proteomes; NULL (default), results filtered redundancy. see 'Reducing proteome redundancy' information. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"list element list corresponds single proteome (search hit) contains informations pertinent proteome.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"\"GET https://ebi.ac.uk/proteins/api/proteomes\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"","code":"# \\donttest{ rba_uniprot_proteomes_search(name = \"SARS-CoV\") # } # \\donttest{ rba_uniprot_proteomes_search(name = \"SARS-CoV\", is_ref_proteome = TRUE) # } # \\donttest{ rba_uniprot_proteomes_search(name = \"SARS-CoV\", is_ref_proteome = TRUE) # } # \\donttest{ rba_uniprot_proteomes_search(genome_acc = \"AY274119\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":null,"dir":"Reference","previous_headings":"","what":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"UniProt maps post-translational modification proteomics data different sources proteins' sequences. Using function, can retrieve HPP (Human Proteome Project) proteomics features map given UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"","code":"rba_uniprot_proteomics_hpp(accession, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"accession UniProtKB primary secondary accession. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"list containing proteomics data features supplied UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteomics/nonPtm/accession\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"","code":"# \\donttest{ rba_uniprot_proteomics_hpp(accession = \"P04234\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"Using function, can search HPP (Human Proteome Project) proteomics features map UniProt proteins. may also refine search modifiers data_source, peptide etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"","code":"rba_uniprot_proteomics_hpp_search( accession = NULL, taxid = NULL, data_source = NULL, upid = NULL, peptide = NULL, unique = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. data_source Proteomics data source. addition manual curation, UniProt also import PTM annotations following databases: \"HPP\" Please use `rba_uniprot_proteomics_species()` information available data sources given species. upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. peptide Peptide sequence(s). can supply 20 sequences. unique Logical: results filtered based Peptide's uniqueness (fact peptide maps 1 protein). TRUE, unique peptides returned, FALSE un-unique peptides returned; NULL (default) results filtered based . ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"list element correspond UniProt protein proteomics data organized \"features\" sub-list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteomics/ptm\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"","code":"# \\donttest{ rba_uniprot_proteomics_hpp_search(peptide = \"NDQVYQPLRDRDDAQYSHLGGNWAR\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"UniProt maps proteomics data different sources proteins' sequences. Using function, can retrieve non-post-translational modification proteomics features map given UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"","code":"rba_uniprot_proteomics_non_ptm(accession, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"accession UniProtKB primary secondary accession. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"list containing proteomics data features supplied UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteomics/nonPtm/accession\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"","code":"# \\donttest{ rba_uniprot_proteomics_non_ptm(accession = \"P04234\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"Using function, can search non-Post-Translational Modification proteomics features map UniProt proteins. may also refine search modifiers data_source, peptide etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"","code":"rba_uniprot_proteomics_non_ptm_search( accession = NULL, taxid = NULL, data_source = NULL, upid = NULL, peptide = NULL, unique = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. data_source Proteomics data source. addition manual curation, UniProt also import PTM annotations following databases: \"MaxQB\" \"PeptideAtlas\" \"EPD\" \"ProteomicsDB\" Please use `rba_uniprot_proteomics_species()` information available data sources given species. upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. peptide Peptide sequence(s). can supply 20 sequences. unique Logical: results filtered based Peptide's uniqueness (fact peptide maps 1 protein). TRUE, unique peptides returned, FALSE un-unique peptides returned; NULL (default) results filtered based . ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"list element correspond UniProt protein proteomics data organized \"features\" sub-list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteomics/nonPtm\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"","code":"# \\donttest{ rba_uniprot_proteomics_non_ptm_search(peptide = \"NDQVYQPLRDRDDAQYSHLGGNWAR\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"UniProt maps post-translational modification proteomics data different sources proteins' sequences. Using function, can retrieve post-translational modification features map given UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"","code":"rba_uniprot_proteomics_ptm(accession, confidence_score = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"accession UniProtKB primary secondary accession. confidence_score (Character) Valid values: \"Bronze\", \"Silver\", \"gold\". UniProt classifies modified residues three categories based false localization rate (FLR) across multiple dataset. See Large scale modified residue information. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"list containing post-translational modification features supplied UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"see also: PTM / Processing section UniProtKB UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteomics/ptm/accession\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"","code":"# \\donttest{ rba_uniprot_proteomics_ptm(accession = \"P04234\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"Using function, can search Post-Translational Modification proteomics features map UniProt proteins. may also refine search modifiers data_source, peptide etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"","code":"rba_uniprot_proteomics_ptm_search( accession = NULL, ptm = NULL, taxid = NULL, data_source = NULL, upid = NULL, peptide = NULL, unique = NULL, confidence_score = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. ptm Post-translational modification name. Valid values : \"Acetylation \", \"ADP-ribosylation \", \"Amidation \", \"Autocatalytic cleavage \", \"Bromination \", \"Citrullination \", \"Cleavage pair basic residues \", \"Covalent protein-DNA linkage \", \"Covalent protein-RNA linkage \", \"CTQ \", \"D-amino acid \", \"Disulfide bond \", \"Formylation \", \"Gamma-carboxyglutamic acid \", \"Glutathionylation \", \"Glycoprotein \", \"Lipoprotein \", \"Hydroxylation \", \"Hypusine \", \"Iodination \", \"Isopeptide bond \", \"LTQ \", \"Methylation \", \"Nitration \", \"Organic radical \", \"Oxidation \", \"Peptidoglycan-anchor \", \"Phosphopantetheine \", \"Phosphoprotein \", \"Pyrrolidone carboxylic acid \", \"Quinone \", \"S-nitrosylation \", \"Sulfation \", \"Thioester bond \", \"Thioether bond \", \"TPQ \", \"TTQ \", \"Ubl conjugation \", \"Zymogen\". taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. data_source Proteomics data source. addition manual curation, UniProt also import PTM annotations following databases: \"PRIDE\" \"PTMeXchange\" Please use `rba_uniprot_proteomics_species()` information available data sources given species. upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. peptide Peptide sequence(s). can supply 20 sequences. unique Logical: results filtered based Peptide's uniqueness (fact peptide maps 1 protein). TRUE, unique peptides returned, FALSE un-unique peptides returned; NULL (default) results filtered based . confidence_score (Character) Valid values: \"Bronze\", \"Silver\", \"gold\". UniProt classifies modified residues three categories based false localization rate (FLR) across multiple dataset. See Large scale modified residue information. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"list element correspond UniProt protein post-translational modification organized \"features\" sub-list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. see also: PTM / Processing section UniProtKB UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"\"GET https://www.ebi.ac.uk/proteins/api//proteomics/ptm\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"","code":"# \\donttest{ rba_uniprot_proteomics_ptm_search(peptide = \"NDQVYQPLRDRDDAQYSHLGGNWAR\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"Retrieve information available Species proteomics data sources UniProt.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"","code":"rba_uniprot_proteomics_species(...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"data frame available species rows, columns indicating proteomics data sources, separated three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project)","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteomics/species\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"","code":"# \\donttest{ rba_uniprot_proteomics_species() # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit.html","id":null,"dir":"Reference","previous_headings":"","what":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","title":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","text":"Use function retrieve RNA-editing events (conversion, insertion, deletion nucleotides) annotations linked UniProt entry.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","text":"","code":"rba_uniprot_rna_edit(accession, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","text":"accession UniProtKB primary secondary accession. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","text":"list containing UniProt RNA-editing features details given accession.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","text":"\"GET https://www.ebi.ac.uk/proteins/api/rna-edit/accession\"","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","text":"","code":"# \\donttest{ rba_uniprot_rna_edit(accession = \"Q16851\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","title":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","text":"UniProt Curates RNA-editing events (conversion, insertion, deletion nucleotides). Use function search RNA editing records UniProt using various criteria accession, taxon ID, variant location.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","text":"","code":"rba_uniprot_rna_edit_search( accession = NULL, taxid = NULL, variantlocation = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. taxid (Numeric) NIH-NCBI Taxon ID. can supply 20 taxon IDs. variantlocation Character: RNA editing variant location(s). can supply 20 taxon IDs. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","text":"List element corresponds one UniProt entity returned search query. element sub-list containing information UniProt entity.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/rna-editing\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","text":"","code":"# \\donttest{ rba_uniprot_rna_edit_search(accession = c(\"Q16851\", \"Q16849\")) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"Using function, can retrieve taxonomic nodes information providing NCBI taxonomic identifiers. also, can explicitly retrieve nodes relation supplied node's hierarchy UniProt Taxonomy database.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"","code":"rba_uniprot_taxonomy( ids, hierarchy = NULL, node_only = TRUE, page_size = 200, page_number = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"ids (numeric) single numeric vector NCBI taxonomic identifier(s) hierarchy Retrieve taxonomic nodes specific hierarchical relation supplied taxonomic node. one : \"children\", \"parent\" \"siblings\". node_only Retrieve node(s) information exclude URL links parents, siblings children nodes. page_size (numeric) hierarchy supplied. hierarchy information may long, thus UniProt API paginate results, may use argument control pagination. maximum value 200. page_number (numeric) hierarchy supplied. hierarchy information may long, thus UniProt API paginate results, may use argument control pagination. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"list containing supplied nodes related nodes taxonomic information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"\"GET https://ebi.ac.uk/proteins/api/ids/{ids}\" \"GET https://ebi.ac.uk/proteins/api/ids/id/{id}/node\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/node\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/children\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/children/node\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/parent\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/parent/node\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/siblings\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/siblings/node\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"","code":"# \\donttest{ rba_uniprot_taxonomy(ids = c(9606, 10090)) # } # \\donttest{ rba_uniprot_taxonomy(ids = 9989, hierarchy = \"children\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"Use function retrieve lowest common ancestor (LCA) two taxonomy nodes UniProt Taxonomy database","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"","code":"rba_uniprot_taxonomy_lca(ids, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"ids (numeric) Numeric vector NCBI taxonomic identifiers, minimum length two. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"list UniProt taxonomy information supplied taxonomy elements.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"\"GET https://ebi.ac.uk/proteins/api/ancestor/{ids}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"","code":"# \\donttest{ rba_uniprot_taxonomy_lca(c(9606,10090,9823,7712)) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"Use function retrieve taxonomic lineage supplied taxonomy node.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"","code":"rba_uniprot_taxonomy_lineage(id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"id (numeric) NCBI taxonomic identifier ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"list data frame containing nodes preceded supplied node taxonomic tree. node first row root node last row.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"\"GET https://ebi.ac.uk/proteins/api/lineage/{id}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"","code":"# \\donttest{ rba_uniprot_taxonomy_lineage(id = 9989) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"Using function, can search retrieve taxonomic nodes using names UniProt Taxonomy database.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"","code":"rba_uniprot_taxonomy_name( name, field = \"scientific\", search_type = \"equal_to\", node_only = TRUE, page_size = 200, page_number = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"name name used search query. field Specify field supplied name searched. one : \"scientific\" (default), \"common\" \"mnemonic\". search_type logical relationship supplied search query taxonomic name field. one \"equal_to\" (default), \"start_with\", \"end_with\" \"contain\". node_only (logical) Retrieve node(s) information exclude URL links parents, siblings children nodes. default = TRUE page_size (numeric) search results may long, thus UniProt API paginate results, may use argument control pagination. maximum value 200. page_number (numeric) search results may long, thus UniProt API paginate results, may use argument control pagination. maximum value 200. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"list containing taxonomic nodes match supplied inputs.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"\"GET https://ebi.ac.uk/proteins/api/name/{name}\" \"GET https://ebi.ac.uk/proteins/api/name/{name}/node\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"","code":"# \\donttest{ rba_uniprot_taxonomy_name(name = \"homo\", field = \"scientific\", search_type = \"start_with\") # } # \\donttest{ rba_uniprot_taxonomy_name(name = \"adenovirus\", field = \"scientific\", search_type = \"contain\", page_size = 200, page_number = 2) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":null,"dir":"Reference","previous_headings":"","what":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"Using function can retrieve nodes located top bottom supplied node UniProt Taxonomy database tree","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"","code":"rba_uniprot_taxonomy_path(id, direction, depth = 5, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"id (numeric) NCBI taxonomic identifier direction direction taxonomic path, either \"TOP\" \"BOTTOM\". depth (numeric) many levels traversed taxonomic tree? (1 5, default = 5) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"nested list containing node path specified supplied argument UniProt taxonomic tree.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"\"GET https://ebi.ac.uk/proteins/api/path\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"","code":"# \\donttest{ rba_uniprot_taxonomy_path(id = 9606, direction = \"TOP\", depth = 3) # } # \\donttest{ rba_uniprot_taxonomy_path(id = 207598, direction = \"BOTTOM\", depth = 3) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"Use function retrieve shortest path two nodes taxonomy tree UniProt Taxonomy database.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"","code":"rba_uniprot_taxonomy_relationship(from, to, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"NCBI taxonomic identifier initial node. NCBI taxonomic identifier final node. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"nested list containing node shortest path supplied nodes.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"\"GET https://ebi.ac.uk/proteins/api/relationship\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"","code":"# \\donttest{ rba_uniprot_taxonomy_relationship(from = 9606, to = 10090) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniParc entry — rba_uniprot_uniparc","title":"Get UniParc entry — rba_uniprot_uniparc","text":"Use function retrieve UniParc entries. can use either - one - UniProt accession, Cross-reference database id, UniParc ID UniProt Proteome UPID. can also filter returned content returned UniParc entry. see \"Argument\" section details.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniParc entry — rba_uniprot_uniparc","text":"","code":"rba_uniprot_uniparc( upi = NULL, accession = NULL, db_id = NULL, upid = NULL, rf_dd_type = NULL, rf_db_id = NULL, rf_active = NULL, rf_tax_id = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniParc entry — rba_uniprot_uniparc","text":"upi unique UniParc Identifier. accession UniProtKB primary secondary accession. db_id Protein ID cross-reference (external) database. upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. rf_dd_type Filter content UniParc entry cross-reference names. can supply multiple values. rf_db_id Filter content UniParc entry protein identifiers cross-reference database. can supply multiple values. rf_active (logical ) Filter content UniParc entry based active status source database: NULL: (default) filter contents based active status. TRUE: return contents still active. FALSE: return contents active. rf_tax_id (Numeric) Filter content UniParc entry NIH-NCBI Taxon ID. can supply multiple values. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniParc entry — rba_uniprot_uniparc","text":"list correspond UniParc entry.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniParc entry — rba_uniprot_uniparc","text":"\"GET https://ebi.ac.uk/proteins/api/uniparc/accession/{accession} \" \"GET https://ebi.ac.uk/proteins/api/uniparc/dbreference/{dbid}\" \"GET https://ebi.ac.uk/proteins/api/uniparc/proteome/{upid}\" \"GET https://ebi.ac.uk/proteins/api/uniparc/upi/{upi}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniParc entry — rba_uniprot_uniparc","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniParc entry — rba_uniprot_uniparc","text":"","code":"# \\donttest{ rba_uniprot_uniparc(upi = \"UPI00000000C9\") # } # \\donttest{ rba_uniprot_uniparc(upi = \"UPI00000000C9\") # } # \\donttest{ rba_uniprot_uniparc(upi = \"UPI00000000C9\", rf_active = FALSE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"function returns UniParc Entry cross-reference longest active UniProtKB sequence (preferably Swiss-Prot TrEMBL). finds one longest active UniProtKB sequence returns 400 (Bad Request) error response list cross references found.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"","code":"rba_uniprot_uniparc_bestguess( upi = NULL, accession = NULL, db_id = NULL, gene = NULL, taxid = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"upi unique UniParc Identifier. accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. db_id Protein ID cross-reference (external) database. can supply 100 IDs. gene UniProt gene name(s). can supply 20 gene names. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"list element correspond UniParc entry.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"\"GET https://ebi.ac.uk/proteins/api/uniparc/bestguess\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"","code":"# \\donttest{ rba_uniprot_uniparc_bestguess(\"UPI00000000C9\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniParc Entries — rba_uniprot_uniparc_search","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"Use function search UniProt Archive (UniParc) entries.may also refine search modifiers sequence length, taxon id etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"","code":"rba_uniprot_uniparc_search( upi = NULL, accession = NULL, db_type = NULL, db_id = NULL, gene = NULL, protein = NULL, taxid = NULL, organism = NULL, sequence_checksum = NULL, ipr = NULL, signature_db = NULL, signature_id = NULL, upid = NULL, seq_length = NULL, rf_dd_type = NULL, rf_db_id = NULL, rf_active = NULL, rf_tax_id = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"upi unique UniParc Identifier(s). can supply 100 IDs. accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. db_type cross-reference (external database) name. db_id Protein ID cross-reference (external) database. can supply 100 IDs. gene UniProt gene name(s). can supply 20 gene names. protein UniProt protein name. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. organism Organism name. sequence_checksum Sequence CRC64 checksum. ipr InterPro identifier(s). can supply 20 IDs. signature_db InterPro's signature database. can supply 13 following values: \"CATH\", \"CDD\", \"HAMAP\", \"MobiDB Lite\", \"Panther\", \"Pfam\", \"PIRSF\", \"PRINTS\", \"Prosite\", \"SFLD\", \"SMART\", \"SUPERFAMILY\" /\"TIGRfams\" signature_id Signature ID InterPro's signature database. can supply 20 IDs. upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. seq_length exact sequence length (e.g. 150) range sequence lengths (e.g. \"130-158\"). rf_dd_type Filter content UniParc entry cross-reference names. can supply multiple values. rf_db_id Filter content UniParc entry protein identifiers cross-reference database. can supply multiple values. rf_active (logical ) Filter content UniParc entry based active status source database: NULL: (default) filter contents based active status. TRUE: return contents still active. FALSE: return contents active. rf_tax_id (Numeric) Filter content UniParc entry NIH-NCBI Taxon ID. can supply multiple values. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"List element corresponds one UniParc entry returned search query. element sub-list containing sequence information reference entries.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"\"GET https://ebi.ac.uk/proteins/api/uniparc\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"","code":"# \\donttest{ rba_uniprot_uniparc_search(upi = \"UPI00000000C9\") # } # \\donttest{ rba_uniprot_uniparc_search(accession = \"P30914\") # } # \\donttest{ rba_uniprot_uniparc_search(accession = \"P30914\", rf_active = TRUE) # } # \\donttest{ rba_uniprot_uniparc_search(taxid = \"694009\", protein = \"Nucleoprotein\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"Retrieve UniParc Entry providing exact sequence. Note partial matches accepted. can also filter returned content returned UniParc entry. see \"Argument\" section details.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"","code":"rba_uniprot_uniparc_sequence( sequence, rf_dd_type = NULL, rf_db_id = NULL, rf_active = NULL, rf_tax_id = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"sequence Exact UniParc protein sequence. Partial matches accepted. rf_dd_type Filter content UniParc entry cross-reference names. can supply multiple values. rf_db_id Filter content UniParc entry protein identifiers cross-reference database. can supply multiple values. rf_active (logical ) Filter content UniParc entry based active status source database: NULL: (default) filter contents based active status. TRUE: return contents still active. FALSE: return contents active. rf_tax_id (Numeric) Filter content UniParc entry NIH-NCBI Taxon ID. can supply multiple values. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"list correspond UniParc entry.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"\"POST https://ebi.ac.uk/proteins/api/uniparc/sequence\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"","code":"# \\donttest{ rba_uniprot_uniparc_sequence(\"GMRSCPRGCSQRGRCENGRCVCNPGYTGEDC\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":null,"dir":"Reference","previous_headings":"","what":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"Retrieve natural variant annotations sequence using UniProt protein accession, dbSNP HGVS expression.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"","code":"rba_uniprot_variation( id, id_type, source_type = NULL, consequence_type = NULL, wild_type = NULL, alternative_sequence = NULL, location = NULL, save_peff = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"id ID can either UniProt primary secondary accession, NIH-NCBI dbSNP ID HGVS expression. NIH-NCBI dbSNP id HGVS Expression. id_type type supplied ID argument, one : \"uniprot\", \"dbsnp\" \"hgvs\" source_type Variation's source type. can choose two : \"UniProt\", \"large scale study\" /\"mixed\". consequence_type Variation's consequence type. can choose two : \"missense\", \"stop gained\" \"stop lost\". wild_type Wild type amino acid. Accepted values IUPAC single-letter amino acid (e.g. D Aspartic acid) \"*\" stop codon. can supply 20 values. alternative_sequence Alternative amino acid. Accepted values IUPAC single-letter amino acid (e.g. D Aspartic acid) \"*\" stop codon \"-\" deletion. can supply 20 values. location valid amino acid range (e.g. 10-25) within sequence range variation occurs. can supply 20 values. save_peff Logical Character: FALSE: (default) save PEFF file, just return list object. TRUE: Save PEFF file automatically-generated path. Character string: valid file path save PEFF file. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"list element list corresponds UniProt protein entry.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"\"GET https://www.ebi.ac.uk/proteins/api/variation/dbsnp/{dbid}\" \"GET https://www.ebi.ac.uk/proteins/api/variation/hgvs/{hgvs}\" \"GET https://www.ebi.ac.uk/proteins/api/variation/{accession}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"","code":"# \\donttest{ rba_uniprot_variation(id = \"rs121434451\", id_type = \"dbsnp\") # } # \\donttest{ rba_uniprot_variation(id = \"NC_000008.11:g.22119227C>T\", id_type = \"hgvs\") # } # \\donttest{ rba_uniprot_variation(id = \"O43593\", id_type = \"uniprot\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniProt Natural Variants — rba_uniprot_variation_search","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"Using function, can search retrieve Natural variant(s) annotated protein's sequences. may also refine search modifiers source type, disease etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"","code":"rba_uniprot_variation_search( accession = NULL, source_type = NULL, consequence_type = NULL, wild_type = NULL, alternative_sequence = NULL, location = NULL, disease = NULL, omim = NULL, evidence = NULL, taxid = NULL, db_type = NULL, db_id = NULL, save_peff = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. source_type Variation's source type. can choose two : \"UniProt\", \"large scale study\" /\"mixed\". consequence_type Variation's consequence type. can choose two : \"missense\", \"stop gained\" \"stop lost\". wild_type Wild type amino acid. Accepted values IUPAC single-letter amino acid (e.g. D Aspartic acid) \"*\" stop codon. can supply 20 values. alternative_sequence Alternative amino acid. Accepted values IUPAC single-letter amino acid (e.g. D Aspartic acid) \"*\" stop codon \"-\" deletion. can supply 20 values. location valid amino acid range (e.g. 10-25) within sequence range variation occurs. can supply 20 values. disease Human disease associated sequence variation. Accepted values disease name (e.g. Alzheimer disease 18), partial disease name (Alzheimer) /disease acronym (e.g. AD). can supply 20 values. omim OMIM ID associated variation. can supply 20 values. evidence Pubmed ID variation's citation can supply 20 values. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. db_type cross-reference database variation. can supply two following: \"dbSNP\": NIH-NCBI dbSNP database. \"cosmic curate\": COSMIC (Catalogue Somatic Mutations Cancer) \"ClinVar\": NIH-NCBI ClinVar db_id variation ID Cross-reference (external) database. can supply 20 values. save_peff Logical Character: FALSE: (default) save PEFF file, just return list object. TRUE: Save PEFF file automatically-generated path. Character string: valid file path save PEFF file. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"List element corresponds one UniProt entity returned search query. element sub-list containing information UniProt Variation.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/variation\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"","code":"# \\donttest{ rba_uniprot_variation_search(accession = \"P05067\") # } # \\donttest{ rba_uniprot_variation_search(disease = \"alzheimer disease, 18\") # } # \\donttest{ rba_uniprot_variation_search(disease = \"alzheimer\", wild_type = \"A\", alternative_sequence = \"T\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rbioapi.html","id":null,"dir":"Reference","previous_headings":"","what":"rbioapi: User-Friendly R Interface to Biologic Web Services' API — rbioapi","title":"rbioapi: User-Friendly R Interface to Biologic Web Services' API — rbioapi","text":"Currently fully supports Enrichr, JASPAR, miEAA, PANTHER, Reactome, STRING, UniProt! goal rbioapi provide user-friendly consistent interface biological databases services. way insulates user technicalities using web services API creates unified easy--use interface biological medical web services. ongoing project; New databases services added periodically. Feel free suggest databases services often use.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rbioapi.html","id":"supported-database-services","dir":"Reference","previous_headings":"","what":"Supported Database/Services","title":"rbioapi: User-Friendly R Interface to Biologic Web Services' API — rbioapi","text":"Enrichr JASPAR MiEAA PANTHER Reactome STRING UniProt","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rbioapi.html","id":"author","dir":"Reference","previous_headings":"","what":"Author","title":"rbioapi: User-Friendly R Interface to Biologic Web Services' API — rbioapi","text":"Maintainer: Moosa Rezwani moosa.rezwani@gmail.com (ORCID)","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-081-current-cran-version","dir":"Changelog","previous_headings":"","what":"rbioapi 0.8.1 (Current CRAN version)","title":"rbioapi 0.8.1 (Current CRAN version)","text":"CRAN release: 2024-03-30 Move JASPAR 2024. Minor improvements fixes.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-080","dir":"Changelog","previous_headings":"","what":"rbioapi 0.8.0","title":"rbioapi 0.8.0","text":"CRAN release: 2023-09-30 Move STRING v12. Incorporate recent changes PANTHER MIEAA API. Minor improvements fixes.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-079","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.9","title":"rbioapi 0.7.9","text":"CRAN release: 2023-05-09 Stability improvements.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-078","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.8","title":"rbioapi 0.7.8","text":"CRAN release: 2023-05-02 Bug fixes minor improvements.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-077","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.7","title":"rbioapi 0.7.7","text":"CRAN release: 2022-08-08 Bug fixes minor improvements.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-076","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.6","title":"rbioapi 0.7.6","text":"CRAN release: 2022-04-05 Submitted paper Bioinformatics journal (DOI: 10.1093/bioinformatics/btac172). Added vignette article: “-Representation (Enrichment) Analysis”” Updated citations information. Moved JASPAR 2022. Added new API endpoints UniProt PANTHER. Minor internal improvements.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-075","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.5","title":"rbioapi 0.7.5","text":"Moved STRING database version 11.5","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-074","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.4","title":"rbioapi 0.7.4","text":"CRAN release: 2021-06-22 Bug fixes minor improvements.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-073","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.3","title":"rbioapi 0.7.3","text":"Improved internal functions.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-072","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.2","title":"rbioapi 0.7.2","text":"JASPAR supported.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-071","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.1","title":"rbioapi 0.7.1","text":"Enrichr supported.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-070","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.0","title":"rbioapi 0.7.0","text":"CRAN release: 2021-04-30 package submitted CRAN","code":""}]
+[{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":null,"dir":"","previous_headings":"","what":"GNU General Public License","title":"GNU General Public License","text":"Version 3, 29 June 2007Copyright © 2007 Free Software Foundation, Inc. Everyone permitted copy distribute verbatim copies license document, changing allowed.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"preamble","dir":"","previous_headings":"","what":"Preamble","title":"GNU General Public License","text":"GNU General Public License free, copyleft license software kinds works. licenses software practical works designed take away freedom share change works. contrast, GNU General Public License intended guarantee freedom share change versions program–make sure remains free software users. , Free Software Foundation, use GNU General Public License software; applies also work released way authors. can apply programs, . speak free software, referring freedom, price. General Public Licenses designed make sure freedom distribute copies free software (charge wish), receive source code can get want , can change software use pieces new free programs, know can things. protect rights, need prevent others denying rights asking surrender rights. Therefore, certain responsibilities distribute copies software, modify : responsibilities respect freedom others. example, distribute copies program, whether gratis fee, must pass recipients freedoms received. must make sure , , receive can get source code. must show terms know rights. Developers use GNU GPL protect rights two steps: (1) assert copyright software, (2) offer License giving legal permission copy, distribute /modify . developers’ authors’ protection, GPL clearly explains warranty free software. users’ authors’ sake, GPL requires modified versions marked changed, problems attributed erroneously authors previous versions. devices designed deny users access install run modified versions software inside , although manufacturer can . fundamentally incompatible aim protecting users’ freedom change software. systematic pattern abuse occurs area products individuals use, precisely unacceptable. Therefore, designed version GPL prohibit practice products. problems arise substantially domains, stand ready extend provision domains future versions GPL, needed protect freedom users. Finally, every program threatened constantly software patents. States allow patents restrict development use software general-purpose computers, , wish avoid special danger patents applied free program make effectively proprietary. prevent , GPL assures patents used render program non-free. precise terms conditions copying, distribution modification follow.","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_0-definitions","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"0. Definitions","title":"GNU General Public License","text":"“License” refers version 3 GNU General Public License. “Copyright” also means copyright-like laws apply kinds works, semiconductor masks. “Program” refers copyrightable work licensed License. licensee addressed “”. “Licensees” “recipients” may individuals organizations. “modify” work means copy adapt part work fashion requiring copyright permission, making exact copy. resulting work called “modified version” earlier work work “based ” earlier work. “covered work” means either unmodified Program work based Program. “propagate” work means anything , without permission, make directly secondarily liable infringement applicable copyright law, except executing computer modifying private copy. Propagation includes copying, distribution (without modification), making available public, countries activities well. “convey” work means kind propagation enables parties make receive copies. Mere interaction user computer network, transfer copy, conveying. interactive user interface displays “Appropriate Legal Notices” extent includes convenient prominently visible feature (1) displays appropriate copyright notice, (2) tells user warranty work (except extent warranties provided), licensees may convey work License, view copy License. interface presents list user commands options, menu, prominent item list meets criterion.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_1-source-code","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"1. Source Code","title":"GNU General Public License","text":"“source code” work means preferred form work making modifications . “Object code” means non-source form work. “Standard Interface” means interface either official standard defined recognized standards body, , case interfaces specified particular programming language, one widely used among developers working language. “System Libraries” executable work include anything, work whole, () included normal form packaging Major Component, part Major Component, (b) serves enable use work Major Component, implement Standard Interface implementation available public source code form. “Major Component”, context, means major essential component (kernel, window system, ) specific operating system () executable work runs, compiler used produce work, object code interpreter used run . “Corresponding Source” work object code form means source code needed generate, install, (executable work) run object code modify work, including scripts control activities. However, include work’s System Libraries, general-purpose tools generally available free programs used unmodified performing activities part work. example, Corresponding Source includes interface definition files associated source files work, source code shared libraries dynamically linked subprograms work specifically designed require, intimate data communication control flow subprograms parts work. Corresponding Source need include anything users can regenerate automatically parts Corresponding Source. Corresponding Source work source code form work.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_2-basic-permissions","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"2. Basic Permissions","title":"GNU General Public License","text":"rights granted License granted term copyright Program, irrevocable provided stated conditions met. License explicitly affirms unlimited permission run unmodified Program. output running covered work covered License output, given content, constitutes covered work. License acknowledges rights fair use equivalent, provided copyright law. may make, run propagate covered works convey, without conditions long license otherwise remains force. may convey covered works others sole purpose make modifications exclusively , provide facilities running works, provided comply terms License conveying material control copyright. thus making running covered works must exclusively behalf, direction control, terms prohibit making copies copyrighted material outside relationship . Conveying circumstances permitted solely conditions stated . Sublicensing allowed; section 10 makes unnecessary.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_3-protecting-users-legal-rights-from-anti-circumvention-law","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"3. Protecting Users’ Legal Rights From Anti-Circumvention Law","title":"GNU General Public License","text":"covered work shall deemed part effective technological measure applicable law fulfilling obligations article 11 WIPO copyright treaty adopted 20 December 1996, similar laws prohibiting restricting circumvention measures. convey covered work, waive legal power forbid circumvention technological measures extent circumvention effected exercising rights License respect covered work, disclaim intention limit operation modification work means enforcing, work’s users, third parties’ legal rights forbid circumvention technological measures.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_4-conveying-verbatim-copies","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"4. Conveying Verbatim Copies","title":"GNU General Public License","text":"may convey verbatim copies Program’s source code receive , medium, provided conspicuously appropriately publish copy appropriate copyright notice; keep intact notices stating License non-permissive terms added accord section 7 apply code; keep intact notices absence warranty; give recipients copy License along Program. may charge price price copy convey, may offer support warranty protection fee.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_5-conveying-modified-source-versions","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"5. Conveying Modified Source Versions","title":"GNU General Public License","text":"may convey work based Program, modifications produce Program, form source code terms section 4, provided also meet conditions: ) work must carry prominent notices stating modified , giving relevant date. b) work must carry prominent notices stating released License conditions added section 7. requirement modifies requirement section 4 “keep intact notices”. c) must license entire work, whole, License anyone comes possession copy. License therefore apply, along applicable section 7 additional terms, whole work, parts, regardless packaged. License gives permission license work way, invalidate permission separately received . d) work interactive user interfaces, must display Appropriate Legal Notices; however, Program interactive interfaces display Appropriate Legal Notices, work need make . compilation covered work separate independent works, nature extensions covered work, combined form larger program, volume storage distribution medium, called “aggregate” compilation resulting copyright used limit access legal rights compilation’s users beyond individual works permit. Inclusion covered work aggregate cause License apply parts aggregate.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_6-conveying-non-source-forms","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"6. Conveying Non-Source Forms","title":"GNU General Public License","text":"may convey covered work object code form terms sections 4 5, provided also convey machine-readable Corresponding Source terms License, one ways: ) Convey object code , embodied , physical product (including physical distribution medium), accompanied Corresponding Source fixed durable physical medium customarily used software interchange. b) Convey object code , embodied , physical product (including physical distribution medium), accompanied written offer, valid least three years valid long offer spare parts customer support product model, give anyone possesses object code either (1) copy Corresponding Source software product covered License, durable physical medium customarily used software interchange, price reasonable cost physically performing conveying source, (2) access copy Corresponding Source network server charge. c) Convey individual copies object code copy written offer provide Corresponding Source. alternative allowed occasionally noncommercially, received object code offer, accord subsection 6b. d) Convey object code offering access designated place (gratis charge), offer equivalent access Corresponding Source way place charge. need require recipients copy Corresponding Source along object code. place copy object code network server, Corresponding Source may different server (operated third party) supports equivalent copying facilities, provided maintain clear directions next object code saying find Corresponding Source. Regardless server hosts Corresponding Source, remain obligated ensure available long needed satisfy requirements. e) Convey object code using peer--peer transmission, provided inform peers object code Corresponding Source work offered general public charge subsection 6d. separable portion object code, whose source code excluded Corresponding Source System Library, need included conveying object code work. “User Product” either (1) “consumer product”, means tangible personal property normally used personal, family, household purposes, (2) anything designed sold incorporation dwelling. determining whether product consumer product, doubtful cases shall resolved favor coverage. particular product received particular user, “normally used” refers typical common use class product, regardless status particular user way particular user actually uses, expects expected use, product. product consumer product regardless whether product substantial commercial, industrial non-consumer uses, unless uses represent significant mode use product. “Installation Information” User Product means methods, procedures, authorization keys, information required install execute modified versions covered work User Product modified version Corresponding Source. information must suffice ensure continued functioning modified object code case prevented interfered solely modification made. convey object code work section , , specifically use , User Product, conveying occurs part transaction right possession use User Product transferred recipient perpetuity fixed term (regardless transaction characterized), Corresponding Source conveyed section must accompanied Installation Information. requirement apply neither third party retains ability install modified object code User Product (example, work installed ROM). requirement provide Installation Information include requirement continue provide support service, warranty, updates work modified installed recipient, User Product modified installed. Access network may denied modification materially adversely affects operation network violates rules protocols communication across network. Corresponding Source conveyed, Installation Information provided, accord section must format publicly documented (implementation available public source code form), must require special password key unpacking, reading copying.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_7-additional-terms","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"7. Additional Terms","title":"GNU General Public License","text":"“Additional permissions” terms supplement terms License making exceptions one conditions. Additional permissions applicable entire Program shall treated though included License, extent valid applicable law. additional permissions apply part Program, part may used separately permissions, entire Program remains governed License without regard additional permissions. convey copy covered work, may option remove additional permissions copy, part . (Additional permissions may written require removal certain cases modify work.) may place additional permissions material, added covered work, can give appropriate copyright permission. Notwithstanding provision License, material add covered work, may (authorized copyright holders material) supplement terms License terms: ) Disclaiming warranty limiting liability differently terms sections 15 16 License; b) Requiring preservation specified reasonable legal notices author attributions material Appropriate Legal Notices displayed works containing ; c) Prohibiting misrepresentation origin material, requiring modified versions material marked reasonable ways different original version; d) Limiting use publicity purposes names licensors authors material; e) Declining grant rights trademark law use trade names, trademarks, service marks; f) Requiring indemnification licensors authors material anyone conveys material (modified versions ) contractual assumptions liability recipient, liability contractual assumptions directly impose licensors authors. non-permissive additional terms considered “restrictions” within meaning section 10. Program received , part , contains notice stating governed License along term restriction, may remove term. license document contains restriction permits relicensing conveying License, may add covered work material governed terms license document, provided restriction survive relicensing conveying. add terms covered work accord section, must place, relevant source files, statement additional terms apply files, notice indicating find applicable terms. Additional terms, permissive non-permissive, may stated form separately written license, stated exceptions; requirements apply either way.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_8-termination","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"8. Termination","title":"GNU General Public License","text":"may propagate modify covered work except expressly provided License. attempt otherwise propagate modify void, automatically terminate rights License (including patent licenses granted third paragraph section 11). However, cease violation License, license particular copyright holder reinstated () provisionally, unless copyright holder explicitly finally terminates license, (b) permanently, copyright holder fails notify violation reasonable means prior 60 days cessation. Moreover, license particular copyright holder reinstated permanently copyright holder notifies violation reasonable means, first time received notice violation License (work) copyright holder, cure violation prior 30 days receipt notice. Termination rights section terminate licenses parties received copies rights License. rights terminated permanently reinstated, qualify receive new licenses material section 10.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_9-acceptance-not-required-for-having-copies","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"9. Acceptance Not Required for Having Copies","title":"GNU General Public License","text":"required accept License order receive run copy Program. Ancillary propagation covered work occurring solely consequence using peer--peer transmission receive copy likewise require acceptance. However, nothing License grants permission propagate modify covered work. actions infringe copyright accept License. Therefore, modifying propagating covered work, indicate acceptance License .","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_10-automatic-licensing-of-downstream-recipients","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"10. Automatic Licensing of Downstream Recipients","title":"GNU General Public License","text":"time convey covered work, recipient automatically receives license original licensors, run, modify propagate work, subject License. responsible enforcing compliance third parties License. “entity transaction” transaction transferring control organization, substantially assets one, subdividing organization, merging organizations. propagation covered work results entity transaction, party transaction receives copy work also receives whatever licenses work party’s predecessor interest give previous paragraph, plus right possession Corresponding Source work predecessor interest, predecessor can get reasonable efforts. may impose restrictions exercise rights granted affirmed License. example, may impose license fee, royalty, charge exercise rights granted License, may initiate litigation (including cross-claim counterclaim lawsuit) alleging patent claim infringed making, using, selling, offering sale, importing Program portion .","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_11-patents","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"11. Patents","title":"GNU General Public License","text":"“contributor” copyright holder authorizes use License Program work Program based. work thus licensed called contributor’s “contributor version”. contributor’s “essential patent claims” patent claims owned controlled contributor, whether already acquired hereafter acquired, infringed manner, permitted License, making, using, selling contributor version, include claims infringed consequence modification contributor version. purposes definition, “control” includes right grant patent sublicenses manner consistent requirements License. contributor grants non-exclusive, worldwide, royalty-free patent license contributor’s essential patent claims, make, use, sell, offer sale, import otherwise run, modify propagate contents contributor version. following three paragraphs, “patent license” express agreement commitment, however denominated, enforce patent (express permission practice patent covenant sue patent infringement). “grant” patent license party means make agreement commitment enforce patent party. convey covered work, knowingly relying patent license, Corresponding Source work available anyone copy, free charge terms License, publicly available network server readily accessible means, must either (1) cause Corresponding Source available, (2) arrange deprive benefit patent license particular work, (3) arrange, manner consistent requirements License, extend patent license downstream recipients. “Knowingly relying” means actual knowledge , patent license, conveying covered work country, recipient’s use covered work country, infringe one identifiable patents country reason believe valid. , pursuant connection single transaction arrangement, convey, propagate procuring conveyance , covered work, grant patent license parties receiving covered work authorizing use, propagate, modify convey specific copy covered work, patent license grant automatically extended recipients covered work works based . patent license “discriminatory” include within scope coverage, prohibits exercise , conditioned non-exercise one rights specifically granted License. may convey covered work party arrangement third party business distributing software, make payment third party based extent activity conveying work, third party grants, parties receive covered work , discriminatory patent license () connection copies covered work conveyed (copies made copies), (b) primarily connection specific products compilations contain covered work, unless entered arrangement, patent license granted, prior 28 March 2007. Nothing License shall construed excluding limiting implied license defenses infringement may otherwise available applicable patent law.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_12-no-surrender-of-others-freedom","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"12. No Surrender of Others’ Freedom","title":"GNU General Public License","text":"conditions imposed (whether court order, agreement otherwise) contradict conditions License, excuse conditions License. convey covered work satisfy simultaneously obligations License pertinent obligations, consequence may convey . example, agree terms obligate collect royalty conveying convey Program, way satisfy terms License refrain entirely conveying Program.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_13-use-with-the-gnu-affero-general-public-license","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"13. Use with the GNU Affero General Public License","title":"GNU General Public License","text":"Notwithstanding provision License, permission link combine covered work work licensed version 3 GNU Affero General Public License single combined work, convey resulting work. terms License continue apply part covered work, special requirements GNU Affero General Public License, section 13, concerning interaction network apply combination .","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_14-revised-versions-of-this-license","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"14. Revised Versions of this License","title":"GNU General Public License","text":"Free Software Foundation may publish revised /new versions GNU General Public License time time. new versions similar spirit present version, may differ detail address new problems concerns. version given distinguishing version number. Program specifies certain numbered version GNU General Public License “later version” applies , option following terms conditions either numbered version later version published Free Software Foundation. Program specify version number GNU General Public License, may choose version ever published Free Software Foundation. Program specifies proxy can decide future versions GNU General Public License can used, proxy’s public statement acceptance version permanently authorizes choose version Program. Later license versions may give additional different permissions. However, additional obligations imposed author copyright holder result choosing follow later version.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_15-disclaimer-of-warranty","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"15. Disclaimer of Warranty","title":"GNU General Public License","text":"WARRANTY PROGRAM, EXTENT PERMITTED APPLICABLE LAW. EXCEPT OTHERWISE STATED WRITING COPYRIGHT HOLDERS /PARTIES PROVIDE PROGRAM “” WITHOUT WARRANTY KIND, EITHER EXPRESSED IMPLIED, INCLUDING, LIMITED , IMPLIED WARRANTIES MERCHANTABILITY FITNESS PARTICULAR PURPOSE. ENTIRE RISK QUALITY PERFORMANCE PROGRAM . PROGRAM PROVE DEFECTIVE, ASSUME COST NECESSARY SERVICING, REPAIR CORRECTION.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_16-limitation-of-liability","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"16. Limitation of Liability","title":"GNU General Public License","text":"EVENT UNLESS REQUIRED APPLICABLE LAW AGREED WRITING COPYRIGHT HOLDER, PARTY MODIFIES /CONVEYS PROGRAM PERMITTED , LIABLE DAMAGES, INCLUDING GENERAL, SPECIAL, INCIDENTAL CONSEQUENTIAL DAMAGES ARISING USE INABILITY USE PROGRAM (INCLUDING LIMITED LOSS DATA DATA RENDERED INACCURATE LOSSES SUSTAINED THIRD PARTIES FAILURE PROGRAM OPERATE PROGRAMS), EVEN HOLDER PARTY ADVISED POSSIBILITY DAMAGES.","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"id_17-interpretation-of-sections-15-and-16","dir":"","previous_headings":"TERMS AND CONDITIONS","what":"17. Interpretation of Sections 15 and 16","title":"GNU General Public License","text":"disclaimer warranty limitation liability provided given local legal effect according terms, reviewing courts shall apply local law closely approximates absolute waiver civil liability connection Program, unless warranty assumption liability accompanies copy Program return fee. END TERMS CONDITIONS","code":""},{"path":"https://rbioapi.moosa-r.com/LICENSE.html","id":"how-to-apply-these-terms-to-your-new-programs","dir":"","previous_headings":"","what":"How to Apply These Terms to Your New Programs","title":"GNU General Public License","text":"develop new program, want greatest possible use public, best way achieve make free software everyone can redistribute change terms. , attach following notices program. safest attach start source file effectively state exclusion warranty; file least “copyright” line pointer full notice found. Also add information contact electronic paper mail. program terminal interaction, make output short notice like starts interactive mode: hypothetical commands show w show c show appropriate parts General Public License. course, program’s commands might different; GUI interface, use “box”. also get employer (work programmer) school, , sign “copyright disclaimer” program, necessary. information , apply follow GNU GPL, see . GNU General Public License permit incorporating program proprietary programs. program subroutine library, may consider useful permit linking proprietary applications library. want , use GNU Lesser General Public License instead License. first, please read .","code":" Copyright (C) 2020 Moosa Rezwani This program is free software: you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program. If not, see . rbioapi Copyright (C) 2020 Moosa Rezwani This program comes with ABSOLUTELY NO WARRANTY; for details type 'show w'. This is free software, and you are welcome to redistribute it under certain conditions; type 'show c' for details."},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"what-does-rbioapi-do","dir":"Articles","previous_headings":"","what":"What does rbioapi do?","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"Currently fully supports Enrichr, JASPAR, miEAA, PANTHER, Reactome, STRING, UniProt! goal rbioapi provide user-friendly consistent interface biological databases services: way insulates user technicalities using web services API creates unified easy--use interface biological medical web services. rbioapi, need technical knowledge web services API learn work new package every biologic service database. ongoing project; New databases services added periodically. Feel free suggest databases services often use.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"what-is-supported-by-rbioapi","dir":"Articles","previous_headings":"","what":"What is Supported by rbioapi?","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"rbioapi dedicated Biological Medical databases web services. Currently, rbioapi supports covers every API resources following services: (alphabetical order): CRAN (Stable) version: (https://cran.r-project.org/package=rbioapi) Enrichr (rbioapi vignette article) (new) JASPAR (rbioapi vignette article) (new) miEAA (rbioapi vignette article) PANTHER (rbioapi vignette article) Reactome (rbioapi vignette article) STRING (rbioapi vignette article) UniProt (rbioapi vignette article) Github (Developmental) version: (https://github.com/moosa-r/rbioapi/): currently none services dedicated vignette article. However, article, write general framework rbioapi. Make sure check vignette article service learn use . Note : rbioapi ongoing project. New databases services implemented periodically order gradually make package comprehensive possible. see often using certain database/service? Feel free suggest database/service creating issue GitHub repository. appreciate suggestions.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"How-to-install","dir":"Articles","previous_headings":"","what":"How to install?","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"can install stable release version rbioapi CRAN : However, CRAN version released every 1-2 months, can install recent (development) version GitHub : Now, can load package:","code":"install.packages(\"rbioapi\") install.packages(\"remotes\") remotes::install_github(\"moosa-r/rbioapi\") library(rbioapi)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"naming-conventions","dir":"Articles","previous_headings":"","what":"Naming conventions","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"make namespace organized, functions named following pattern: example, rba_string_version() call STRING’s version resource. Thus, version, rbioapi function one following naming schema: rba_enrichr_* rba_jaspar_* rba_mieaa_* rba_panther_* rba_reactome_* rba_string_* rba_uniprot_* three exceptions: rba_options(), rba_connection_test(), rba_pages(); helper functions. later.","code":"rba_[service_name]_[resource_name] rba_string_version() #> Retrieving the STRING database version and address used by rbioapi. #> $string_version #> [1] \"12.0\" #> #> $stable_address #> [1] \"https://version-12-0.string-db.org\""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"changing-the-options","dir":"Articles","previous_headings":"","what":"Changing the options","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"provide control, multiple options implemented. See manual rba_options() function full description available options. short, options govern rbioapi’s connection servers (e.g. timeout, retry) options modify experience rbioapi (e.g. verbose, diagnostics, save_file). two ways may use change option. Also, can get table available rbioapi options current values calling rba_options()without argument: Now, let us consider ways can alter settings:","code":"rba_options() #> rbioapi_option current_value allowed_value #> 1 diagnostics FALSE Logical (TRUE/FALSE) #> 2 dir_name rbioapi Character #> 3 progress FALSE Logical (TRUE/FALSE) #> 4 retry_max 0 Numeric (0 or greater) #> 5 retry_wait 10 Numeric (0 or greater) #> 6 save_file FALSE Logical (TRUE/FALSE) #> 7 skip_error TRUE Logical (TRUE/FALSE) #> 8 timeout 30 Numeric (0.1 or greater) #> 9 verbose TRUE Logical (TRUE/FALSE)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"changing-the-options-change-the-option-globally","dir":"Articles","previous_headings":"Changing the options","what":"Change the option globally","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"Changing option globally means rest R session, rbioapi function respect changed option. , use rba_options(). argument function corresponds certain option; Thus running function desired new values, globally alter rbioapi option. example:","code":"rba_options(save_file = TRUE) ## From now on, the raw file of server's response will be saved to your working directory. rba_options(verbose = FALSE) ## From now on, the package will be quiet."},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"changing-the-options-change-the-option-only-within-a-function-call","dir":"Articles","previous_headings":"Changing the options","what":"Change the option only within a function call","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"can pass additional arguments rbioapi function using “ellipsis” (familiar … dot dot dot!). Meaning can call function additional arguments ‘option = value’ pair. way, changes options confined within particular function call. example:","code":"## Save the server's raw response file: x <- rba_reactome_species(only_main = TRUE, save_file = \"reactome_species.json\") ## Also, in the case of connection failure, retry up to 10 times: x <- rba_reactome_species(only_main = TRUE, save_file = \"reactome_species.json\", retry_max = 10) ## Run these codes in your own R session to see the difference. ## show internal diagnostics boring details x <- rba_uniprot_proteins_crossref(db_id = \"CD40\", db_name = \"HGNC\", diagnostics = TRUE) ## The next function you call, will still use the default rbioapi options x <- rba_uniprot_proteins_crossref(db_id = \"CD40\", db_name = \"HGNC\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"connection-test","dir":"Articles","previous_headings":"","what":"Connection test","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"second exception functions’ naming schema rba_connection_test(). Run simple function check connection supported services/databases. encounter errors using rbioapi, kindly run function make sure internet connection servers fine.","code":"rba_connection_test(print_output = TRUE) #> Checking Your connection to the Databases currently supported by rbioapi: #> --->>> Internet : #> +++ Connected to the Internet. #> --->>> Enrichr : #> +++ The server is responding. #> --->>> Ensembl : #> +++ The server is responding. #> --->>> JASPAR : #> +++ The server is responding. #> --->>> miEAA : #> +++ The server is responding. #> --->>> PANTHER : #> +++ The server is responding. #> --->>> Reactome Content Service : #> +++ The server is responding. #> --->>> Reactome Analysis Service : #> +++ The server is responding. #> --->>> STRING : #> +++ The server is responding. #> --->>> UniProt : #> +++ The server is responding."},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"multi-pages","dir":"Articles","previous_headings":"","what":"Iterating over paginated results","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"API resources return paginated responses. particularly common API resources return potentially large responses. rbioapi, cases, arguments “page_number” (default value 1) -API resource allows- “page_size”. save time, may use rba_pages(). function iterate pages specified. Take rba_uniprot_taxonomy_name example. function allows search taxonomic nodes UniProt. response can potentially huge size, UniProt returns paginated response. example, search nodes contain “adenovirus”, large number hits: can see, server returned first page response, retrieve pages, make separate calls change “page_number” argument within call, simply use rba_pages() demonstrated : can see, done : Wrap function call qoute() enter input rba_pages(). Replace argument want iterate , string format: “pages:start:end”. example, supplied page_number = “pages:1:3” get responses pages 1 3.","code":"adeno <- rba_uniprot_taxonomy_name(name = \"adenovirus\", search_type = \"contain\", page_number = 1) str(adeno, max.level = 2) #> List of 2 #> $ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ taxonomyId : int [1:200] 10509 10510 10511 10512 10513 10514 10515 10519 10521 10522 ... #> ..$ mnemonic : chr [1:200] \"9ADEN\" \"ADEB3\" \"ADEB7\" \"9ADEN\" ... #> ..$ scientificName: chr [1:200] \"Mastadenovirus\" \"Bovine adenovirus B serotype 3\" \"Bovine adenovirus 7\" \"Canine adenovirus 1\" ... #> ..$ rank : chr [1:200] \"genus\" \"serotype\" \"serotype\" \"serotype\" ... #> ..$ superregnum : chr [1:200] \"V\" \"V\" \"V\" \"V\" ... #> ..$ hidden : logi [1:200] FALSE TRUE TRUE TRUE TRUE TRUE ... #> ..$ commonName : chr [1:200] NA \"BAdV-3\" \"BAdV-7\" NA ... #> ..$ synonym : chr [1:200] NA \"Mastadenovirus bos3\" NA NA ... #> $ pageInfo :List of 3 #> ..$ resultsPerPage: int 200 #> ..$ currentPage : int 1 #> ..$ totalRecords : int 1102 adeno_pages = rba_pages(quote(rba_uniprot_taxonomy_name(name = \"adenovirus\", search_type = \"contain\", page_number = \"pages:1:3\"))) ## You can inspect the structure of the response: str(adeno_pages, max.level = 2) #> List of 3 #> $ page_1:List of 2 #> ..$ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ pageInfo :List of 3 #> $ page_2:List of 2 #> ..$ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ pageInfo :List of 3 #> $ page_3:List of 2 #> ..$ taxonomies:'data.frame': 200 obs. of 6 variables: #> ..$ pageInfo :List of 3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"how-to-cite","dir":"Articles","previous_headings":"","what":"How and what to cite?","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"rbioapi interface databases services. Thus, used rbioapi published research, addition kindly citing rbioapi, make sure fully properly cite databases/services used. Suggested citations added functions’ manuals, “references” section; Nevertheless, user’s responsibility check proper citations properly cite database/services used.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"how-to-cite-rbioapi","dir":"Articles","previous_headings":"How and what to cite?","what":"How to cite rbioapi","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"how-to-cite-services","dir":"Articles","previous_headings":"How and what to cite?","what":"How to cite the databases and web services","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"cite Enrichr. (See Enrichr website) cite JASPAR. (See JASPAR website) cite miEAA. (See miEAA website) cite PANTHER. (See PANTHER website) cite Reactome. (See Reactome website) cite STRING. (See STRING website) cite UniProt. (See UniProt website)","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"code-of-conduct","dir":"Articles","previous_headings":"","what":"Code of conduct","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"package, rbioapi, unofficial interface implementation associated, endorsed, officially connected way original databases web services. creators maintainers rbioapi independent entities official relationship databases web services. using rbioapi, remember querying data web services; please considerate. Never flood server requests, need download unreasonably large volumes data, directly downloading databases supplied services may better alternative. see rate-limited server (HTTP 429 Many Requests response status code), know sending requests server interprets normal behavior, please seek methods use Sys.sleep() requests.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"what-next","dir":"Articles","previous_headings":"","what":"What next?","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"supported service dedicated vignette article. Make sure check . Enrichr (Documentation site) JASPAR (Documentation site) miEAA (Documentation site) PANTHER (Documentation site) Reactome (Documentation site) STRING (Documentation site) UniProt (Documentation site) also adding vignette articles focusing tasks workflows: rbioapi: Enrichment (-Representation) Analysis R (documentation site)","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"design-philosophy","dir":"Articles","previous_headings":"","what":"Design philosophy of rbioapi","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"learn design philosophy concepts behind developing rbioapi, please read paper Bioinformatics.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"article rbioapi documentation site Functions references rbioapi documentation site","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"1: rbioapi: User-Friendly R Interface to Biologic Web Services' API","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] digest_0.6.37 desc_1.4.3 R6_2.5.1 fastmap_1.2.0 #> [5] xfun_0.49 cachem_1.1.0 knitr_1.49 htmltools_0.5.8.1 #> [9] rmarkdown_2.29 lifecycle_1.0.4 cli_3.6.3 sass_0.4.9 #> [13] pkgdown_2.1.1 textshaping_0.4.1 jquerylib_0.1.4 systemfonts_1.1.0 #> [17] compiler_4.4.2 httr_1.4.7 tools_4.4.2 ragg_1.3.3 #> [21] curl_6.0.1 evaluate_1.0.1 bslib_0.8.0 yaml_2.3.10 #> [25] jsonlite_1.8.9 rlang_1.1.4 fs_1.6.5 htmlwidgets_1.6.4"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"how-to-install","dir":"Articles","previous_headings":"","what":"How to install?","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"can install stable release version rbioapi CRAN : However, CRAN version released every 1-2 months, can install recent (development) version GitHub : Now, can load package:","code":"install.packages(\"rbioapi\") install.packages(\"remotes\") remotes::install_github(\"moosa-r/rbioapi\") library(rbioapi)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"what-is-over-representation-analysis","dir":"Articles","previous_headings":"","what":"What is Over-representation analysis?","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"Enrichment (-Representation) analysis commonly performed one’s analysis yields list genes, proteins, entities. delve details refer D. W. Huang et al.: Nucleic Acids Res. 37, 1 (2009) thorough review subject. short, perform analysis, addition algorithms, two data required: gene list derived analysis. Gene sets, genes grouped based shared property concept (pathway, role diseases, physical location, etc.). -representation analysis, can compare gene list find member gene set -represented, meaning present list manner can explained chance alone.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"setting-up-data","dir":"Articles","previous_headings":"","what":"Setting up the data","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"Many web services supported rbioapi provide tools perform -representation analysis gene sets curated databases. Among databases web services currently supported rbioapi, Enrichr, miEAA, PANTHER, Reactome, STRING provide services. service dedicated vignette article rbioapi. focus performing Enrichment (-Representation) analysis. demonstration, use results Galani et al.: Nat. Immunol. 22, 32 (2021) compared gene expression critically ill non-critically ill COVID patients healthy individuals. assign variable 1214 differentially expressed genes (DEGs) exclusively induced critically ill COVID patients. Next, see insights can extract list. Please Note: -representation services return large responses. reduce size vignette article, display first 10 rows Data Frame.","code":"covid_critical <- c(\"TXNDC5\", \"GABRR2\", \"MGAM2\", \"LOC200772\", \"LYPD2\", \"IFI27\", \"RPH3A\", \"OTOF\", \"NBPF8\", \"CLEC4F\", \"CNGB1\", \"HIST1H2BF\", \"HIF1A\", \"SDC1\", \"TUBB8\", \"FBXO39\", \"TPSB2\", \"CD177\", \"LRRN3\", \"EBLN2\", \"PCSK9\", \"ELK2AP\", \"UCHL1\", \"C22orf15\", \"LPO\", \"C3orf20\", \"CLRN1-AS1\", \"GPR75\", \"CA12\", \"RAB19\", \"CHRFAM7A\", \"CRYGN\", \"DLGAP5\", \"BTBD8\", \"LOC100272216\", \"PRG3\", \"CYP46A1\", \"LOC102723604\", \"PPAP2B\", \"C4BPA\", \"SPESP1\", \"LILRP2\", \"UBE2Q1-AS1\", \"MIR3945\", \"NOMO3\", \"MEG3\", \"LOC400927-CSNK1E\", \"MIR6732\", \"MIR590\", \"PPP1R3G\", \"PYCR1\", \"ARHGAP42\", \"MMP8\", \"HMMR\", \"P3H2\", \"ACER1\", \"NOG\", \"RAB39A\", \"ANTXRLP1\", \"LINC00266-3\", \"GPRC5D\", \"MCM10\", \"TSPY26P\", \"ANKRD36BP1\", \"GBP1P1\", \"PRL\", \"CYP1A1\", \"KIF4A\", \"LOC102724323\", \"SERPINB10\", \"GSTA4\", \"TRIM51\", \"MIXL1\", \"RNASE1\", \"CASC8\", \"MAOA\", \"XCL1\", \"ADAMTS2\", \"LOC101929125\", \"DCANP1\", \"BHLHA15\", \"ANOS1\", \"SLC18A1\", \"CCDC150\", \"CAV1\", \"SH3BP5\", \"LINC00398\", \"NCOA2\", \"SPATC1\", \"SHROOM2\", \"GPR27\", \"LRRC26\", \"RNF169\", \"USP3-AS1\", \"VWA7\", \"ROCK2\", \"FSTL4\", \"METTL7B\", \"CYP4F29P\", \"LEF1-AS1\", \"HORMAD2-AS1\", \"FBXO15\", \"PPTC7\", \"TYMS\", \"PPP4R2\", \"ZNF608\", \"FAM46B\", \"PCSK1N\", \"LINC00623\", \"CASC5\", \"ZNF224\", \"DENND2C\", \"WDR86\", \"PTGR1\", \"SPATA3-AS1\", \"LOC101927412\", \"KIF14\", \"MMP28\", \"PBK\", \"VMO1\", \"ADCY3\", \"HIST1H2BO\", \"FTO-IT1\", \"MIR342\", \"FANK1\", \"CRIP2\", \"TIAF1\", \"LOC344887\", \"OLFM4\", \"MKNK1-AS1\", \"ZDHHC19\", \"SEPT14\", \"EPSTI1\", \"FOXC1\", \"MIR616\", \"KRT72\", \"LINC01347\", \"LOC101928100\", \"KIAA0895\", \"BOK\", \"HIST1H2AI\", \"DBH-AS1\", \"ADORA2A-AS1\", \"MED12L\", \"SAMD15\", \"TARM1\", \"SMTNL1\", \"POU5F1P3\", \"LINC00968\", \"OAS3\", \"LOC103091866\", \"SH3RF3-AS1\", \"NBPF10\", \"APAF1\", \"SLC2A14\", \"SYT17\", \"ETV3\", \"SHROOM4\", \"AOAH-IT1\", \"NAIP\", \"ALAS2\", \"GLIS3\", \"ADAM17\", \"OLFM1\", \"PCAT29\", \"TNFRSF18\", \"DNASE1L3\", \"IGF2BP3\", \"LINC01271\", \"AP3B2\", \"TXNDC2\", \"CEP55\", \"SIGLEC1\", \"RAB3IL1\", \"PLD4\", \"KIFC1\", \"LINC00487\", \"ABHD12B\", \"ITGA7\", \"GJB6\", \"CARD14\", \"LRRN2\", \"MPO\", \"KLRC3\", \"LOC100507487\", \"SCGB3A1\", \"CD38\", \"LRRN1\", \"SYCP2L\", \"ANLN\", \"ASPM\", \"OAS1\", \"IFI44L\", \"CDCA3\", \"HLA-DQB2\", \"ANO9\", \"NUDT11\", \"HMP19\", \"DEPDC1\", \"GPR84\", \"PLEKHF1\", \"PI16\", \"RDH5\", \"TMED8\", \"LINC00824\", \"SEPT4\", \"CLIC3\", \"B4GALNT3\", \"OLAH\", \"ITGA1\", \"FOXI1\", \"LOC100506142\", \"CDC20\", \"HAGHL\", \"GTSCR1\", \"B3GALNT1\", \"SOCS3\", \"PCDH1\", \"TAS2R20\", \"CDC25A\", \"NPDC1\", \"LOC100505915\", \"XCL2\", \"TIAM2\", \"LOC100288069\", \"IL34\", \"IL18R1\", \"CYYR1\", \"ZNF888\", \"FAM20A\", \"MDS2\", \"ABCA13\", \"KCNJ1\", \"SLC4A9\", \"EXO1\", \"LAIR2\", \"IQSEC3\", \"SCT\", \"SLC26A8\", \"ESCO2\", \"ZDHHC1\", \"SNORA63\", \"FBLN5\", \"PRUNE2\", \"CPNE7\", \"CDHR2\", \"GNLY\", \"APOBEC3B\", \"MFSD9\", \"SYNGR3\", \"PTGDS\", \"COL17A1\", \"TBC1D14\", \"AIM2\", \"TMEM204\", \"FAM157B\", \"ZBED6\", \"EME1\", \"ATF3\", \"KBTBD4\", \"LUC7L2\", \"KIF20A\", \"LCNL1\", \"DOCK9-AS2\", \"KCNE1\", \"BTN2A3P\", \"KL\", \"IDI2-AS1\", \"EBF4\", \"SCARNA21\", \"CEACAM6\", \"KLRB1\", \"C5orf58\", \"ASXL2\", \"RPLP0P2\", \"CYTL1\", \"DIAPH3\", \"DOK7\", \"RFFL\", \"KIAA1107\", \"TAS2R40\", \"CCDC186\", \"COL6A2\", \"METRN\", \"SNHG25\", \"RRM2\", \"CYP1B1\", \"NEURL1\", \"MATK\", \"SLC28A3\", \"JCHAIN\", \"TNFRSF4\", \"FXYD1\", \"PLLP\", \"ARHGAP23\", \"SNORA4\", \"MYO18A\", \"ZNF429\", \"NRN1\", \"HJURP\", \"TCN1\", \"CDC6\", \"ATP5EP2\", \"SOAT2\", \"LOC101928034\", \"EIF2AK2\", \"ARG1\", \"SLC16A11\", \"TPPP3\", \"TMEM38A\", \"TOP2A\", \"LINC00999\", \"DGCR9\", \"RCAN3AS\", \"CACNG6\", \"LINC01550\", \"TDRD9\", \"CARD17\", \"GBP6\", \"LY6E\", \"RSAD2\", \"LOC100506258\", \"PRKAR2A\", \"LTF\", \"IGLL5\", \"FAM157A\", \"LOC101927018\", \"CCR7\", \"FLJ42351\", \"IFIT3\", \"GPRIN1\", \"ANXA9\", \"TMEM119\", \"PARGP1\", \"A3GALT2\", \"CYP4F22\", \"PLBD1-AS1\", \"SELM\", \"NCR3\", \"PNPLA1\", \"BMX\", \"LOC440461\", \"GAMT\", \"CEACAM8\", \"TP53I13\", \"C1orf226\", \"SKA3\", \"DHRS3\", \"VRK2\", \"BTBD19\", \"ETNK2\", \"LOC728323\", \"NRIR\", \"ADORA2A\", \"GPR162\", \"CMPK2\", \"USP18\", \"P4HA2\", \"TSSK4\", \"EP300\", \"CLEC4D\", \"LCN10\", \"GPR141\", \"SH2D2A\", \"GOLGA7B\", \"TMIGD2\", \"DLL4\", \"HP\", \"CXCR6\", \"MAL\", \"C12orf57\", \"CLIC5\", \"IL4\", \"IGFBP6\", \"ERG\", \"HERC3\", \"KEL\", \"MSX2P1\", \"INE1\", \"PRKCQ-AS1\", \"FHIT\", \"SLC1A7\", \"KIAA1958\", \"SARDH\", \"PFKFB3\", \"SNORD89\", \"IFI44\", \"DDX60\", \"TMEM238\", \"HAR1A\", \"EGR1\", \"VNN1\", \"TRIM9\", \"TAF13\", \"AP3S2\", \"TMEM56\", \"KLRC2\", \"CACNA1C-AS2\", \"ALX3\", \"FCGBP\", \"CD247\", \"ALDH1L2\", \"HIST1H2AC\", \"RTP5\", \"PPARG\", \"AMPH\", \"LINC00861\", \"CDKL5\", \"MYBL2\", \"LOC101927051\", \"TLR5\", \"TMEM121\", \"BMP8B\", \"AK5\", \"RBP5\", \"LINC01355\", \"PITRM1-AS1\", \"CMTM1\", \"BIRC5\", \"C10orf10\", \"TNFRSF25\", \"ZAP70\", \"LOC105373383\", \"DSP\", \"WDR86-AS1\", \"RPLP2\", \"KREMEN1\", \"LOC101927550\", \"PDZD4\", \"LOC100130451\", \"MKI67\", \"LOC728743\", \"CXCL10\", \"LINC01547\", \"LOC645513\", \"ATOH8\", \"S1PR5\", \"KISS1R\", \"MELK\", \"TCEA3\", \"SLC22A20\", \"RAMP1\", \"FOLR2\", \"GGT6\", \"CACNA1E\", \"FABP6\", \"RAP2C-AS1\", \"PRRG4\", \"FAM63B\", \"BLK\", \"P3H3\", \"WIPF2\", \"TROAP\", \"FAHD2CP\", \"CA6\", \"LINC00892\", \"LRCH3\", \"BUB1B\", \"LOC100996286\", \"NT5E\", \"PASK\", \"BATF2\", \"TTC39C-AS1\", \"ACTA2\", \"CHIT1\", \"LAMC1\", \"TNFAIP3\", \"ANKRD22\", \"C12orf42\", \"SPON2\", \"SLX4IP\", \"TNNC1\", \"ZNF771\", \"SPEG\", \"HIST1H4H\", \"HTR6\", \"TNFRSF17\", \"FSD1\", \"LINC00266-1\", \"CD6\", \"PRSS30P\", \"SFTPD\", \"COPZ2\", \"BPI\", \"CCIN\", \"CDK1\", \"ATP2C2\", \"GOLGA8H\", \"USP44\", \"SLC14A1\", \"ZDHHC14\", \"SNORD50A\", \"LTK\", \"KCNG2\", \"MAPK11\", \"ACOT4\", \"CTSW\", \"C1orf106\", \"CDKN3\", \"UPB1\", \"CAMK2N1\", \"RBM5-AS1\", \"DNLZ\", \"GZMM\", \"PLA2G7\", \"ZCCHC2\", \"PRSS41\", \"RPL13\", \"OLR1\", \"BCAS4\", \"EPB41\", \"TRABD2A\", \"PBX4\", \"GZMK\", \"PNPLA7\", \"B4GALT5\", \"ARHGEF17\", \"APOA1\", \"GPA33\", \"KLRG1\", \"GBP5\", \"LOC102723701\", \"CENPA\", \"LOC285696\", \"KCNK5\", \"SUSD4\", \"RPS28\", \"ESPL1\", \"ITGB4\", \"SPAG16\", \"CYP4F35P\", \"CD3D\", \"BMS1P20\", \"CBS\", \"ETV2\", \"SPATS2L\", \"DUSP13\", \"FAM19A1\", \"VSIG10L\", \"CD2\", \"NHSL2\", \"FAAH2\", \"FXYD7\", \"NTN5\", \"FICD\", \"GLDC\", \"LOC101927865\", \"LINC00944\", \"PTPRCAP\", \"GNB3\", \"TRIM22\", \"PRRT1\", \"NR1I3\", \"BTN3A1\", \"STX16-NPEPL1\", \"TMEM191A\", \"SERPINB2\", \"UST\", \"GALNT12\", \"BUB1\", \"GTF2I\", \"FOSL2\", \"COL13A1\", \"RGS9\", \"NCALD\", \"DNAH10\", \"CA11\", \"CKB\", \"HSPB1\", \"CDC45\", \"ATP7B\", \"WNT5B\", \"ZNF699\", \"PRRT4\", \"GALNT14\", \"ZNF319\", \"DNAH17\", \"LOC283710\", \"CPEB4\", \"LY6G6C\", \"PPAN\", \"WASH5P\", \"HIST1H3H\", \"IL32\", \"TEPP\", \"CNR1\", \"YJEFN3\", \"FAM159A\", \"FGFBP2\", \"FKBP5\", \"BIN1\", \"VPREB3\", \"E2F8\", \"HK3\", \"CDH2\", \"HFE\", \"BEAN1-AS1\", \"KIFC3\", \"HELB\", \"HLA-DPB1\", \"GZMH\", \"LMNB1\", \"CC2D2A\", \"IQCH-AS1\", \"CTSF\", \"TMEM132D\", \"LEF1\", \"REL\", \"CBR3\", \"WNT10B\", \"LOC100289473\", \"APBA2\", \"KIF23\", \"LOC646471\", \"PNMA6A\", \"EPC2\", \"HBEGF\", \"S100B\", \"C14orf132\", \"KCND1\", \"SIPA1L2\", \"NCAPG\", \"OAS2\", \"C3AR1\", \"CSF1\", \"CHCHD6\", \"AUTS2\", \"IL24\", \"CDC42EP2\", \"LTBP3\", \"PXT1\", \"ADAMTS10\", \"BLZF1\", \"TPST1\", \"ID3\", \"GYG1\", \"EFCAB2\", \"MYO10\", \"TLE2\", \"SLC30A1\", \"CCNI\", \"WNT7A\", \"RBL2\", \"ERICH6-AS1\", \"IGFBP3\", \"DTL\", \"SORBS3\", \"RPS19\", \"SMA4\", \"RPS27\", \"BEAN1\", \"MIRLET7BHG\", \"ABCA1\", \"ZKSCAN7\", \"GPR34\", \"GPR153\", \"TRIM52\", \"GRASP\", \"RNASE2\", \"CENPF\", \"ACTG1P20\", \"MMP9\", \"ZFP82\", \"RTN1\", \"RPS21\", \"PCBP1-AS1\", \"PVRL3\", \"RPS10\", \"FER1L4\", \"SEPT1\", \"DEPDC1B\", \"LINC00926\", \"SEC14L2\", \"LOC100420587\", \"PCSK4\", \"HPS3\", \"KIR3DL1\", \"SPRN\", \"HRH2\", \"FAHD2B\", \"P3H4\", \"TMEM160\", \"ENGASE\", \"RAD51AP1\", \"ZNF233\", \"RAP1GAP\", \"TTBK2\", \"PINK1\", \"SH2D1B\", \"BAIAP2L1\", \"BECN1\", \"RPL13A\", \"INHBB\", \"HPCAL4\", \"TPM2\", \"ACVR2B\", \"CEP126\", \"RPL18\", \"B3GNT7\", \"ROBO3\", \"MYOM2\", \"SLC51A\", \"CCL5\", \"PROSER3\", \"RPL18A\", \"SERINC4\", \"ATP11B\", \"SMARCD3\", \"STMN3\", \"FAM173A\", \"CDK5RAP2\", \"GGH\", \"EIF4G3\", \"C18orf32\", \"SHCBP1\", \"CCM2L\", \"LAT\", \"PRF1\", \"ARL15\", \"WHAMMP1\", \"NBN\", \"ARHGEF11\", \"ZWINT\", \"BTBD11\", \"MCOLN2\", \"EYS\", \"GRAP\", \"TAP1\", \"FAM157C\", \"ANXA3\", \"MCEMP1\", \"TCF7\", \"IGSF9B\", \"SDSL\", \"LNPEP\", \"NSUN5P1\", \"FAM110B\", \"SPNS3\", \"ACTL10\", \"GCSAM\", \"LOC101927482\", \"UGCG\", \"CD24\", \"SCO2\", \"GMCL1\", \"SAMD12\", \"NUSAP1\", \"WNT1\", \"NME3\", \"LOC728084\", \"RGS18\", \"PNMA3\", \"KLRF1\", \"ENO2\", \"SUPT3H\", \"ATP5D\", \"ZC3H13\", \"PSTPIP2\", \"SNORD81\", \"SESN2\", \"TK1\", \"LHFPL2\", \"SCARNA10\", \"SERPING1\", \"SYT2\", \"SNORA33\", \"JAK2\", \"CYB5D1\", \"SH3RF3\", \"ARL14EP\", \"UBASH3A\", \"ARL5B\", \"SPRED2\", \"NELL2\", \"PPP2R2B\", \"CDH12\", \"WDR54\", \"KLF4\", \"MTUS1\", \"ELF1\", \"CARNS1\", \"CLEC10A\", \"CD3E\", \"TTK\", \"KBTBD7\", \"TPX2\", \"ZNF69\", \"AICDA\", \"TAMM41\", \"LOC100288152\", \"AK1\", \"MMP24\", \"SAMD9L\", \"RAD51\", \"ACE\", \"COLGALT2\", \"NEDD4\", \"SPEF2\", \"CENPE\", \"CRISPLD2\", \"TSEN54\", \"RCVRN\", \"FRMD3\", \"SKAP1\", \"CYP4F3\", \"TMEM161B-AS1\", \"KANSL1L\", \"SLC29A2\", \"CEP97\", \"XAF1\", \"CDKN1C\", \"PRDM5\", \"HBP1\", \"CACNG8\", \"RP2\", \"OASL\", \"NPIPA1\", \"ZNF354A\", \"RPL32\", \"GLTSCR2\", \"CD52\", \"SBK1\", \"ZNF703\", \"GBP1\", \"C4orf29\", \"ERV3-1\", \"ABCC2\", \"EPB41L5\", \"FFAR3\", \"PLEKHB1\", \"LOC100507387\", \"RPL36\", \"PRC1\", \"C19orf60\", \"PRSS23\", \"CD160\", \"HOPX\", \"SAMD10\", \"RPSAP9\", \"CDCA2\", \"SWT1\", \"NPEPL1\", \"RORC\", \"MS4A3\", \"BCL2L15\", \"CXCR5\", \"EPHX2\", \"B3GNT9\", \"CDCA7L\", \"LMTK2\", \"UBAP1L\", \"CD79B\", \"OBSCN\", \"TMEM102\", \"ZNF540\", \"SPP1\", \"HABP4\", \"LOC100130872\", \"APBB1\", \"GPC2\", \"CD1C\", \"LONRF3\", \"NR2C2\", \"NSUN7\", \"SIGIRR\", \"SNORD38B\", \"FAM65C\", \"HELZ2\", \"ARL4D\", \"ENO3\", \"RPL9\", \"IFT81\", \"LSMEM2\", \"SCARNA2\", \"CD5\", \"AHNAK2\", \"RPL27A\", \"SOX8\", \"TMEM161A\", \"ZNF81\", \"PXK\", \"LOC441081\", \"RPS26\", \"CCNB1\", \"PLXDC1\", \"NFKBIA\", \"PKMYT1\", \"SLC27A5\", \"LRRC4\", \"TARP\", \"MAP2K6\", \"EIF1B-AS1\", \"SCARNA17\", \"NUDT8\", \"EAF1\", \"TBC1D8\", \"SESTD1\", \"CLEC12B\", \"ZNF776\", \"PDCD1\", \"FBXL16\", \"SLFN14\", \"ATP8B3\", \"ZNF396\", \"STOM\", \"CCDC30\", \"FAM86FP\", \"FAM129C\", \"TMEM42\", \"ZNF607\", \"IL11RA\", \"ECHDC2\", \"CCNE2\", \"PUS7L\", \"EFCAB12\", \"TGFA\", \"MAPK14\", \"NSG1\", \"C9orf142\", \"KLHL15\", \"LOC102723766\", \"VEGFB\", \"TJP3\", \"YAE1D1\", \"PROS1\", \"CSGALNACT2\", \"HLA-DOA\", \"TUBBP5\", \"RPL37A\", \"FAM195A\", \"LTB4R2\", \"NCAPH\", \"EVL\", \"CR1\", \"LTC4S\", \"ANKS3\", \"RPL35\", \"GLIS2\", \"TRAPPC6A\", \"LIPN\", \"RPS12\", \"RPL38\", \"LIME1\", \"PHGDH\", \"C4orf48\", \"SLED1\", \"BACH2\", \"EVA1C\", \"GATA3\", \"SLC25A38\", \"USP32\", \"RPL39\", \"EGR2\", \"USP35\", \"ZNF662\", \"PLEKHG1\", \"CRTAM\", \"AANAT\", \"OPLAH\", \"FBXO6\", \"LOXL1\", \"LOC101928786\", \"FRMD4B\", \"IL1R1\", \"ADM2\", \"DNASE1L1\", \"STAT4\", \"RPLP1\", \"TTC9\", \"BEND7\", \"F8\", \"FOSB\", \"SLAMF6\", \"STK17B\", \"PVT1\", \"ARVCF\", \"APOBEC3C\", \"CDK14\", \"RPS14\", \"POLQ\", \"CDC42BPG\", \"CCDC85B\", \"UBR5-AS1\", \"TNNT3\", \"TCL1A\", \"IL7R\", \"PTX3\", \"KLHL14\", \"MTRNR2L1\", \"ZBTB46\", \"RPL34\", \"VPS9D1-AS1\", \"KLF7\", \"RPL10A\", \"SLC2A11\", \"ACTN4\", \"RPSA\", \"SGK223\", \"PLSCR1\", \"SBF2\", \"LINC01420\", \"CDCA5\", \"F5\", \"ADGRB2\", \"RPL23A\", \"MAN1A2\", \"LLGL2\", \"GINS2\", \"NUDT14\", \"TG\", \"RSRC1\", \"TMEM256\", \"SYTL2\", \"TYSND1\", \"TPGS1\", \"ABHD14B\", \"LSM7\", \"ZNF281\", \"CEMP1\", \"M1AP\", \"CD82\", \"LOC101928150\", \"MRPL41\", \"IFIH1\", \"CCNB2\", \"IFITM10\", \"RPS3A\", \"TMEM8B\", \"CEP135\", \"SIRPB2\", \"IRS2\", \"SYCE1L\", \"SULT1B1\", \"ADAM9\", \"ZCCHC18\", \"DDIAS\", \"LINC01278\", \"MTHFD2\", \"TIGIT\", \"FUOM\", \"FOSL1\", \"RPS16\", \"BRAF\", \"CACNA1I\", \"EXT1\", \"GPR82\", \"LRRC45\", \"STAG1\", \"KIF11\", \"NCAM1\", \"RNF24\", \"KIAA2018\", \"SAMD9\", \"ABCA2\", \"PVRIG\", \"RASGRF2\", \"IRAK2\", \"ARHGEF4\", \"ZNF682\", \"RASSF7\", \"THAP7\", \"KIF1B\", \"GAS5\", \"KIF15\", \"RMRP\", \"GALM\", \"LYNX1\", \"C7orf50\", \"ATXN1L\", \"KCNN4\", \"LDLRAP1\", \"RETSAT\", \"RNF10\", \"NOXA1\", \"UBXN7\", \"UHRF1BP1L\", \"TESPA1\", \"MB21D1\", \"LINC00116\", \"FOXM1\", \"CCR6\", \"NMUR1\", \"RPL22\", \"LCK\", \"MEGF9\", \"CLSPN\", \"MIR4697HG\", \"PPP1R15A\", \"ADCK5\", \"SAMD3\", \"RPS27A\", \"TPPP\", \"PIWIL4\", \"ANKRD33B\", \"IL18RAP\", \"SNRPD2\", \"WASF1\", \"ALDH5A1\", \"FAM149B1\", \"RPS18\", \"SLCO4C1\", \"MGC16275\", \"ZNF837\", \"SAMHD1\", \"NSMF\", \"PDIA6\", \"SNX20\", \"ATF7IP2\", \"BPHL\", \"RPL35A\", \"NFKBIZ\", \"LMF1\", \"MGMT\", \"PPL\", \"FAM120C\", \"APRT\", \"RANGRF\", \"PHLDB3\", \"IDNK\", \"RPS15\", \"LGR6\", \"MOB1A\", \"CREB5\", \"THEM4\", \"ENDOG\", \"RPL7\", \"EDN1\", \"ZNF808\", \"SNHG15\", \"RPL3\", \"SMCR8\", \"FCMR\", \"ZNF449\", \"ZBTB37\", \"NHLRC4\", \"DHRS9\", \"C1QTNF3\", \"MS4A1\", \"AFF2\", \"FBXO32\", \"SLC6A6\", \"ZSCAN30\", \"CHPT1\", \"PARP14\", \"MZT2B\", \"FLT3LG\", \"TCTN2\", \"MAN1A1\", \"LOC728175\", \"ALOX5\", \"DUSP18\", \"ZC3H12D\", \"PECR\", \"LRRC37A3\", \"EPB41L4A-AS1\", \"SPAG5\", \"KDM7A\", \"DDX31\", \"NCOA6\", \"SLC6A12\", \"FCER1A\", \"FBXL13\", \"AKR7A2\", \"PRR5\", \"PRKCE\", \"PPP1R3D\", \"SYNM\", \"GLI1\", \"NTNG2\", \"EEF1G\", \"LOC643802\", \"MAGEE1\", \"PIK3AP1\", \"RPS8\", \"SNHG19\", \"C19orf70\", \"GAS7\", \"PHF12\", \"ATP11A\", \"SLC22A23\", \"ATP6V0E2\", \"UCKL1-AS1\", \"TIPARP\", \"BEX2\", \"FAM102A\", \"RPS20\", \"TTC16\", \"PLP2\", \"HAPLN3\", \"C19orf24\", \"ZNF397\", \"FOXO4\", \"TRAPPC2B\", \"QTRT1\", \"CDK10\", \"PDZD8\", \"GIPC1\", \"CD274\", \"C9orf139\", \"SPIB\", \"KLHDC7B\", \"ZNF32\", \"ELMO2\", \"AK4\", \"SAMD4B\", \"MFSD3\", \"EXD3\", \"SLC37A3\", \"RPL8\", \"TRIM56\", \"NMB\", \"PIPOX\", \"PXN-AS1\", \"SLC2A5\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"enrichr","dir":"Articles","previous_headings":"","what":"Enrichr","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"Enrichr , developed Ma’ayan Lab, service perform enrichment analysis considerable number curated gene set libraries across various species. thoroughly covered performing enrichment analysis Enrichr vignette article Enrichr & rbioapi. Therefore, provide brief demonstration . First, let us retrieve list available libraries Enrichr using rba_enrichr_libs() function. can find available Enrichr libraries libraryName column returned data frame. required argument rba_enrichr() function gene_list, use gene_set_library argument request enrichment analysis “KEGG_2021_Human” library. gene_set_library parameter, can also provide multiple gene set libraries leave default parameter NULL perform enrichment analysis using every gene set library available Enrichr. Also note regex_library_name parameter TRUE (default value), gene_set_library parameter considered regex pattern, partial matchs also selected. can see , one library selected, results list elements enrichment results one library: also possible provide background gene list Enrichr analysis. feature supported organism set “human”.","code":"enrichr_libs <- rba_enrichr_libs(organism = \"human\") #> Retrieving List of available libraries and statistics from Enrichr human. enrichr_enrich <- rba_enrichr(gene_list = covid_critical, organism = \"human\", gene_set_library = \"KEGG_2021_Human\") #> --Step 1/3: #> Retrieving List of available libraries and statistics from Enrichr human. #> --Step 2/3: #> Uploading 1214 gene symbols to Enrichr human. #> --Step 3/3: #> Performing enrichment analysis on gene-list 87054386 against Enrichr human library: KEGG_2021_Human. enrichr_enrich_kegg <- rba_enrichr(gene_list = covid_critical, gene_set_library = \"kegg\", regex_library_name = TRUE # default value ) #> --Step 1/3: #> Retrieving List of available libraries and statistics from Enrichr human. #> --Step 2/3: #> Uploading 1214 gene symbols to Enrichr human. #> --Step 3/3: #> Performing enrichment analysis on gene-list 87054393 using multiple Enrichr human libraries. #> Note: You have selected '6' Enrichr human libraries. Note that for each library, a separate call should be sent to Enrichr server. Thus, this could take a while depending on the number of selected libraries and your network connection. #> | | | 0% | |============ | 17% | |======================= | 33% | |=================================== | 50% | |=============================================== | 67% | |========================================================== | 83% | |======================================================================| 100% str(enrichr_enrich_kegg, max.level = 1) #> List of 6 #> $ KEGG_2013 :'data.frame': 139 obs. of 9 variables: #> $ KEGG_2015 :'data.frame': 131 obs. of 9 variables: #> $ KEGG_2016 :'data.frame': 260 obs. of 9 variables: #> $ KEGG_2019_Human:'data.frame': 272 obs. of 9 variables: #> $ KEGG_2019_Mouse:'data.frame': 267 obs. of 9 variables: #> $ KEGG_2021_Human:'data.frame': 285 obs. of 9 variables:"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"reactome-analysis-services","dir":"Articles","previous_headings":"","what":"Reactome Analysis services","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"Reactome curates extensive top-quality cellular pathways data across various species. Given fact proteins operate organized units, pathways, analyzing list Reactome pathways gene sets can provide valuable insights functional trajectories results. can refer Reactome & rbioapi article -depth coverage Reactome services. demonstrate -representation functionality function rba_reactome_analysis() accepts gene lists table input. table supplied, first column consist identifiers, next column numerical gene expression values. Refer rba_reactome_analysis() function’s manual details. , use gene list critical COVID: Let us examine response’s structure: list’s element names self-explanatory. results returned data frame pathways element. Note Reactome map provided gene identifiers identifiers may found. Hence, keep eye identifiersNotFound element. Naturally, can alter analysis parameters using rba_reactome_analysis() function’s arguments. used parameters returned “summary” element. code chunk, note “token” associated analysis. can use token perform following. Retrieve analysis results: addition main response, can download data associated request. see argument request rba_reactome_analysis_download() function’s manual information. , download CSV file input identifiers found: Reactome also generates nice report analysis pdf format, make sure try :","code":"reactome <- rba_reactome_analysis(input = covid_critical) #> Retrieving Reactome Analysis Results of your supplied Identifiers. str(reactome, max.level = 1) #> List of 8 #> $ summary :List of 7 #> $ expression :List of 1 #> $ identifiersNotFound: int 560 #> $ pathwaysFound : int 1535 #> $ pathways :'data.frame': 1535 obs. of 19 variables: #> $ resourceSummary :'data.frame': 4 obs. of 3 variables: #> $ speciesSummary :'data.frame': 1 obs. of 5 variables: #> $ warnings : list() str(reactome$summary) #> List of 7 #> $ token : chr \"MjAyNDEyMDkxNzUwNTFfMjc%3D\" #> $ projection : logi TRUE #> $ interactors : logi FALSE #> $ type : chr \"OVERREPRESENTATION\" #> $ sampleName : chr \"Gene names\" #> $ text : logi TRUE #> $ includeDisease: logi TRUE reactome_2 <- rba_reactome_analysis_token(reactome$summary$token) rba_reactome_analysis_download(token = reactome$summary$token, request = \"not_found_ids\", save_to = \"my_analysis.csv\") rba_reactome_analysis_pdf(token = reactome$summary$token, species = 9606, #Homo sapiens save_to = \"my_analysis.pdf\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"panther","dir":"Articles","previous_headings":"","what":"PANTHER","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"PANTHER (protein analysis evolutionary relationships) project provides classification systems genes proteins. PANTHER also provides enrichment service. fact, enrichment tool available Gene Ontology (GO) website powered PANTHER. Just like previous sections, review enrichment functionality ; -depth review PANTHER refer vignette article “PANTHER & rbioapi”. perform analysis, first, need choose annotation datasets (.e. collection gene sets) want compare results . retrieve list available annotation datasets, call following function: Note enter “id” datasets, label. example, entering “biological_process” incorrect, rather use “GO:0008150”. , demonstrate enrichment analysis using Biological Process annotations. Gene Ontology (GO) project one pinnacles scientists’ collective effort bioinformatics. GO Consortium provides comprehensive model biological systems. short, GO curates thoroughly designed directed acyclic graph (DAG) ontologies. may think tree terms, branches , terms become specific). protein may annotated one terms. terms organized three domains: “Molecular Function,” “Biological Process,” “Cellular Component”. GO slim datasets refer subsets cut-version GO terms. familiar GO, strongly encourage see page follow links provides: GO resource. Depending provided input, PANTHER conduct two types analysis: character vector supplied, -representation analysis performed using either Fisher’s exact binomial test. data frame gene identifiers corresponding expression values supplied, statistical enrichment test performed using Mann-Whitney U (Wilcoxon Rank-Sum) test. rbioapi determines proper analysis based class genes parameter. Please refer details section rba_panther_enrich() function manual rbioapi & PANTHER vignette article information. , demonstrate using gene list, without expression values: addition results table, PANTHER returns useful information analysis. names self-explanatory: analysis results returned Data Frame element named result:","code":"panther_sets <- rba_panther_info(what = \"datasets\") #> Retrieving available annotation datasets. panther_enrich <- rba_panther_enrich(genes = covid_critical, organism = 9606, #Homo sapiens annot_dataset = \"GO:0008150\" #Biological Process ) #> Performing PANTHER over-representation analysis (Fisher's exact test) on 1214 genes from `organism 9606` against `GO:0008150` datasets. str(panther_enrich, 2) #> List of 9 #> $ reference :List of 3 #> ..$ organism : chr \"Homo sapiens\" #> ..$ mapped_count : int 20580 #> ..$ unmapped_count: int 0 #> $ input_list :List of 5 #> ..$ organism : chr \"Homo sapiens\" #> ..$ mapped_count : int 1040 #> ..$ mapped_id : chr [1:1040] \"SCT\" \"C4BPA\" \"FAM159A\" \"TSEN54\" ... #> ..$ unmapped_count: int 174 #> ..$ unmapped_id : chr [1:174] \"LOC200772\" \"ELK2AP\" \"CLRN1-AS1\" \"LOC100272216\" ... #> $ result :'data.frame': 15029 obs. of 9 variables: #> ..$ number_in_list : int [1:15029] 38 108 104 136 195 77 295 143 129 129 ... #> ..$ fold_enrichment : num [1:15029] 5.57 2.04 2 1.79 1.59 ... #> ..$ fdr : num [1:15029] 1.86e-14 1.04e-08 6.92e-08 5.89e-08 6.17e-08 ... #> ..$ expected : num [1:15029] 6.82 52.94 52.06 75.84 122.53 ... #> ..$ number_in_reference: int [1:15029] 132 1024 1007 1467 2370 677 4070 1620 1420 1423 ... #> ..$ pValue : num [1:15029] 1.24e-18 1.38e-12 1.38e-11 1.57e-11 2.05e-11 ... #> ..$ plus_minus : chr [1:15029] \"+\" \"+\" \"+\" \"+\" ... #> ..$ term.id : chr [1:15029] \"GO:0002181\" \"GO:0002684\" \"GO:0050776\" \"GO:0009607\" ... #> ..$ term.label : chr [1:15029] \"cytoplasmic translation\" \"positive regulation of immune system process\" \"regulation of immune response\" \"response to biotic stimulus\" ... #> $ search :List of 1 #> ..$ search_type: chr \"overrepresentation\" #> $ tool_release_date : int 20240807 #> $ enrichment_test_type : chr \"FISHER\" #> $ annotDataSet : chr \"GO:0008150\" #> $ annot_version_release_date: chr \"GO Ontology database DOI: 10.5281/zenodo.14083199 Released 2024-11-03\" #> $ correction : chr \"FDR\""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"string","dir":"Articles","previous_headings":"","what":"STRING","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"addition proteins interaction data, STRING also curates proteins/genes annotations provides enrichment analysis services. can perform analysis multiple gene sets. gene sets can accessed using services two gene sets exclusive STRING. See “D. Szklarczyk et al.: Nucleic Acids Res. 49, D1 (2021)” information. . review enrichment functionality ; -depth review STRING refer vignette article “STRING & rbioapi”. Gene sets exclusively STRING: Reference Publications (PubMed) Hierarchical clustering STRING network Gene sets also available services: Gene Ontology domains: Molecular Function, Biological Process, Cellular Component COMPARTMENTS Human Disease Ontology InterPro KEG1G pathways UniProt keyword Pfam Reactome pathways BRENDA Tissue Enzyme Source Ontology SMART can directly supply covid_critical variable STRING’s enrichment function: can see, default list returned element data Frame enrichment analysis results one gene sets listed : “PMID” element, see PubMed papers -represented gene list. keep table tidy, displaying inputGenes preferredNames columns. can retrieve annotations associated input protein(s). difference statistical analysis performed full annotations input gene returned. potentially unwieldy response, allow_pubmed set fo FALSE default. set TRUE also retrieve PubMed paper abstracts include gene. can see, input gene large number annotations. Let us take look PMID Data Frame, contains PubMed Abstract paper terms: addition data frame, can also get plot summarizing enrichment results. API endpoint supports extensive customization plot; please refer rba_string_enrichment_image() function’s manual detailed instructions. perform enrichment analysis KEGG database, retrieve plot results. Visualization enrichment analysis results","code":"string_enrich <- rba_string_enrichment(ids = covid_critical, species = 9606 #Homo sapiens ) #> Performing functional enrichment of 1214 Input Identifiers. str(string_enrich, max.level = 1) #> List of 13 #> $ COMPARTMENTS :'data.frame': 18 obs. of 10 variables: #> $ Component :'data.frame': 19 obs. of 10 variables: #> $ DISEASES :'data.frame': 10 obs. of 10 variables: #> $ Function :'data.frame': 1 obs. of 10 variables: #> $ HPO :'data.frame': 3 obs. of 10 variables: #> $ KEGG :'data.frame': 6 obs. of 10 variables: #> $ Keyword :'data.frame': 18 obs. of 10 variables: #> $ NetworkNeighborAL:'data.frame': 46 obs. of 10 variables: #> $ PMID :'data.frame': 100 obs. of 10 variables: #> $ Process :'data.frame': 77 obs. of 10 variables: #> $ RCTM :'data.frame': 49 obs. of 10 variables: #> $ TISSUES :'data.frame': 14 obs. of 10 variables: #> $ WikiPathways :'data.frame': 3 obs. of 10 variables: string_annot <- rba_string_annotations(ids = \"CD177\", species = 9606, #Homo sapiens allow_pubmed = TRUE ) #> Retrieving functional annotations of 1 Input Identifiers. str(string_annot, max.level = 1) #> List of 13 #> $ COMPARTMENTS :'data.frame': 31 obs. of 8 variables: #> $ Component :'data.frame': 43 obs. of 8 variables: #> $ DISEASES :'data.frame': 6 obs. of 8 variables: #> $ Function :'data.frame': 9 obs. of 8 variables: #> $ HPO :'data.frame': 8 obs. of 8 variables: #> $ InterPro :'data.frame': 2 obs. of 8 variables: #> $ Keyword :'data.frame': 13 obs. of 8 variables: #> $ NetworkNeighborAL:'data.frame': 5 obs. of 8 variables: #> $ Pfam :'data.frame': 1 obs. of 8 variables: #> $ PMID :'data.frame': 2453 obs. of 8 variables: #> $ Process :'data.frame': 92 obs. of 8 variables: #> $ RCTM :'data.frame': 7 obs. of 8 variables: #> $ TISSUES :'data.frame': 13 obs. of 8 variables: graph_3 <- rba_string_enrichment_image(ids = covid_critical, species = 9606, category = \"KEGG\", image_format = \"image\", save_image = FALSE, group_by_similarity = 0.6)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"mieaa","dir":"Articles","previous_headings":"","what":"miEAA","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"miRNA Enrichment Analysis Annotation Tool (miEAA) service provided Chair Clinical Bioinformatics Saarland University. makes miEAA unique among services presented miEAA curates miRNA sets. Hence can directly perform miRNA enrichment analysis across various species services miEAA provides. -depth covered performing enrichment analysis miEAA vignette article “miEEA & rbioapii”. Therefore, provide brief demonstration . can use covid_critical gene list . rather use miRNA list paper “. Parray et al.: Vaccines 9, 1056 (2021)”. used microarray find differentially expressed miRNA severe versus mild COVID 19 patients’ blood. necessary, can first see enrichment categories available mature human miRNA: Next, use wrapper function available perform necessary steps one function call. Note supplied categories parameter. left NULL, enrichment performed every available category.","code":"covid_mirna <- c(\"hsa-miR-3609\", \"hsa-miR-199a-5p\", \"hsa-miR-139-5p\", \"hsa-miR-145-5p\",\"hsa-miR-3651\", \"hsa-miR-1273h-3p\", \"hsa-miR-4632-5p\",\"hsa-miR-6861-5p\", \"hsa-miR-6802-5p\",\"hsa-miR-5196-5p\",\"hsa-miR-92b-5p\", \"hsa-miR-6805-5p\",\"hsa-miR-98-5p\",\"hsa-miR-3185\", \"hsa-miR-572\",\"hsa-miR-371b-5p\",\"hsa-miR-3180\", \"hsa-miR-8073\",\"hsa-miR-4750-5p\",\"hsa-miR-6075\", \"hsa-let-7i-5p\",\"hsa-miR-1231\",\"hsa-miR-885-3p\") rba_mieaa_cats(mirna_type = \"mature\", species = 9606 #Homo sapiens ) #> Retrieving available enrichment categories of miRNA for Homo sapiens. #> Annotations derived over miRTarBase (Gene Ontology) #> \"GO_Annotations_indirect_mature\" #> Annotation (Gene Ontology) #> \"GO_Annotations_mature\" #> Pathways (KEGG) #> \"KEGG_mature\" #> exRNA forms (miRandola) #> \"miRandola_mature\" #> Chromosomal location (miRBase) #> \"miRBase_Chromosomes_mature\" #> Conservation (miRBase) #> \"miRBase_Conserved_miRNAs_5_organisms_mature\" #> Confidence (miRBase) #> \"miRBase_High_confidence_mature\" #> Seed family (miRBase) #> \"miRBase_Seed_family_mature\" #> GO Biological process (miRPathDB) #> \"miRPathDB_GO_Biological_process_mature\" #> GO Cellular component (miRPathDB) #> \"miRPathDB_GO_Cellular_component_mature\" #> GO Molecular function (miRPathDB) #> \"miRPathDB_GO_Molecular_function_mature\" #> KEGG (miRPathDB) #> \"miRPathDB_KEGG_mature\" #> Reactome (miRPathDB) #> \"miRPathDB_Reactome_mature\" #> WikiPathways (miRPathDB) #> \"miRPathDB_WikiPathways_mature\" #> Target genes (miRTarBase) #> \"miRTarBase_mature\" #> Diseases (miRWalk) #> \"miRWalk_Diseases_mature\" #> Gene Ontology (miRWalk) #> \"miRWalk_GO_mature\" #> Organs (miRWalk) #> \"miRWalk_Organs_mature\" #> Pathways (miRWalk) #> \"miRWalk_Pathways_mature\" #> Diseases (MNDR) #> \"MNDR_mature\" #> Interactions (NPInter) #> \"NPInter_mature\" #> Gender/Age #> \"Published_Age_gender_mature\" #> Cell-type specific (Atlas) #> \"Published_cell_specific_mature\" #> Cell-type specific (Cellular microRNAome) #> \"miRNAome_mature\" #> Published Diseases #> \"Published_Diseases_mature\" #> Immune cells #> \"Published_Immune_cells_mature\" #> Localization (RNALocate) #> \"RNALocate_mature\" #> Drugs (SM2miR) #> \"SM2miR_mature\" #> Expressed in tissue (Tissue Atlas) #> \"TissueAtlas_mature\" #> Tissue specific (isomiRdb) #> \"isomiRdb_tissue_specific_mature\" #> High confidence (MirGeneDB) #> \"MirGeneDB_High_confidence_mature\" #> isomiRs (isomiRdb) #> \"isomiRdb_mature\" mieaa_enrich <- rba_mieaa_enrich(test_set = covid_mirna, mirna_type = \"mature\", test_type = \"ORA\", species = 9606, categories = \"miRPathDB_GO_Biological_process_mature\") #> -- Step 1/3: Submitting Enrichment analysis request: #> Submitting ORA enrichment request for 23 miRNA IDs of species Homo sapiens to miEAA servers. #> #> -- Step 2/3: Checking for Submitted enrichment analysis's status every 5 seconds. #> Your submitted job ID is: 8b096cba-37e5-40e6-bdfb-833dae4a6a6a #> . #> #> -- Step 3/3: Retrieving the results. #> Retrieving results of submitted enrichment request with ID: 8b096cba-37e5-40e6-bdfb-833dae4a6a6a"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"how-to-cite","dir":"Articles","previous_headings":"","what":"How to cite?","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"rbioapi interface databases services. Thus, used rbioapi published research, kindly addition citing rbioapi, make sure fully properly cite databases/services used. Suggested citations added functions’ manuals, “references” section; Nevertheless, user’s responsibility check proper citations properly cite database/services used. Please see rbioapi’s main vignette article details.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_do_enrich.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"3.A: Do with rbioapi: Enrichment (Over-Representation) Analysis in R","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] httr_1.4.7 cli_3.6.3 knitr_1.49 rlang_1.1.4 #> [5] xfun_0.49 png_0.1-8 textshaping_0.4.1 jsonlite_1.8.9 #> [9] DT_0.33 htmltools_0.5.8.1 ragg_1.3.3 sass_0.4.9 #> [13] rmarkdown_2.29 grid_4.4.2 crosstalk_1.2.1 evaluate_1.0.1 #> [17] jquerylib_0.1.4 fastmap_1.2.0 yaml_2.3.10 lifecycle_1.0.4 #> [21] compiler_4.4.2 fs_1.6.5 htmlwidgets_1.6.4 systemfonts_1.1.0 #> [25] digest_0.6.37 R6_2.5.1 curl_6.0.1 magrittr_2.0.3 #> [29] bslib_0.8.0 tools_4.4.2 pkgdown_2.1.1 cachem_1.1.0 #> [33] desc_1.4.3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.A: Enrichr & rbioapi","text":"Enrichr popular gene-set enrichment analysis tool developed Ma’ayan Lab.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"gene-set-library-concept-in-enrichr","dir":"Articles","previous_headings":"","what":"Gene set library concept in Enrichr","title":"2.A: Enrichr & rbioapi","text":"Directly quoting Enrichr’s help page: gene set library set related gene sets enrichment terms […] libraries constructed many sources published studies major biological biomedical online databases. Others created available Enrichr. (source: https://maayanlab.cloud/Enrichr/help#background) get list available libraries Enrichr, use: returned data frame, can find names available Enrichr libraries “libraryName” column. see following sections, can use names request enrichment analysis based selected library libraries.","code":"enrichr_libs <- rba_enrichr_libs()"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"enrichment-analysis-using-enrichr","dir":"Articles","previous_headings":"","what":"Enrichment analysis using Enrichr","title":"2.A: Enrichr & rbioapi","text":"perform enrichment analysis gene-set Enrichr using rbioapi, can take two approaches. begin simple one. first, create vector genes’ NCBI IDs use input example article.","code":"# Create a vector with our genes' NCBI IDs genes <- c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\",\"CDK1\",\"KIF23\",\"PLK1\", \"RAC2\",\"RACGAP1\",\"RHOA\",\"RHOB\", \"PHF14\", \"RBM3\", \"MSL1\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"approach-1-using-the-wrapper-function","dir":"Articles","previous_headings":"Enrichment analysis using Enrichr","what":"Approach 1: Using the one-step Wrapper function","title":"2.A: Enrichr & rbioapi","text":"required input function simply supply gene-set character vector. Optionally can also select one libraries. Please see rba_enrichr() function’s manual details arguments. Note default value argument gene_set_library rba_enrichr function “”. means call function , Enrichr libraries used enrichment analysis uploaded gene list. case, named list, elements dataframe containing genes’ analysis results using Enrichr library. Alternatively, can use gene_set_library argument specify library (libraries) use. demonstrate using “MSigDB_Hallmark_2020” library: supplying gene_set_library argument, rbioapi assumes entering regex pattern. can disable setting regex_library_name FALSE. However, feature useful need -example- partial matches library names. Suppose want perform enrichment analysis every library available Enrichr contains name “MSig”. can following: Note one Enrichr library selected, data frame enrichment analysis result returned. multiple libraries selected, function’s output list element data frame corresponding one selected libraries.","code":"# Request the enrichment analysis results_all <- rba_enrichr(gene_list = genes) # Request the enrichment analysis by a specific library results_msig_hallmark <- rba_enrichr(gene_list = genes, gene_set_library = \"MSigDB_Hallmark_2020\") # Request the enrichment analysis results_msig <- rba_enrichr(gene_list = genes, gene_set_library = \"msig\", regex_library_name = TRUE) #> | | | 0% | |======================= | 33% | |=============================================== | 67% | |======================================================================| 100% # You can drop `regex_library_name = TRUE`, as it is TRUE by default. str(results_msig_hallmark) #> 'data.frame': 18 obs. of 9 variables: #> $ Term : chr \"Mitotic Spindle\" \"G2-M Checkpoint\" \"E2F Targets\" \"Apoptosis\" ... #> $ Overlap : chr \"5/199\" \"4/200\" \"4/200\" \"3/161\" ... #> $ P.value : num 2.57e-07 1.22e-05 1.22e-05 2.17e-04 2.74e-03 ... #> $ Adjusted.P.value : num 4.62e-06 7.29e-05 7.29e-05 9.76e-04 9.87e-03 ... #> $ Old.P.value : int 0 0 0 0 0 0 0 0 0 0 ... #> $ Old.Adjusted.P.value: int 0 0 0 0 0 0 0 0 0 0 ... #> $ Odds.Ratio : num 51 36.7 36.7 31.4 29.7 ... #> $ Combined.Score : num 774 416 416 265 175 ... #> $ Genes : chr \"CDC42;RACGAP1;PLK1;CDK1;KIF23\" \"RACGAP1;PLK1;CDK1;KIF23\" \"RACGAP1;PLK1;CDK1;BRCA1\" \"CDK2;BRCA1;RHOB\" ... str(results_msig, 1) #> List of 3 #> $ MSigDB_Computational :'data.frame': 195 obs. of 9 variables: #> $ MSigDB_Oncogenic_Signatures:'data.frame': 26 obs. of 9 variables: #> $ MSigDB_Hallmark_2020 :'data.frame': 18 obs. of 9 variables:"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"approach-2-going-step-by-step","dir":"Articles","previous_headings":"Enrichment analysis using Enrichr","what":"Approach 2: Going step-by-step","title":"2.A: Enrichr & rbioapi","text":"rba_enrichr() wrapper function. internally executes sequence functions necessary run analysis. Alternatively, go step step. demonstrate steps section. First, need retrieve list available Enrichr libraries. step optional. can skip already know name desired libraries want run analysis every available library. Now, need upload genes list Enrichr. , identifier assigned submitted list, needed next step. returned response, need numeric ID “userListId” element. Finally, ready submit enrichment analysis request Enrichr. explained wrapper function rba_enrichr(), can supply “gene_set_library” argument different ways. select “Table_Mining_of_CRISPR_Studies” library:","code":"# Get a list of available Enrichr libraries libs <- rba_enrichr_libs(store_in_options = TRUE) # Submit your gene-set to enrichr list_id <- rba_enrichr_add_list(gene_list = genes) str(list_id) #> List of 2 #> $ shortId : chr \"ac4e54ca49e721981e2aa81ee1c0df82\" #> $ userListId: int 87054434 # Request the analysis results_crispr <- rba_enrichr_enrich(user_list_id = list_id$userListId, gene_set_library = \"Table_Mining_of_CRISPR_Studies\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"other-species","dir":"Articles","previous_headings":"","what":"Working with Other Species","title":"2.A: Enrichr & rbioapi","text":"Enrichr also provides libraries model organisms. following functions organism argument allows perform analysis species humans: rba_enrichr() rba_enrichr_enrich() rba_enrichr_gene_map() rba_enrichr_libs() available options organism argument human”, (H. sapiens & M. musculus), fly” (D. melanogaster), “yeast” (S. cerevisiae), “worm” (C. elegans), “fish” (D. rerio).","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"background-gene-list","dir":"Articles","previous_headings":"","what":"Providing background gene list","title":"2.A: Enrichr & rbioapi","text":"human mouse, Enrichr also support use background gene list. background gene list used compute results statistics. using one-step wrapper rba_enrichr() (Approach 1), Everything handled hood; simply supply background gene background_genes parameter. choose follow step--step approach, please note Enrichr relies API back-end called speedrichr handle analysis background gene list. Therefore, performing analysis background gene list, must explicitly upload target gene list speedrichr. . Later steps automatically interact speedrichr long relevant parameters background genes specified.","code":"# Assume we have the background genes in the variable my_background_genes results_msig <- rba_enrichr(gene_list = genes, background_genes = my_background_genes, regex_library_name = TRUE) # Create a vector with our genes' NCBI IDs genes <- c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\",\"CDK1\",\"KIF23\",\"PLK1\", \"RAC2\",\"RACGAP1\",\"RHOA\",\"RHOB\", \"PHF14\", \"RBM3\", \"MSL1\") # Step 1: Upload the target gene list to speedrichr # Note: Ensure `speedrichr = TRUE` is specified. Otherwise, it will not be # possible to use the background gene list later. list_id_spdr <- rba_enrichr_add_list(gene_list = genes, speedrichr = TRUE) # Step 2: Upload the background gene list # Assume we have the background genes in the variable my_background_genes background_id <- rba_enrichr_add_background(background_genes = my_background_genes) # Step 3: Submit the enrichment analysis and retrieve the results go_results <- rba_enrichr_enrich(user_list_id = list_id_spdr$userListId, background_id = background_id$backgroundid, gene_set_library = \"GO\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"see-also-in-functions-manuals","dir":"Articles","previous_headings":"","what":"See also in Functions’ manuals","title":"2.A: Enrichr & rbioapi","text":"rbioapi Enrichr functions covered vignette, sure check manuals: rba_enrichr_gene_map() rba_enrichr_view_list()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.A: Enrichr & rbioapi","text":"cite Enrichr (Please see https://maayanlab.cloud/Enrichr/help#terms): Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"other-services","dir":"Articles","previous_headings":"","what":"Over-representation analysis Using Other Services","title":"2.A: Enrichr & rbioapi","text":"services supported rbioapi also provide -representation analysis tools. Please see vignette article rbioapi: -Representation (Enrichment) Analysis R (link documentation site) -depth review.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.A: Enrichr & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_enrichr.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.A: Enrichr & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] httr_1.4.7 cli_3.6.3 knitr_1.49 rlang_1.1.4 #> [5] xfun_0.49 textshaping_0.4.1 jsonlite_1.8.9 DT_0.33 #> [9] htmltools_0.5.8.1 ragg_1.3.3 sass_0.4.9 rmarkdown_2.29 #> [13] crosstalk_1.2.1 evaluate_1.0.1 jquerylib_0.1.4 fastmap_1.2.0 #> [17] yaml_2.3.10 lifecycle_1.0.4 compiler_4.4.2 fs_1.6.5 #> [21] htmlwidgets_1.6.4 systemfonts_1.1.0 digest_0.6.37 R6_2.5.1 #> [25] curl_6.0.1 magrittr_2.0.3 bslib_0.8.0 tools_4.4.2 #> [29] pkgdown_2.1.1 cachem_1.1.0 desc_1.4.3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.B: JASPAR & rbioapi","text":"Directly quoting Fornes O, Castro-Mondragon JA, Khan , et al: JASPAR (https://jaspar.elixir.) open-access database curated, non-redundant transcription factor (TF)-binding profiles stored position frequency matrices (PFMs) TFs across multiple species six taxonomic groups. 8th release JASPAR, CORE collection expanded 245 new PFMs (169 vertebrates, 42 plants, 17 nematodes, 10 insects, 7 fungi), 156 PFMs updated (125 vertebrates, 28 plants 3 insects). new profiles represent 18% expansion compared previous release. source: Fornes O, Castro-Mondragon JA, Khan , et al. JASPAR 2020: update open-access database transcription factor binding profiles. Nucleic Acids Res. 2019; doi: 10.1093/nar/gkz1001","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"data-organization-in-jaspar","dir":"Articles","previous_headings":"","what":"Data Organization in JASPAR","title":"2.B: JASPAR & rbioapi","text":"JASPAR database transcription factor binding matrices annotations metadata. entities organized hierarchical fashion explore next.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"releases","dir":"Articles","previous_headings":"Data Organization in JASPAR","what":"Releases","title":"2.B: JASPAR & rbioapi","text":"addition latest JASPAR database release (2020), active releases also available. rbioapi JASPAR functions release argument allows use database releases.","code":"## Call the function without any arguments to get a list of releases releases <- rba_jaspar_releases() ## Supply a release number for details: release_7_info <- rba_jaspar_releases(7)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"collections","dir":"Articles","previous_headings":"Data Organization in JASPAR","what":"Collections","title":"2.B: JASPAR & rbioapi","text":"Within release, Matrix profiles organized collections, can use rba_jaspar_collections() get list available collections, read “JASPAR Collections” section documentation page JASPAR web-site thorough review.","code":"## To get a list of available collection in release 2020: rba_jaspar_collections(release = 2020) #> name url #> 1 CORE https://jaspar.elixir.no/api/v1/collections/CORE/ #> 2 UNVALIDATED https://jaspar.elixir.no/api/v1/collections/UNVALIDATED/ ## You can list information of all matrices available in a collection: mat_in_core_2020 <- rba_jaspar_collections_matrices(collection = \"CORE\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"taxonomic-groups","dir":"Articles","previous_headings":"Data Organization in JASPAR","what":"Taxonomic Groups","title":"2.B: JASPAR & rbioapi","text":"Within collection, matrix profiles organized based main taxonomic groups:","code":"## To get a list of taxonomic groups in release 2020: rba_jaspar_taxons(release = 2020) #> name url #> 1 plants https://jaspar.elixir.no/api/v1/taxon/plants/ #> 2 vertebrates https://jaspar.elixir.no/api/v1/taxon/vertebrates/ #> 3 insects https://jaspar.elixir.no/api/v1/taxon/insects/ #> 4 urochordates https://jaspar.elixir.no/api/v1/taxon/urochordates/ #> 5 nematodes https://jaspar.elixir.no/api/v1/taxon/nematodes/ #> 6 fungi https://jaspar.elixir.no/api/v1/taxon/fungi/ #> 7 diatoms https://jaspar.elixir.no/api/v1/taxon/diatoms/ #> 8 trematodes https://jaspar.elixir.no/api/v1/taxon/trematodes/ #> 9 dictyostelium https://jaspar.elixir.no/api/v1/taxon/dictyostelium/ #> 10 cnidaria https://jaspar.elixir.no/api/v1/taxon/cnidaria/ #> 11 oomycota https://jaspar.elixir.no/api/v1/taxon/oomycota/ ## You can list information of all matrices available in a taxonomic group: mat_in_insects <- rba_jaspar_taxons_matrices(tax_group = \"insects\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"species","dir":"Articles","previous_headings":"Data Organization in JASPAR","what":"Species","title":"2.B: JASPAR & rbioapi","text":"go data organization hierarchy, taxonomic group consist species:","code":"## To get a list of species in release 2020: species <- rba_jaspar_species(release = 2020) head(species) #> tax_id species #> 1 5037 Ajellomyces capsulatus #> 2 4151 Antirrhinum majus #> 3 81972 Arabidopsis lyrata subsp. lyrata #> 4 3702 Arabidopsis thaliana #> 5 9913 Bos taurus #> 6 6238 Caenorhabditis briggsae #> url #> 1 https://jaspar.elixir.no/api/v1/species/5037/ #> 2 https://jaspar.elixir.no/api/v1/species/4151/ #> 3 https://jaspar.elixir.no/api/v1/species/81972/ #> 4 https://jaspar.elixir.no/api/v1/species/3702/ #> 5 https://jaspar.elixir.no/api/v1/species/9913/ #> 6 https://jaspar.elixir.no/api/v1/species/6238/ #> matrix_url #> 1 https://jaspar.elixir.no/api/v1/species/5037/ #> 2 https://jaspar.elixir.no/api/v1/species/4151/ #> 3 https://jaspar.elixir.no/api/v1/species/81972/ #> 4 https://jaspar.elixir.no/api/v1/species/3702/ #> 5 https://jaspar.elixir.no/api/v1/species/9913/ #> 6 https://jaspar.elixir.no/api/v1/species/6238/ ## You can list information of all matrices available in a specie: mat_in_human <- rba_jaspar_species_matrices(tax_id = 9606)"},{"path":[]},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"search-matrix-profiles","dir":"Articles","previous_headings":"Matrix Profiles","what":"Search Matrix Profiles","title":"2.B: JASPAR & rbioapi","text":"Retrieving list every matrix available given category option. can also build search query using rba_jaspar_matrix_search. Note search function, required fill every argument. may use combination arguments see fit build query. can even call function without argument get list matrix profiles. instance:","code":"## Get a list of all the available matrix profile: all_matrices <- rba_jaspar_matrix_search() ## Search FOX: FOX_matrices <- rba_jaspar_matrix_search(term = \"FOX\") ## Transcription factors named FOXP3 FOXP3_matrices <- rba_jaspar_matrix_search(term = \"FOXP3\") ## Transcription factors of Zipper-Type Class zipper_matrices <- rba_jaspar_matrix_search(tf_class = \"Zipper-Type\") ## Transcription factors of Zipper-Type Class in PBM collection zipper_pbm_matrices <- rba_jaspar_matrix_search(tf_class = \"Zipper-Type\", collection = \"PBM\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"list-matrix-profiles-associated-to-a-base-identifier","dir":"Articles","previous_headings":"Matrix Profiles","what":"List Matrix Profiles Associated to a Base identifier","title":"2.B: JASPAR & rbioapi","text":"Since JASPAR release 2010, matrix profiles versioned. matrix profile Identifier “base_id.version” naming schema; example “MA0600.2” corresponds second version matrix base ID MA0600. can Use rba_jaspar_matrix_versions get list matrix profiles given base ID. Also note functions, generally used list available matrices, argument called only_last_version.","code":"## Get matrix profiles versions associated to a base id MA0600_versions <- rba_jaspar_matrix_versions(\"MA0600\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"get-a-matrix-profile","dir":"Articles","previous_headings":"Matrix Profiles","what":"Get a Matrix Profile","title":"2.B: JASPAR & rbioapi","text":"Now listed searched matrix profiles, can use rba_jaspar_matrix retrieve matrix profiles. two ways can use function:","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"get-matrix-and-annotations-as-an-r-object","dir":"Articles","previous_headings":"Matrix Profiles > Get a Matrix Profile","what":"Get Matrix and Annotations as an R Object","title":"2.B: JASPAR & rbioapi","text":", fill matrix_id argument rba_jaspar_matrix","code":"pfm_matrix <- rba_jaspar_matrix(matrix_id = \"MA0600.2\") ## you can find the matrix in the pfm element along with ## other elements which correspond to annotations and details str(pfm_matrix) #> List of 24 #> $ matrix_id : chr \"MA0600.2\" #> $ name : chr \"RFX2\" #> $ base_id : chr \"MA0600\" #> $ version : int 2 #> $ collection : chr \"CORE\" #> $ sequence_logo: chr \"https://jaspar.elixir.no/static/logos/svg/MA0600.2.svg\" #> $ versions_url : chr \"https://jaspar.elixir.no/api/v1/matrix/MA0600/versions\" #> $ sites_url : NULL #> $ pfm : num [1:4, 1:16] 1381 5653 4042 2336 270 ... #> ..- attr(*, \"dimnames\")=List of 2 #> .. ..$ : chr [1:4] \"A\" \"C\" \"G\" \"T\" #> .. ..$ : NULL #> $ class : chr \"Fork head/winged helix factors\" #> $ family : chr \"RFX-related factors\" #> $ tfe_id : list() #> $ medline : chr \"8754849\" #> $ pazar_tf_id : list() #> $ remap_tf_name: chr \"RFX2\" #> $ source : chr \"23332764\" #> $ tax_group : chr \"vertebrates\" #> $ type : chr \"HT-SELEX\" #> $ tfe_ids : list() #> $ pubmed_ids : chr \"8754849\" #> $ pazar_tf_ids : list() #> $ uniprot_ids : chr \"P48378\" #> $ species :'data.frame': 1 obs. of 2 variables: #> ..$ tax_id: int 9606 #> ..$ name : chr \"Homo sapiens\" #> $ tffm :List of 7 #> ..$ tffm_id : chr \"TFFM0576.1\" #> ..$ base_id : chr \"TFFM0576\" #> ..$ version : int 1 #> ..$ log_p_1st_order: num 6275 #> ..$ log_p_detailed : num 6660 #> ..$ experiment_name: chr \"CistromeDB_58298\" #> ..$ tffm_url : chr \"https://jaspar.elixir.no/api/v1/tffm/TFFM0576.1/\""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"save-a-matrix-a-file-in-specific-format","dir":"Articles","previous_headings":"Matrix Profiles > Get a Matrix Profile","what":"Save a Matrix a File in Specific Format","title":"2.B: JASPAR & rbioapi","text":"JASPAR provides position frequency matrices (PFM) formatted Raw PFM, JASPAR, TRANSFAC, YAML, MEME. can download matrix profile file formats. , use file_format save_to arguments available rba_jaspar_matrix. two notes : case, function save matrix file returns un-parsed content file character string. save_to argument function, fact rbioapi function can used many ways: 2.1. save_to = NA: rbioapi automatically generate file path working directory, save file path , informs message. 2.2 save_to = file_name without path: rbioapi save file supplied name working directory. 2.3. save_to = directory path (without file): rbioapi save file proper name directory. 2.4. save_to = file path (.e. ending .extension): rbioapi save file exactly path. Make sure file extension path matches requested file format. case, rbioapi save file extension supplied path, issues warning inform . aforementioned cases, file path can absolute relative.","code":"## Different wqays in which you can save the matrix file: meme_matrix1 <- rba_jaspar_matrix(matrix_id = \"MA0600.2\", file_format = \"meme\") meme_matrix2 <- rba_jaspar_matrix(matrix_id = \"MA0600.2\", file_format = \"meme\", save_to = \"my_matrix.meme\") meme_matrix3 <- rba_jaspar_matrix(matrix_id = \"MA0600.2\", file_format = \"meme\", save_to = \"c:/rbioapi\") meme_matrix4 <- rba_jaspar_matrix(matrix_id = \"MA0600.2\", file_format = \"meme\", save_to = \"c:/rbioapi/my_matrix.meme\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"get-binding-sites-of-a-matrix-profiles","dir":"Articles","previous_headings":"Matrix Profiles","what":"Get Binding Sites of a Matrix Profiles","title":"2.B: JASPAR & rbioapi","text":"available, can retrieve information binding sites associated matrix profile. information includes data frame genomic coordination binding site, URL FASTA BED files, along annotations.","code":"## Get binding site of a matrix profile: binding_sites <- rba_jaspar_sites(matrix_id = \"MA0600.2\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"tf-flexible-models-tffms","dir":"Articles","previous_headings":"","what":"TF flexible models (TFFMs)","title":"2.B: JASPAR & rbioapi","text":"JASPAR also stores assigns identifiers TF flexible models (TFFMs). Just like PFM (position frequency matrices), can search TFFMs retrieve information annotations using TFFM Identifier. TFFM IDs versioned, meaning base_id.version format.","code":"## Search TFFMs. This is a search function. Thus, what has been presented ## in `Search Matrix Profiles` section also applies here: ## Get a list of all the available matrix profile: all_tffms <- rba_jaspar_tffm_search() ## Search FOX: FOX_tffms <- rba_jaspar_tffm_search(term = \"FOX\") ## Transcription factors named FOXP3 FOXP3_tffms <- rba_jaspar_tffm_search(term = \"FOXP3\") ## Transcription factors of insects taxonomic group insects_tffms <- rba_jaspar_tffm_search(tax_group = \"insects\") ## Now that you have a TFFM ID, you can retrieve it TFFM0056 <- rba_jaspar_tffm(\"TFFM0056.3\") str(TFFM0056) #> List of 10 #> $ tffm_id : chr \"TFFM0056.3\" #> $ base_id : chr \"TFFM0056\" #> $ version : int 3 #> $ matrix_base_id : chr \"MA0039\" #> $ matrix_id : chr \"MA0039.4\" #> $ matrix_url : chr \"https://jaspar.elixir.no/api/v1/matrix/MA0039.4/\" #> $ matrix_version : int 4 #> $ experiment_name: chr \"CistromeDB_33718\" #> $ first_order :List of 5 #> ..$ log_p : num 7420 #> ..$ dense_logo : chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_first_order_trained_dense_logo.svg\" #> ..$ summary_logo: chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_first_order_trained_summary_logo.svg\" #> ..$ hits : chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_first_order_trained.hits.svg\" #> ..$ xml : chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_first_order_trained.xml\" #> $ detailed :List of 5 #> ..$ log_p : num 6854 #> ..$ dense_logo : chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_detailed_trained_dense_logo.svg\" #> ..$ summary_logo: chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_detailed_trained_summary_logo.svg\" #> ..$ hits : chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_detailed_trained.hits.svg\" #> ..$ xml : chr \"https://jaspar.elixir.no/static/TFFM/TFFM0056.3/TFFM_detailed_trained.xml\""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.B: JASPAR & rbioapi","text":"cite JASPAR (Please see https://jaspar.elixir./faq/): Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; https://doi.org/10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, https://doi.org/10.1093/bioinformatics/btx804 cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.B: JASPAR & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_jaspar.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.B: JASPAR & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] digest_0.6.37 desc_1.4.3 R6_2.5.1 fastmap_1.2.0 #> [5] xfun_0.49 cachem_1.1.0 knitr_1.49 htmltools_0.5.8.1 #> [9] rmarkdown_2.29 lifecycle_1.0.4 cli_3.6.3 sass_0.4.9 #> [13] pkgdown_2.1.1 textshaping_0.4.1 jquerylib_0.1.4 systemfonts_1.1.0 #> [17] compiler_4.4.2 httr_1.4.7 tools_4.4.2 ragg_1.3.3 #> [21] curl_6.0.1 evaluate_1.0.1 bslib_0.8.0 yaml_2.3.10 #> [25] jsonlite_1.8.9 rlang_1.1.4 fs_1.6.5 htmlwidgets_1.6.4"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.C: miEEA & rbioapi","text":"miRNA Enrichment Analysis Annotation Tool (miEAA) service provided Chair Clinical Bioinformatics Saarland University. Basically, miEAA multi-species microRNA enrichment analysis tool. information, see website published paper.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"first-find-enrichment-categories","dir":"Articles","previous_headings":"","what":"First, find enrichment categories","title":"2.C: miEEA & rbioapi","text":"Performing enrichment analysis miRNA set, note based input miRNA type (either mature precursor, mixture !) species, different sets supported enrichment categories. Thus, recommended retrieve list possible enrichment categories may use:","code":"## A list of available enrichment categories for: ## mature human miRNA: rba_mieaa_cats(mirna_type = \"mature\", species = 9606) ## precursor human miRNA rba_mieaa_cats(mirna_type = \"precursor\", species = 9606) ## precursor zebrafish miRNA rba_mieaa_cats(mirna_type = \"mature\", species = \"Danio rerio\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"submit-enrichment-analysis-request-to-mieaa","dir":"Articles","previous_headings":"","what":"Submit Enrichment analysis request to miEAA","title":"2.C: miEEA & rbioapi","text":"two approaches , start simpler one.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"approach-1-using-the-wrapper-function","dir":"Articles","previous_headings":"Submit Enrichment analysis request to miEAA","what":"Approach 1: Using the Wrapper function","title":"2.C: miEEA & rbioapi","text":"Just fill arguments rba_mieaa_enrich() according function’s manual; can see function’s arguments, lot controls enrichment request, need provide test_set, mirna_type, test_type, species:","code":"## 1 We create a variable with our miRNAs' mature IDs mirs <- c(\"hsa-miR-20b-5p\", \"hsa-miR-144-5p\", \"hsa-miR-17-5p\", \"hsa-miR-20a-5p\", \"hsa-miR-222-3p\", \"hsa-miR-106a-5p\", \"hsa-miR-93-5p\", \"hsa-miR-126-3p\", \"hsa-miR-363-3p\", \"hsa-miR-302c-3p\", \"hsa-miR-374b-5p\", \"hsa-miR-18a-5p\", \"hsa-miR-548d-3p\", \"hsa-miR-135a-3p\", \"hsa-miR-558\", \"hsa-miR-130b-5p\", \"hsa-miR-148a-3p\") ## 2a We can perform enrichment analysis on our miRNA set without limiting the analysis to any categories mieaa_all <- rba_mieaa_enrich(test_set = mirs, mirna_type = \"mature\", test_type = \"ORA\", species = 9606) #> -- Step 1/3: Submitting Enrichment analysis request: #> No categories were supplied, Requesting enrichment using all of the 32 available categories for species 'Homo sapiens'. #> Submitting ORA enrichment request for 17 miRNA IDs of species Homo sapiens to miEAA servers. #> #> -- Step 2/3: Checking for Submitted enrichment analysis's status every 5 seconds. #> Your submitted job ID is: ec6d5db3-184a-4af2-9c6f-ea6b6e9dedaf #> ........ #> #> -- Step 3/3: Retrieving the results. #> Retrieving results of submitted enrichment request with ID: ec6d5db3-184a-4af2-9c6f-ea6b6e9dedaf ## 2b Or, We can limit the enrichment to certain datasets (enrichment categories) mieaa_kegg <- rba_mieaa_enrich(test_set = mirs, mirna_type = \"mature\", test_type = \"ORA\", species = 9606, categories = \"KEGG_mature\" ) #> -- Step 1/3: Submitting Enrichment analysis request: #> Submitting ORA enrichment request for 17 miRNA IDs of species Homo sapiens to miEAA servers. #> #> -- Step 2/3: Checking for Submitted enrichment analysis's status every 5 seconds. #> Your submitted job ID is: 46a665b6-1561-42b8-8e28-225b744d0f06 #> . #> #> -- Step 3/3: Retrieving the results. #> Retrieving results of submitted enrichment request with ID: 46a665b6-1561-42b8-8e28-225b744d0f06"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"approach-2-going-step-by-step","dir":"Articles","previous_headings":"Submit Enrichment analysis request to miEAA","what":"Approach 2: Going step-by-step","title":"2.C: miEEA & rbioapi","text":"stated , rba_mieaa_enrich() wrapper function, meaning executes following sequence functions: Please Note: services supported rbioapi also provide -representation analysis tools. Please see vignette article rbioapi: -Representation (Enrichment) Analysis R (link documentation site) -depth review.","code":"## 1 Submit enrichment request to miEAA request <- rba_mieaa_enrich_submit(test_set = mirs, mirna_type = \"mature\", test_type = \"ORA\", species = 9606, categories = c(\"miRWalk_Diseases_mature\", \"miRWalk_Organs_mature\") ) ## 2 check for job's running status rba_mieaa_enrich_status(job_id = request$job_id) ## 3 If the job has completed, retrieve the results results <- rba_mieaa_enrich_results(job_id = request$job_id)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"convert-mirna-accessions","dir":"Articles","previous_headings":"","what":"Convert miRNA accessions","title":"2.C: miEEA & rbioapi","text":"miEAA recognizes miRBASE version 22 accessions. can use rba_mieaa_convert_version() convert miRNA accession different miRBASE versions. Also, stated , miEAA differentiate precursor mature miRNA accessions, convert 2 accession types, use rba_mieaa_convert_type().","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.C: miEEA & rbioapi","text":"cite miEAA (Please see https://ccb-compute2.cs.uni-saarland.de/mieaa2/): Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig, Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.C: miEEA & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_mieaa.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.C: miEEA & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] httr_1.4.7 cli_3.6.3 knitr_1.49 rlang_1.1.4 #> [5] xfun_0.49 textshaping_0.4.1 jsonlite_1.8.9 DT_0.33 #> [9] htmltools_0.5.8.1 ragg_1.3.3 sass_0.4.9 rmarkdown_2.29 #> [13] crosstalk_1.2.1 evaluate_1.0.1 jquerylib_0.1.4 fastmap_1.2.0 #> [17] yaml_2.3.10 lifecycle_1.0.4 compiler_4.4.2 fs_1.6.5 #> [21] htmlwidgets_1.6.4 systemfonts_1.1.0 digest_0.6.37 R6_2.5.1 #> [25] curl_6.0.1 magrittr_2.0.3 bslib_0.8.0 tools_4.4.2 #> [29] pkgdown_2.1.1 cachem_1.1.0 desc_1.4.3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.D: PANTHER & rbioapi","text":"Directly quoting paper published PANTHER (Protein Analysis Evolutionary Relationships) authors: PANTHER classification system (https://www.pantherdb.org) comprehensive system combines genomes, gene function , pathways statistical analysis tools enable analyze large-scale genome-wide experimental data. system (PANTHER v.14.0) covers 131 complete genomes organized gene families subfamilies; evolutionary relationships represented phylogenetic trees, multiple sequence statistical models (hidden Markov models (HMMs)). families subfamilies annotated Gene Ontology (GO) terms, sequences assigned PANTHER pathways. suite tools built allow users browse query gene functions analyze-scale experimental data number statistical tests. widely used bench scientists, bioinformaticians, computer systems biologists. (source: Mi, Huaiyu, et al. “Protocol Update large-scale genome gene function analysis PANTHER classification system (v. 14.0).” Nature protocols 14.3 (2019): 703-721) available tools PANTHER’s RESTful API services can divided 3 broad categories: Mapping genes, retrieving information, research tools. Herein, provide short introduction; can always check functions’ manuals detailed guides examples.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"map-genes","dir":"Articles","previous_headings":"","what":"Map genes","title":"2.D: PANTHER & rbioapi","text":"rba_panther_mapping(): map gene-set PANTHER database retrieve attributes annotations associated genes rba_panther_ortholog(): Retrieve Orthologs genes rba_panther_homolog(): Retrieve Homologs genes","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"get-information","dir":"Articles","previous_headings":"","what":"Get information","title":"2.D: PANTHER & rbioapi","text":"rba_panther_info(): Retrieve list PANTHER’s supported organisms, datasets, families, pathways rba_panther_family(): Retrieve Orthologs, MSA, Tree topology given PANTHER family.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"gene-list-analysis","dir":"Articles","previous_headings":"","what":"Gene List Analysis","title":"2.D: PANTHER & rbioapi","text":"rba_panther_enrich() equivalent Gene List analysis tool’s webpage. Depending provided input’s class, PANTHER perform either -representation analysis statistical enrichment analysis. demonstrate perform analyses.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"analysis-get-available-annotation-datasets","dir":"Articles","previous_headings":"Gene List Analysis","what":"Get the available annotation datasets","title":"2.D: PANTHER & rbioapi","text":"First, need select annotation dataset conduct analysis based . annotation dataset contains collection terms, term associated group genes. retrieve list available annotation datasets PANTHER, use following command: Please note use ID desired annotation dataset, label. example, using \"biological_process\" incorrect; rather use \"GO:0008150\".","code":"annots <- rba_panther_info(what = \"datasets\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"submit-the-analysis-request","dir":"Articles","previous_headings":"Gene List Analysis","what":"Submit the analysis request","title":"2.D: PANTHER & rbioapi","text":"Depending provided input, PANTHER conduct two types analysis: character vector supplied, -representation analysis performed using either Fisher’s exact binomial test. data frame gene identifiers corresponding expression values supplied, statistical enrichment test performed using Mann-Whitney U (Wilcoxon Rank-Sum) test. rbioapi determines proper analysis based class genes parameter. Please refer details section rba_panther_enrich() function manual information.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"over-representation-analysis","dir":"Articles","previous_headings":"Gene List Analysis > Submit the analysis request","what":"Over-representation analysis","title":"2.D: PANTHER & rbioapi","text":"Now, suppose want perform -representation analysis ‘GO biological process’ annotation dataset. example, provide gene names, thus -representation analysis conducted:","code":"# Create a variable to store the genes vector my_genes_vec <- c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\", \"CDK1\",\"KIF23\",\"PLK1\", \"RAC2\",\"RACGAP1\",\"RHOA\", \"RHOB\", \"PHF14\", \"RBM3\", \"MSL1\") # Submit the analysis request. enriched <- rba_panther_enrich(genes = my_genes_vec, organism = 9606, annot_dataset = \"GO:0008150\", cutoff = 0.05) #> Performing PANTHER over-representation analysis (Fisher's exact test) on 15 genes from `organism 9606` against `GO:0008150` datasets. # Note that we didn't supply the `test_type` parameter. # In this case, the function will default to using Fisher's exact test # (i.e. `test_type = \"FISHER\"`). # You may also use binomial test for the over-representation analysis # (i.e. `test_type = \"BINOMIAL\"`)."},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"statistical-enrichment-analysis","dir":"Articles","previous_headings":"Gene List Analysis > Submit the analysis request","what":"Statistical enrichment analysis","title":"2.D: PANTHER & rbioapi","text":"can see example, vector gene names used. can also use corresponding expression values genes. case, PANTHER perform statistical enrichment analysis. , change supply data frame genes parameter. Note case, Mann-Whitney U Test performed. data frame two columns: first column contain gene identifiers character vector; second column contain corresponding expression values numeric vector. Please Note: services supported rbioapi also provide -representation analysis tools. Please see vignette article rbioapi: -Representation (Enrichment) Analysis R (link documentation site) -depth review.","code":"# Create a variable to store the data frame my_genes_df <- data.frame( genes = c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\", \"CDK1\",\"KIF23\",\"PLK1\", \"RAC2\",\"RACGAP1\",\"RHOA\", \"RHOB\", \"PHF14\", \"RBM3\", \"MSL1\"), ## generate random expression values expression = runif(15, 0, 10) ) # Submit the analysis request. enriched <- rba_panther_enrich(genes = my_genes_df, organism = 9606, annot_dataset = \"GO:0008150\", cutoff = 0.05) # Note that we didn't supply the `test_type` parameter. # In this case, the function will default to Mann-Whitney U Test # (i.e. `test_type = \"Mann-Whitney\"`). # This is the only valid value for the statistical enrichment analysis test, # thus ommiting or supplying it will not make a difference."},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"tree-grafter","dir":"Articles","previous_headings":"","what":"Tree grafter","title":"2.D: PANTHER & rbioapi","text":"rba_panther_tree_grafter() equivalent “Graft sequence PANTHER library trees” tool.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.D: PANTHER & rbioapi","text":"cite PANTHER (Please see https://www.pantherdb.org/publications.jsp#HowToCitePANTHER): Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.D: PANTHER & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_panther.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.D: PANTHER & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] httr_1.4.7 cli_3.6.3 knitr_1.49 rlang_1.1.4 #> [5] xfun_0.49 textshaping_0.4.1 jsonlite_1.8.9 DT_0.33 #> [9] htmltools_0.5.8.1 ragg_1.3.3 sass_0.4.9 rmarkdown_2.29 #> [13] crosstalk_1.2.1 evaluate_1.0.1 jquerylib_0.1.4 fastmap_1.2.0 #> [17] yaml_2.3.10 lifecycle_1.0.4 compiler_4.4.2 fs_1.6.5 #> [21] htmlwidgets_1.6.4 systemfonts_1.1.0 digest_0.6.37 R6_2.5.1 #> [25] curl_6.0.1 magrittr_2.0.3 bslib_0.8.0 tools_4.4.2 #> [29] pkgdown_2.1.1 cachem_1.1.0 desc_1.4.3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.E: Reactome & rbioapi","text":"Directly quoting Reactome: REACTOME open-source, open access, manually curated peer-reviewed pathway database. goal provide intuitive bioinformatics tools visualization, interpretation analysis pathway knowledge support basic clinical research, genome analysis, modeling, systems biology education. Founded 2003, Reactome project led Lincoln Stein OICR, Peter D’Eustachio NYULMC, Henning Hermjakob EMBL-EBI, Guanming Wu OHSU. (source: https://reactome.org/--reactome) Reactome provides two RESTful API services: Reactome content services Reactome analysis services. rbioapi, naming schema function belongs analysis services starts rba_reactome_analysis* . rba_reactome_* functions without ‘analysis’ infix correspond content services API. continuing reading article, good idea read Reactome Data Model page.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"reactome-analysis-services","dir":"Articles","previous_headings":"","what":"Reactome analysis services","title":"2.E: Reactome & rbioapi","text":"section mostly revolves around rba_reactome_analysis() function. , naturally, start . explained function’s manual, considerable freedom providing main input function; can supply R object (data frame, matrix, simple vector), URL, local file path. Note type analysis decided based whether input 1-dimensional 2-dimensional. explained detail manual rba_reactome_analysis(), see information.rba_reactome_analysis() API equivalent Reactome’s analyse gene list tool. can see function’s arguments correspond choose webpage’s wizard. mentioned, rba_reactome_analysis()’s arguments correspond wizard analyse gene list tool; arguments corresponds contents “Filter results” tab results page. analysis’s token, can retrieve analysis results many formats using rba_reactome_analysis_pdf() rba_reactome_analysis_download(): token guaranteed stored 7 days. , can upload JSON file downloaded using rba_reactome_analysis_download get token : Please Note: services supported rbioapi also provide -representation analysis tools. Please see vignette article rbioapi: -Representation (Enrichment) Analysis R (link documentation site) -depth review.","code":"## 1 We create a simple vector with our genes genes <- c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\", \"CDK1\", \"KIF23\", \"PLK1\", \"RAC2\", \"RACGAP1\", \"RHOA\", \"RHOB\", \"MSL1\", \"PHF21A\", \"INSR\", \"JADE2\", \"P2RX7\", \"CCDC101\", \"PPM1B\", \"ANAPC16\", \"CDH8\", \"HSPA1L\", \"CUL2\", \"ZNF302\", \"CUX1\", \"CYTH2\", \"SEC22C\", \"EIF4E3\", \"ROBO2\", \"CXXC1\", \"LINC01314\", \"ATP5F1\") ## 2 We call reactome analysis with the default parameters analyzed <- rba_reactome_analysis(input = genes, projection = TRUE, p_value = 0.01) ## 3 As always, we use str() to inspect the resutls str(analyzed, 1) #> List of 8 #> $ summary :List of 7 #> $ expression :List of 1 #> $ identifiersNotFound: int 1 #> $ pathwaysFound : int 82 #> $ pathways :'data.frame': 82 obs. of 19 variables: #> $ resourceSummary :'data.frame': 3 obs. of 3 variables: #> $ speciesSummary :'data.frame': 1 obs. of 5 variables: #> $ warnings : list() ## 4 Note that in the summary element: (analyzed$summary) ### 4.a because we supplied a simple vector, the analysis type was: over-representation ### 4.b You need the token for other rba_reactome_analysis_* functions ## 5 Analsis results are in the pathways data frame: # download a full pdf report rba_reactome_analysis_pdf(token = analyzed$summary$token, species = 9606) # download the result in compressed json.gz format rba_reactome_analysis_download(token = analyzed$summary$token, request = \"results\", save_to = \"reactome_results.json\") re_uploaded <- rba_reactome_analysis_import(input = \"reactome_results.json\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"analysis_see-also-in-functions-manuals","dir":"Articles","previous_headings":"Reactome analysis services","what":"See also in Functions’ manuals","title":"2.E: Reactome & rbioapi","text":"rbioapi Reactome analysis functions covered vignette, sure check manuals: rba_reactome_analysis_mapping() rba_reactome_analysis_species() rba_reactome_analysis_token()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"reactome-contents-services","dir":"Articles","previous_headings":"","what":"Reactome contents services","title":"2.E: Reactome & rbioapi","text":"rbioapi functions correspond Reactome content services starting rba_reactome_* without “_analysis” infix. functions cover can objects Reactome knowledge-base. simpler terms, -- correspond can find Reactome Pathway Browser search results. (e.g. pathway, reaction, physical Entity, etc.)","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"retrieve-any-object-from-reactome-knowledge-base","dir":"Articles","previous_headings":"Reactome contents services","what":"Retrieve any object from Reactome knowledge-base","title":"2.E: Reactome & rbioapi","text":"Using rba_reactome_query(), can retrieve object Reactome knowledge-base. simpler terms, mean object roughly anything Reactome associated ID . can range person’s entry proteins, reactions, pathways, species, many ! can explore Reactome’s data schema learn Reactome knowledge-base objects organization. examples, note limited one ID per query. can use vector inputs, limitation supply one ID, enhanced = TRUE.","code":"## 1 query a pathway Entry pathway <- rba_reactome_query(ids = \"R-HSA-109581\", enhanced = TRUE) ## 2 As always we use str() to inspect the output's structure str(pathway, 2) #> List of 28 #> $ dbId : int 109581 #> $ displayName : chr \"Apoptosis\" #> $ stId : chr \"R-HSA-109581\" #> $ stIdVersion : chr \"R-HSA-109581.6\" #> $ created :List of 5 #> ..$ dbId : int 109608 #> ..$ displayName: chr \"Alnemri, E, Hengartner, Michael, Tschopp, Jürg, Tsujimoto, Yoshihide, Hardwick, JM, 2004-01-16\" #> ..$ dateTime : chr \"2004-01-16 21:01:51\" #> ..$ className : chr \"InstanceEdit\" #> ..$ schemaClass: chr \"InstanceEdit\" #> $ modified :List of 6 #> ..$ dbId : int 11015412 #> ..$ displayName: chr \"Weiser, Joel, 2024-11-17\" #> ..$ dateTime : chr \"2024-11-17 16:07:31\" #> ..$ note : chr \"Inserted by org.reactome.orthoinference\" #> ..$ className : chr \"InstanceEdit\" #> ..$ schemaClass: chr \"InstanceEdit\" #> $ isInDisease : logi FALSE #> $ isInferred : logi FALSE #> $ name :List of 1 #> ..$ : chr \"Apoptosis\" #> $ releaseDate : chr \"2004-09-20\" #> $ speciesName : chr \"Homo sapiens\" #> $ authored :List of 1 #> ..$ : int 109608 #> $ edited :List of 1 #> ..$ :List of 5 #> $ figure :List of 1 #> ..$ :List of 5 #> $ goBiologicalProcess:List of 9 #> ..$ dbId : int 2273 #> ..$ displayName : chr \"apoptotic process\" #> ..$ accession : chr \"0006915\" #> ..$ databaseName: chr \"GO\" #> ..$ definition : chr \"A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external sig\"| __truncated__ #> ..$ name : chr \"apoptotic process\" #> ..$ url : chr \"https://www.ebi.ac.uk/QuickGO/term/GO:0006915\" #> ..$ className : chr \"GO_BiologicalProcess\" #> ..$ schemaClass : chr \"GO_BiologicalProcess\" #> $ literatureReference:List of 7 #> ..$ :List of 11 #> ..$ :List of 11 #> ..$ :List of 11 #> ..$ :List of 11 #> ..$ :List of 11 #> ..$ :List of 11 #> ..$ :List of 11 #> $ orthologousEvent :List of 14 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> ..$ :List of 15 #> $ reviewed :List of 1 #> ..$ :List of 5 #> $ species :List of 1 #> ..$ :List of 8 #> $ summation :List of 1 #> ..$ :List of 5 #> $ reviewStatus :List of 6 #> ..$ dbId : int 9821382 #> ..$ displayName: chr \"five stars\" #> ..$ definition : chr \"externally reviewed\" #> ..$ name :List of 1 #> ..$ className : chr \"ReviewStatus\" #> ..$ schemaClass: chr \"ReviewStatus\" #> $ updateTrackers :List of 22 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> ..$ :List of 6 #> $ hasDiagram : logi TRUE #> $ hasEHLD : logi TRUE #> $ lastUpdatedDate : chr \"2022-06-09\" #> $ hasEvent :List of 4 #> ..$ :List of 16 #> ..$ :List of 17 #> ..$ :List of 17 #> ..$ :List of 16 #> $ schemaClass : chr \"Pathway\" #> $ className : chr \"Pathway\" ## 3 You can compare it with the webpage of R-HSA-202939 entry: # https://reactome.org/content/detail/R-HSA-202939 ## 1 query a protein Entry protein <- rba_reactome_query(ids = 66247, enhanced = TRUE) ## 2 As always we use str() to inspect the output's structure str(protein, 1) #> List of 27 #> $ dbId : int 66247 #> $ displayName : chr \"UniProt:P25942-1 CD40\" #> $ modified :List of 6 #> $ databaseName : chr \"UniProt\" #> $ identifier : chr \"P25942\" #> $ name :List of 1 #> $ otherIdentifier :List of 119 #> $ url : chr \"http://purl.uniprot.org/uniprot/P25942-1\" #> $ crossReference :List of 29 #> $ referenceDatabase :List of 8 #> $ physicalEntity :List of 1 #> $ checksum : chr \"BC8776EC2C4A5680\" #> $ comment :List of 1 #> $ description :List of 1 #> $ geneName :List of 2 #> $ isSequenceChanged : logi FALSE #> $ keyword :List of 17 #> $ secondaryIdentifier:List of 8 #> $ sequenceLength : int 277 #> $ species : int 48887 #> $ chain :List of 2 #> $ referenceGene :List of 11 #> $ referenceTranscript:List of 4 #> $ variantIdentifier : chr \"P25942-1\" #> $ isoformParent :List of 1 #> $ className : chr \"ReferenceIsoform\" #> $ schemaClass : chr \"ReferenceIsoform\" ## 3 You can compare it with the webpage of R-HSA-202939 entry: # https://reactome.org/content/detail/R-HSA-202939"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"find-cross-reference-ids-in-reactome","dir":"Articles","previous_headings":"Reactome contents services","what":"Find Cross-Reference IDs in Reactome","title":"2.E: Reactome & rbioapi","text":"can see second example usage used Reactome’s dbID 66247 query CD40 protein. obtain first place? can use rba_reactome_xref map cross-reference (external) IDs Reactome IDs.","code":"## 1 We Supply HGNC ID to find what is the corresponding database ID in Reactome xref_protein <- rba_reactome_xref(\"CD40\") ## 2 As always use str() to inspect the output's structure str(xref_protein, 1) #> List of 19 #> $ dbId : int 66247 #> $ displayName : chr \"UniProt:P25942-1 CD40\" #> $ databaseName : chr \"UniProt\" #> $ identifier : chr \"P25942\" #> $ name :List of 1 #> $ otherIdentifier :List of 1 #> $ url : chr \"http://purl.uniprot.org/uniprot/P25942-1\" #> $ checksum : chr \"BC8776EC2C4A5680\" #> $ comment :List of 1 #> $ description :List of 1 #> $ geneName :List of 1 #> $ isSequenceChanged : logi FALSE #> $ keyword :List of 1 #> $ secondaryIdentifier:List of 1 #> $ sequenceLength : int 277 #> $ chain :List of 1 #> $ variantIdentifier : chr \"P25942-1\" #> $ className : chr \"ReferenceIsoform\" #> $ schemaClass : chr \"ReferenceIsoform\""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"map-cross-reference-ids-to-reactome","dir":"Articles","previous_headings":"Reactome contents services","what":"Map Cross-Reference IDs to Reactome","title":"2.E: Reactome & rbioapi","text":"cross-reference topic, another useful resource. Using rba_reactome_mapping can find Reactome pathways reactions include external ID:","code":"## 1 Again, consider CD40 protein: xref_mapping <- rba_reactome_mapping(id = \"CD40\", resource = \"hgnc\", map_to = \"pathways\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"see-also-in-functions-manuals","dir":"Articles","previous_headings":"","what":"See also in Functions’ manuals","title":"2.E: Reactome & rbioapi","text":"still rbioapi f Reactome content functions covered vignette. brief overview, see functions’ manual detailed guides examples.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"retrieve-reactome-database-information","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"Retrieve Reactome Database information","title":"2.E: Reactome & rbioapi","text":"rba_reactome_version(): Return current Reactome version rba_reactome_diseases(): Retrieve list disease annotated Reactome. rba_reactome_species(): Retrieve list species annotated Reactome.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"general-mapping-querying","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"General Mapping/Querying","title":"2.E: Reactome & rbioapi","text":"rba_reactome_query() rba_reactome_mapping() rba_reactome_xref()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"things-you-can-do-with-a-entities","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"Things you can do with a Entities","title":"2.E: Reactome & rbioapi","text":"reactome_complex_list(): Get list complexes molecule . rba_reactome_complex_subunits(): Get list subunits complex rba_reactome_participant_of(): Get list Reactome sets complexes entity (event, molecule, reaction, pathway etc.) participant . rba_reactome_entity_other_forms()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"things-you-can-do-with-events","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"Things you can do with Events","title":"2.E: Reactome & rbioapi","text":"rba_reactome_event_ancestors() rba_reactome_participants() rba_reactome_pathways_events() rba_reactome_event_ancestors() rba_reactome_orthology() rba_reactome_event_hierarchy(): Retrieve full event hierarchy species.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"pathways","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"Pathways","title":"2.E: Reactome & rbioapi","text":"rba_reactome_pathways_low() rba_reactome_pathways_events() rba_reactome_pathways_top()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"interactors","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"Interactors","title":"2.E: Reactome & rbioapi","text":"rba_reactome_interactors_psicquic() rba_reactome_interactors_static()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"peaple","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"People","title":"2.E: Reactome & rbioapi","text":"rba_reactome_people_name() rba_reactome_people_id()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"export-diagrams-and-events","dir":"Articles","previous_headings":"See also in Functions’ manuals","what":"Export diagrams and events","title":"2.E: Reactome & rbioapi","text":"rba_reactome_exporter_diagram() rba_reactome_exporter_overview() rba_reactome_exporter_reaction() rba_reactome_exporter_event()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.E: Reactome & rbioapi","text":"cite Reactome (Please see https://reactome.org/cite): Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Fabregat , Korninger F, Viteri G, Sidiropoulos K, Marin-Garcia P, Ping P, Wu G, Stein L, D’Eustachio P, Hermjakob H. Reactome graph database: Efficient access complex pathway data. PLoS Comput Biol. 2018 Jan 29;14(1):e1005968. doi: 10.1371/journal.pcbi.1005968. eCollection 2018 Jan. PubMed PMID: 29377902. Fabregat , Sidiropoulos K, Viteri G, Marin-Garcia P, Ping P, Stein L, D’Eustachio P, Hermjakob H. Reactome diagram viewer: data structures strategies boost performance. Bioinformatics. 2018 Apr 1;34(7):1208-1214. doi: 10.1093/bioinformatics/btx752. PubMed PMID: 29186351. Fabregat , Sidiropoulos K, Viteri G, Forner O, Marin-Garcia P, Arnau V, D’Eustachio P, Stein L, Hermjakob H. Reactome pathway analysis: high-performance -memory approach. BMC Bioinformatics. 2017 Mar 2;18(1):142. doi: 10.1186/s12859-017-1559-2. PubMed PMID: 28249561. Wu G, Haw R. Functional Interaction Network Construction Analysis Disease Discovery. Methods Mol Biol. 2017;1558:235-253. doi: 10.1007/978-1-4939-6783-4_11. PubMed PMID: 28150241. cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.E: Reactome & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_reactome.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.E: Reactome & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] httr_1.4.7 cli_3.6.3 knitr_1.49 rlang_1.1.4 #> [5] xfun_0.49 textshaping_0.4.1 jsonlite_1.8.9 DT_0.33 #> [9] htmltools_0.5.8.1 ragg_1.3.3 sass_0.4.9 rmarkdown_2.29 #> [13] crosstalk_1.2.1 evaluate_1.0.1 jquerylib_0.1.4 fastmap_1.2.0 #> [17] yaml_2.3.10 lifecycle_1.0.4 compiler_4.4.2 fs_1.6.5 #> [21] htmlwidgets_1.6.4 systemfonts_1.1.0 digest_0.6.37 R6_2.5.1 #> [25] curl_6.0.1 magrittr_2.0.3 bslib_0.8.0 tools_4.4.2 #> [29] pkgdown_2.1.1 cachem_1.1.0 desc_1.4.3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.F: STRING & rbioapi","text":"STRING comprehensive database protein-protein interactions (PPI) version 11.0, covers 24,584,628 proteins 5,090 organisms. Directly quoting paper: STRING database aims collect, score integrate publicly available sources protein–protein interaction information, complement computational predictions. goal achieve comprehensive objective global network, including direct (physical) well indirect (functional) interactions. (source: Szklarczyk, Damian, et al. “STRING v11: protein–protein association networks increased coverage, supporting functional discovery genome-wide experimental datasets.” Nucleic acids research 47.D1 (2019): D607-D613. )","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"note-about-species-argument","dir":"Articles","previous_headings":"","what":"Note about species argument","title":"2.F: STRING & rbioapi","text":"can find argument named “species” every rbioapi STRING function. Providing species argument mandatory, recommended STRING API’s documentation always specify species. exception input proteins’ vector length 100; cases, species argument required. Otherwise, calling function without providing species produce ERROR.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"map-your-ids-to-string-ids","dir":"Articles","previous_headings":"","what":"Map your IDs to STRING IDs","title":"2.F: STRING & rbioapi","text":"Although STRING API resources handle recognize variety identifiers, recommended first map IDs STRING IDs using rbioapi STRING functions.","code":"## 1 We create a variable with our genes' NCBI IDs proteins <- c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\",\"CDK1\",\"KIF23\", \"PLK1\",\"RAC2\",\"RACGAP1\",\"RHOA\",\"RHOB\", \"PHF14\", \"RBM3\") ## 2 Now we map our protein IDs proteins_mapped <- rba_string_map_ids(ids = proteins, species = 9606) ## 3 What we need and will use for the rest of this vignette is the `stringId` column"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"get-interaction-network-of-a-protein-set","dir":"Articles","previous_headings":"","what":"Get interaction network of a protein set","title":"2.F: STRING & rbioapi","text":"can retrieve list interactions proteins set along STRING annotations interaction. may filter results using required_score network_type arguments. See ‘values’ section rba_string_interactions_network function’s manual information returned columns.","code":"int_net <- rba_string_interactions_network(ids = proteins_mapped, species = 9606, required_score = 500)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"get-interaction-partners-of-a-protein-set","dir":"Articles","previous_headings":"","what":"Get interaction partners of a protein set","title":"2.F: STRING & rbioapi","text":"last example, obtained interaction proteins among , wanted get list every protein interact protein(s)? , can use rba_string_interaction_partners:","code":"## Although we supply only one protein ID here (CD40 protein), you can provide a vector of proteins as the input int_partners <- rba_string_interaction_partners(ids = \"9606.ENSP00000361359\", species = 9606, required_score = 900)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"get-network-image-of-a-protein-set","dir":"Articles","previous_headings":"","what":"Get network image of a protein set","title":"2.F: STRING & rbioapi","text":"Let’s go back interaction network. must seen STRING webpages, STRING plots interaction network proteins many customizations available. can also STRING API services. rba_string_network_image function flexible variety options; see function’s manual. Network images - Example 1 Network images - Example 2","code":"## Example 1: graph_1 <- rba_string_network_image(ids = proteins_mapped, image_format = \"image\", species = 9606, save_image = FALSE, required_score = 500, network_flavor = \"confidence\") ## Example 2: graph_2 <- rba_string_network_image(ids = proteins_mapped, image_format = \"image\", species = 9606, save_image = FALSE, required_score = 500, add_color_nodes = 5, add_white_nodes = 5, network_flavor = \"actions\")"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"enrichment-using-string","dir":"Articles","previous_headings":"","what":"Enrichment using STRING","title":"2.F: STRING & rbioapi","text":"STRING let perform two types enrichments. See STRING’s paper information.","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"functional-enrichment","dir":"Articles","previous_headings":"Enrichment using STRING","what":"Functional enrichment","title":"2.F: STRING & rbioapi","text":"first type conventional type, statistically tests supplied gene sets sets annotation. Currently, STRING supports Gene Ontology, KEGG pathways, UniProt Keywords, PubMed publications, Pfam domains, InterPro domains, SMART domains. (source). usual, inspect output using str() function. can see , enrichment results category can found returned list’s elements. Let us see “KEGG” results example. , can see terms KEGG pathways database -represented: Please Note: services supported rbioapi also provide -representation analysis tools. Please see vignette article rbioapi: -Representation (Enrichment) Analysis R (link documentation site) -depth review.","code":"enriched <- rba_string_enrichment(ids = proteins_mapped, species = 9606) str(enriched, max.level = 1) #> List of 14 #> $ COMPARTMENTS :'data.frame': 25 obs. of 10 variables: #> $ Component :'data.frame': 17 obs. of 10 variables: #> $ DISEASES :'data.frame': 11 obs. of 10 variables: #> $ Function :'data.frame': 12 obs. of 10 variables: #> $ InterPro :'data.frame': 3 obs. of 10 variables: #> $ KEGG :'data.frame': 45 obs. of 10 variables: #> $ Keyword :'data.frame': 14 obs. of 10 variables: #> $ NetworkNeighborAL:'data.frame': 5 obs. of 10 variables: #> $ PMID :'data.frame': 100 obs. of 10 variables: #> $ Process :'data.frame': 148 obs. of 10 variables: #> $ RCTM :'data.frame': 59 obs. of 10 variables: #> $ SMART :'data.frame': 1 obs. of 10 variables: #> $ TISSUES :'data.frame': 12 obs. of 10 variables: #> $ WikiPathways :'data.frame': 46 obs. of 10 variables:"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"functional-enrichment-plot","dir":"Articles","previous_headings":"Enrichment using STRING","what":"Functional enrichment Plot","title":"2.F: STRING & rbioapi","text":"addition data frame, can also get plot summarizing enrichment results. API endpoint supports extensive customization plot; please refer rba_string_enrichment_image() function’s manual detailed instructions. perform exact enrichment analysis done , retrieve plot results. Visualization enrichment analysis results","code":"graph_3 <- rba_string_enrichment_image(ids = proteins_mapped, species = 9606, category = \"KEGG\", image_format = \"image\", save_image = FALSE, group_by_similarity = 0.6)"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"protein-protein-interaction-enrichment","dir":"Articles","previous_headings":"Enrichment using STRING","what":"Protein-protein interaction enrichment","title":"2.F: STRING & rbioapi","text":"Even without incorporating annotation data, STRING can calculate proteins functionally related. Briefly, STRING accomplishes comparing interactions’ distribution protein-set interactions’ distribution proteome. Read STRING’s paper information.","code":"rba_string_enrichment_ppi(ids = proteins_mapped, species = 9606) #> $number_of_nodes #> [1] 14 #> #> $number_of_edges #> [1] 40 #> #> $average_node_degree #> [1] 5.71 #> #> $local_clustering_coefficient #> [1] 0.694 #> #> $expected_number_of_edges #> [1] 19 #> #> $p_value #> [1] 1.35e-05"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"get-functional-annotations","dir":"Articles","previous_headings":"","what":"Get functional annotations","title":"2.F: STRING & rbioapi","text":"seen , STRING maps proteins multiple annotation sources. can obtain annotation associated proteins without performing enrichment analysis retrieving just significant portion.","code":"annotations <- rba_string_annotations(ids = \"9606.ENSP00000269305\", species = 9606) ## This function returns large results, so the results was not shown in this vignette."},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"see-also-in-functions-manuals","dir":"Articles","previous_headings":"","what":"See also in Functions’ manuals","title":"2.F: STRING & rbioapi","text":"rbioapi STRING functions covered vignette, please check manuals: rba_string_homology_intra() rba_string_homology_inter() rba_string_version()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.F: STRING & rbioapi","text":"cite STRING (Please see https://string-db.org/cgi/?footer_active_subpage=references): Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.F: STRING & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_string.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.F: STRING & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] httr_1.4.7 cli_3.6.3 knitr_1.49 rlang_1.1.4 #> [5] xfun_0.49 png_0.1-8 textshaping_0.4.1 jsonlite_1.8.9 #> [9] DT_0.33 htmltools_0.5.8.1 ragg_1.3.3 sass_0.4.9 #> [13] rmarkdown_2.29 grid_4.4.2 crosstalk_1.2.1 evaluate_1.0.1 #> [17] jquerylib_0.1.4 fastmap_1.2.0 yaml_2.3.10 lifecycle_1.0.4 #> [21] compiler_4.4.2 fs_1.6.5 htmlwidgets_1.6.4 systemfonts_1.1.0 #> [25] digest_0.6.37 R6_2.5.1 curl_6.0.1 magrittr_2.0.3 #> [29] bslib_0.8.0 tools_4.4.2 pkgdown_2.1.1 cachem_1.1.0 #> [33] desc_1.4.3"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"introduction","dir":"Articles","previous_headings":"","what":"Introduction","title":"2.G: UniProt & rbioapi","text":"Directly quoting UniProt: Universal Protein Resource (UniProt) comprehensive resource protein sequence annotation data. UniProt databases UniProt Knowledgebase (UniProtKB), UniProt Reference Clusters (UniRef), UniProt Archive (UniParc). UniProt consortium host institutions EMBL-EBI, SIB PIR committed long-term preservation UniProt databases. (source: https://www.uniprot.org/help/)","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"search-vs-retrieve","dir":"Articles","previous_headings":"","what":"Search vs Retrieve","title":"2.G: UniProt & rbioapi","text":"rbioapi UniProt functions two variants. one retrieve data using proper accession, second one (_search suffix) search using combination arguments. first demonstrate using example, provide list functions rbioapi. Suppose interested Human CD40 ligand protein, know ’s UniProt accession “P29965”. can simply following: equivalent page UniProt accession (UniProtKB - P29965). didn’t know UniProt accession? simply want perform search using certain parameters? can use function _search suffix: equivalent ‘advanced search’ UniProt web portal. See function rba_uniprot_proteins_search’s manual information. Remember *_search functions, required fill every argument, can use combination arguments see fit build search query. applications *_search variants limited title ‘search’ implies. functions also retrieve search hits response; Thus can use mass-retrieving. see “argument” section functions’ manuals, see many arguments accept vector values. consider following examples:","code":"## 1 We can retrieve CD40 protein's information by qurying it's UniProt accession: cd40 <- rba_uniprot_proteins(accession = \"P29965\") ## 2 We use str() to inspect our object's structure str(cd40, 1) #> List of 13 #> $ accession : chr \"P29965\" #> $ id : chr \"CD40L_HUMAN\" #> $ proteinExistence: chr \"Evidence at protein level\" #> $ info :List of 4 #> $ organism :List of 3 #> $ protein :List of 4 #> $ gene :'data.frame': 1 obs. of 2 variables: #> $ comments :'data.frame': 12 obs. of 10 variables: #> $ features :'data.frame': 64 obs. of 9 variables: #> $ dbReferences :'data.frame': 133 obs. of 4 variables: #> $ keywords :'data.frame': 14 obs. of 1 variable: #> $ references :'data.frame': 25 obs. of 3 variables: #> $ sequence :List of 5 ## 1 From the available arguments, we fill only those which we think is pertinent cd40_search <- rba_uniprot_proteins_search(protein = \"CD40 ligand\", organism = \"human\", reviewed = TRUE) ## 2 As always, we use str() to inspect our object's structure str(cd40_search, 2) #> List of 1 #> $ P29965:List of 13 #> ..$ accession : chr \"P29965\" #> ..$ id : chr \"CD40L_HUMAN\" #> ..$ proteinExistence: chr \"Evidence at protein level\" #> ..$ info :List of 4 #> ..$ organism :List of 3 #> ..$ protein :List of 4 #> ..$ gene :List of 1 #> ..$ comments :List of 12 #> ..$ features :List of 64 #> ..$ dbReferences :List of 133 #> ..$ keywords :List of 14 #> ..$ references :List of 25 #> ..$ sequence :List of 5 ## 1 As the simplest scenario, we can retrieve multiple proteins in one call multi_prs1 <- rba_uniprot_proteins_search(accession = c(\"P04637\", \"P38398\", \"P24941\", \"P60953\", \"P06493\", \"Q02241\")) ## As always, we use str() to inspect our object's structure str(multi_prs1, 1) #> List of 6 #> $ P60953:List of 14 #> $ P24941:List of 14 #> $ P04637:List of 14 #> $ P06493:List of 14 #> $ Q02241:List of 14 #> $ P38398:List of 14 ## 2 Or alternatively, search using Gene names, also we want to exclude isoforms and only retrieve swiss-prot entries multi_prs2 <- rba_uniprot_proteins_search(gene = c(\"KIF23\", \"BRCA1\", \"TP53\", \"CDC42\"), reviewed = TRUE, taxid = 9606, isoform = 0) str(multi_prs2, 1) #> List of 29 #> $ Q9ULZ0:List of 14 #> $ Q02241:List of 14 #> $ P38398:List of 14 #> $ Q12888:List of 14 #> $ Q9HCN2:List of 14 #> $ P04637:List of 14 #> $ Q9Y2B4:List of 13 #> $ Q8IXH6:List of 14 #> $ Q53FA7:List of 14 #> $ A1A5B4:List of 14 #> $ Q9NS56:List of 14 #> $ Q96A56:List of 14 #> $ O14683:List of 14 #> $ Q96S44:List of 14 #> $ Q8NBR0:List of 14 #> $ Q13625:List of 14 #> $ Q7L0Q8:List of 14 #> $ Q5VT25:List of 14 #> $ Q9UKI2:List of 14 #> $ Q6NZY7:List of 14 #> $ Q00587:List of 14 #> $ O14613:List of 14 #> $ Q6DT37:List of 14 #> $ Q9H3Q1:List of 14 #> $ Q07960:List of 14 #> $ Q9NRR8:List of 14 #> $ Q9NRR3:List of 14 #> $ P60953:List of 14 #> $ Q9Y5S2:List of 14 ## 3 Search for every proteins with chemokines keyword multi_prs3 <- rba_uniprot_proteins_search(keyword = \"chemokines\") str(multi_prs3, 1) #> List of 17 #> $ P09703:List of 15 #> $ P0DTM9:List of 14 #> $ Q6SW98:List of 15 #> $ P33854:List of 14 #> $ P0DSV7:List of 15 #> $ P19063:List of 14 #> $ P16849:List of 15 #> $ P69332:List of 15 #> $ P24766:List of 15 #> $ Q98314:List of 15 #> $ P69333:List of 15 #> $ P07562:List of 14 #> $ F5HF62:List of 14 #> $ P34016:List of 14 #> $ P21064:List of 14 #> $ P0DSV8:List of 15 #> $ F5HBX1:List of 14 ## 4 Search for every protein of \"SARS-CoV-2\" virus in Swiss-Prot multi_prs4 <- rba_uniprot_proteins_search(organism = \"SARS-CoV-2\", reviewed = TRUE) str(multi_prs4, 1) #> List of 17 #> $ P0DTD3 :List of 14 #> $ P0DTC6 :List of 14 #> $ P0DTG0 :List of 13 #> $ P0DTC7 :List of 14 #> $ P0DTC2 :List of 14 #> $ P0DTC8 :List of 14 #> $ P0DTC4 :List of 14 #> $ A0A663DJA2:List of 14 #> $ P0DTC9 :List of 14 #> $ P0DTC5 :List of 14 #> $ P0DTC3 :List of 14 #> $ P0DTD8 :List of 14 #> $ P0DTD2 :List of 14 #> $ P0DTF1 :List of 13 #> $ P0DTD1 :List of 14 #> $ P0DTC1 :List of 13 #> $ P0DTG1 :List of 13"},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"functions-with-star-search-variant","dir":"Articles","previous_headings":"","what":"Functions with *_search variant","title":"2.G: UniProt & rbioapi","text":"search variants limited . list function retrieve search variants. See manuals detailed guides examples. rba_uniprot_proteins() & rba_uniprot_proteins_search() rba_uniprot_features() & rba_uniprot_features_search() rba_uniprot_variation() & rba_uniprot_variation_search() rba_uniprot_proteomics() & rba_uniprot_proteomics_search() rba_uniprot_antigens() & rba_uniprot_antigens_search() rba_uniprot_epitope() & rba_uniprot_epitope_search() rba_uniprot_rna_edit() & rba_uniprot_rna_edit_search() rba_uniprot_proteomes() & rba_uniprot_proteomes_search() rba_uniprot_ptm() & rba_uniprot_ptm_search() rba_uniprot_mutagenesis() & rba_uniprot_mutagenesis_search() rba_uniprot_proteomics_hpp() & rba_uniprot_proteomics_hpp_search() rba_uniprot_proteomics_non_ptm() & rba_uniprot_proteomics_non_ptm_search() rba_uniprot_proteomics_ptm() & rba_uniprot_proteomics_ptm_search() rba_uniprot_genecentric() & rba_uniprot_genecentric_search() rba_uniprot_uniparc() & rba_uniprot_uniparc_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"uniprot-functions-categories","dir":"Articles","previous_headings":"","what":"UniProt functions categories","title":"2.G: UniProt & rbioapi","text":"UniProt API endpoints organized 5 group. categories rbioapi functions correspond one. See functions’ manuals details.","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"proteins-proteins","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"Proteins:","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_proteins() rba_uniprot_proteins_search() rba_uniprot_proteins_crossref()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"proteins-features","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"Features","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_features() rba_uniprot_features_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"proteins-variation","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"Variation","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_variation() rba_uniprot_variation_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"antigens","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"Antigens","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_antigens() rba_uniprot_antigens_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"epitopes","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"Epitopes","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_epitope() rba_uniprot_epitope_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"mutagenesis","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"Mutagenesis","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_mutagenesis() rba_uniprot_mutagenesis_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"rna-editing","dir":"Articles","previous_headings":"UniProt functions categories > Proteins","what":"RNA-Editing","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_rna_edit() rba_uniprot_rna_edit_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"proteomics","dir":"Articles","previous_headings":"UniProt functions categories","what":"Proteomics","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_proteomics_species() rba_uniprot_proteomics_hpp() rba_uniprot_proteomics_hpp_search() rba_uniprot_proteomics_non_ptm() rba_uniprot_proteomics_non_ptm_search() rba_uniprot_proteomics_ptm() rba_uniprot_proteomics_ptm_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"proteomes","dir":"Articles","previous_headings":"UniProt functions categories","what":"Proteomes","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_proteomes() rba_uniprot_proteomes_search() rba_uniprot_genecentric() rba_uniprot_genecentric_search()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"taxonomy","dir":"Articles","previous_headings":"UniProt functions categories","what":"Taxonomy","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_taxonomy() rba_uniprot_taxonomy_lca() rba_uniprot_taxonomy_lineage() rba_uniprot_taxonomy_name() rba_uniprot_taxonomy_path() rba_uniprot_taxonomy_relationship()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"coordinates","dir":"Articles","previous_headings":"UniProt functions categories","what":"Coordinates","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_coordinates() rba_uniprot_coordinates_search() rba_uniprot_coordinates_location() rba_uniprot_coordinates_sequence() rba_uniprot_genome_coordinates_sequence()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"uniparc","dir":"Articles","previous_headings":"UniProt functions categories","what":"UniParc","title":"2.G: UniProt & rbioapi","text":"rba_uniprot_uniparc() rba_uniprot_uniparc_search() rba_uniprot_uniparc_bestguess() rba_uniprot_uniparc_sequence()","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"citations","dir":"Articles","previous_headings":"","what":"How to Cite?","title":"2.G: UniProt & rbioapi","text":"cite UniProt (Please see https://www.uniprot.org/help/publications): UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 cite rbioapi: Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"links","dir":"Articles","previous_headings":"","what":"Links","title":"2.G: UniProt & rbioapi","text":"article rbioapi documentation site Functions references rbioapi documentation site rbioapi vignette index","code":""},{"path":"https://rbioapi.moosa-r.com/articles/rbioapi_uniprot.html","id":"session-info","dir":"Articles","previous_headings":"","what":"Session info","title":"2.G: UniProt & rbioapi","text":"","code":"#> R version 4.4.2 (2024-10-31) #> Platform: x86_64-pc-linux-gnu #> Running under: Ubuntu 22.04.5 LTS #> #> Matrix products: default #> BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3 #> LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.20.so; LAPACK version 3.10.0 #> #> locale: #> [1] LC_CTYPE=C.UTF-8 LC_NUMERIC=C LC_TIME=C.UTF-8 #> [4] LC_COLLATE=C.UTF-8 LC_MONETARY=C.UTF-8 LC_MESSAGES=C.UTF-8 #> [7] LC_PAPER=C.UTF-8 LC_NAME=C LC_ADDRESS=C #> [10] LC_TELEPHONE=C LC_MEASUREMENT=C.UTF-8 LC_IDENTIFICATION=C #> #> time zone: UTC #> tzcode source: system (glibc) #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.8.1 #> #> loaded via a namespace (and not attached): #> [1] digest_0.6.37 desc_1.4.3 R6_2.5.1 fastmap_1.2.0 #> [5] xfun_0.49 cachem_1.1.0 knitr_1.49 htmltools_0.5.8.1 #> [9] rmarkdown_2.29 lifecycle_1.0.4 cli_3.6.3 sass_0.4.9 #> [13] pkgdown_2.1.1 textshaping_0.4.1 jquerylib_0.1.4 systemfonts_1.1.0 #> [17] compiler_4.4.2 httr_1.4.7 tools_4.4.2 ragg_1.3.3 #> [21] curl_6.0.1 evaluate_1.0.1 bslib_0.8.0 yaml_2.3.10 #> [25] jsonlite_1.8.9 rlang_1.1.4 fs_1.6.5 htmlwidgets_1.6.4"},{"path":"https://rbioapi.moosa-r.com/authors.html","id":null,"dir":"","previous_headings":"","what":"Authors","title":"Authors and Citation","text":"Moosa Rezwani. Author, maintainer.","code":""},{"path":"https://rbioapi.moosa-r.com/authors.html","id":"citation","dir":"","previous_headings":"","what":"Citation","title":"Authors and Citation","text":"Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":"@Article{, title = {rbioapi: User-Friendly R Interface to Biologic Web Services' API}, author = {Moosa Rezwani and Ali Akbar Pourfathollah and Farshid Noorbakhsh}, journal = {Bioinformatics}, volume = {38}, number = {10}, pages = {2952-2953}, year = {2022}, month = {03}, issn = {1367-4803}, doi = {10.1093/bioinformatics/btac172}, }"},{"path":"https://rbioapi.moosa-r.com/index.html","id":"rbioapi-user-friendly-r-interface-to-biologic-web-services-api","dir":"","previous_headings":"","what":"User-Friendly R Interface to Biologic Web Services' API","title":"User-Friendly R Interface to Biologic Web Services' API","text":"Moosa Rezwani 2023-07-27","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/index.html","id":"what-does-rbioapi-do","dir":"","previous_headings":"","what":"What does rbioapi do?","title":"User-Friendly R Interface to Biologic Web Services' API","text":"Currently fully supports Enrichr, JASPAR, miEAA, PANTHER, Reactome, STRING, UniProt! goal rbioapi provide user-friendly consistent interface biological databases services: way insulates user technicalities using web services API creates unified easy--use interface biological medical web services. rbioapi, need technical knowledge web services API learn work new package every biologic service database. ongoing project; New databases services added periodically. Feel free suggest databases services often use.","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"what-is-supported-by-rbioapi","dir":"","previous_headings":"","what":"What is Supported by rbioapi?","title":"User-Friendly R Interface to Biologic Web Services' API","text":"rbioapi dedicated Biological Medical databases web services. Currently, rbioapi supports covers every API resources following services: (alphabetical order): CRAN (Stable) version: (https://cran.r-project.org/package=rbioapi) Enrichr (rbioapi vignette article) (new) JASPAR (rbioapi vignette article) (new) miEAA (rbioapi vignette article) PANTHER (rbioapi vignette article) Reactome (rbioapi vignette article) STRING (rbioapi vignette article) UniProt (rbioapi vignette article) Github (Developmental) version: (https://github.com/moosa-r/rbioapi/): currently none services dedicated vignette article. However, article, write general framework rbioapi. Make sure check vignette article service learn use . Note : rbioapi ongoing project. New databases services implemented periodically order gradually make package comprehensive possible. see often using certain database/service? Feel free suggest database/service creating issue GitHub repository. appreciate suggestions.","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"how-to-install","dir":"","previous_headings":"","what":"How to install?","title":"User-Friendly R Interface to Biologic Web Services' API","text":"can install stable release version rbioapi CRAN : However, CRAN version released every 1-2 months, can install recent (development) version GitHub : Now, can load package:","code":"install.packages(\"rbioapi\") install.packages(\"remotes\") remotes::install_github(\"moosa-r/rbioapi\") library(rbioapi)"},{"path":"https://rbioapi.moosa-r.com/index.html","id":"naming-conventions","dir":"","previous_headings":"","what":"Naming conventions","title":"User-Friendly R Interface to Biologic Web Services' API","text":"make namespace organized, functions named following pattern: example, rba_string_version() call STRING’s version resource. Thus, version, rbioapi function one following naming schema: rba_enrichr_* rba_jaspar_* rba_mieaa_* rba_panther_* rba_reactome_* rba_string_* rba_uniprot_* three exceptions: rba_options(), rba_connection_test(), rba_pages(); helper functions. later.","code":"rba_[service_name]_[resource_name] rba_string_version() #> Retrieving the STRING database version and address used by rbioapi. #> $string_version #> [1] \"11.5\" #> #> $stable_address #> [1] \"https://version-11-5.string-db.org\""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"changing-the-options","dir":"","previous_headings":"","what":"Changing the options","title":"User-Friendly R Interface to Biologic Web Services' API","text":"provide control, multiple options implemented. See manual rba_options() function full description available options. short, options govern rbioapi’s connection servers (e.g. timeout, retry) options modify experience rbioapi (e.g. verbose, diagnostics, save_file). two ways may use change option. Also, can get table available rbioapi options current values calling rba_options()without argument: Now, let us consider ways can alter settings:","code":"rba_options() #> rbioapi_option current_value allowed_value #> 1 diagnostics FALSE Logical (TRUE/FALSE) #> 2 dir_name rbioapi Character #> 3 progress FALSE Logical (TRUE/FALSE) #> 4 retry_max 0 Numeric (0 or greater) #> 5 retry_wait 10 Numeric (0 or greater) #> 6 save_file FALSE Logical (TRUE/FALSE) #> 7 skip_error TRUE Logical (TRUE/FALSE) #> 8 timeout 30 Numeric (0.1 or greater) #> 9 verbose TRUE Logical (TRUE/FALSE)"},{"path":"https://rbioapi.moosa-r.com/index.html","id":"change-the-option-globally","dir":"","previous_headings":"","what":"Change the option globally","title":"User-Friendly R Interface to Biologic Web Services' API","text":"Changing option globally means rest R session, rbioapi function respect changed option. , use rba_options(). argument function corresponds certain option; Thus running function desired new values, globally alter rbioapi option. example:","code":"rba_options(save_file = TRUE) ## From now on, the raw file of server's response will be saved to your working directory. rba_options(verbose = FALSE) ## From now on, the package will be quiet."},{"path":"https://rbioapi.moosa-r.com/index.html","id":"change-the-option-only-within-a-function-call","dir":"","previous_headings":"","what":"Change the option only within a function call","title":"User-Friendly R Interface to Biologic Web Services' API","text":"can pass additional arguments rbioapi function using “ellipsis” (familiar … dot dot dot!). Meaning can call function additional arguments ‘option = value’ pair. way, changes options confined within particular function call. example:","code":"## Save the server's raw response file: x <- rba_reactome_species(only_main = TRUE, save_file = \"reactome_species.json\") ## Also, in the case of connection failure, retry up to 10 times: x <- rba_reactome_species(only_main = TRUE, save_file = \"reactome_species.json\", retry_max = 10) ## Run these codes in your own R session to see the difference. ## show internal diagnostics boring details x <- rba_uniprot_proteins_crossref(db_id = \"CD40\", db_name = \"HGNC\", diagnostics = TRUE) ## The next function you call, will still use the default rbioapi options x <- rba_uniprot_proteins_crossref(db_id = \"CD40\", db_name = \"HGNC\")"},{"path":"https://rbioapi.moosa-r.com/index.html","id":"connection-test","dir":"","previous_headings":"","what":"Connection test","title":"User-Friendly R Interface to Biologic Web Services' API","text":"second exception functions’ naming schema rba_connection_test(). Run simple function check connection supported services/databases. encounter errors using rbioapi, kindly run function make sure internet connection servers fine.","code":"rba_connection_test(print_output = TRUE) #> Checking Your connection to the Databases currently supported by rbioapi: #> --->>> Internet : #> +++ Connected to the Internet. #> --->>> Enrichr : #> +++ The server is responding. #> --->>> Ensembl : #> +++ The server is responding. #> --->>> JASPAR : #> +++ The server is responding. #> --->>> miEAA : #> +++ The server is responding. #> --->>> PANTHER : #> +++ The server is responding. #> --->>> Reactome Content Service : #> +++ The server is responding. #> --->>> Reactome Analysis Service : #> +++ The server is responding. #> --->>> STRING : #> +++ The server is responding. #> --->>> UniProt : #> +++ The server is responding."},{"path":"https://rbioapi.moosa-r.com/index.html","id":"iterating-over-paginated-results","dir":"","previous_headings":"","what":"Iterating over paginated results","title":"User-Friendly R Interface to Biologic Web Services' API","text":"API resources return paginated responses. particularly common API resources return potentially large responses. rbioapi, cases, arguments “page_number” (default value 1) -API resource allows- “page_size”. save time, may use rba_pages(). function iterate pages specified. Take rba_uniprot_taxonomy_name example. function allows search taxonomic nodes UniProt. response can potentially huge size, UniProt returns paginated response. example, search nodes contain “adenovirus”, large number hits: can see, server returned first page response, retrieve pages, make separate calls change “page_number” argument within call, simply use rba_pages() demonstrated : can see, done : Wrap function call qoute() enter input rba_pages(). Replace argument want iterate , string format: “pages:start:end”. example, supplied page_number = “pages:1:3” get responses pages 1 3.","code":"adeno <- rba_uniprot_taxonomy_name(name = \"adenovirus\", search_type = \"contain\", page_number = 1) str(adeno, max.level = 2) #> List of 2 #> $ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ taxonomyId : int [1:200] 10509 10510 10511 10512 10513 10514 10515 10519 10521 10522 ... #> ..$ mnemonic : chr [1:200] \"9ADEN\" \"ADEB3\" \"ADEB7\" \"9ADEN\" ... #> ..$ scientificName: chr [1:200] \"Mastadenovirus\" \"Bovine adenovirus B serotype 3\" \"Bovine adenovirus 7\" \"Canine adenovirus 1\" ... #> ..$ rank : chr [1:200] \"genus\" \"no rank\" \"no rank\" \"no rank\" ... #> ..$ superregnum : chr [1:200] \"V\" \"V\" \"V\" \"V\" ... #> ..$ hidden : logi [1:200] FALSE TRUE TRUE TRUE TRUE TRUE ... #> ..$ commonName : chr [1:200] NA \"BAdV-3\" \"BAdV-7\" NA ... #> ..$ synonym : chr [1:200] NA \"Mastadenovirus bos3\" NA NA ... #> $ pageInfo :List of 3 #> ..$ resultsPerPage: int 200 #> ..$ currentPage : int 1 #> ..$ totalRecords : int 985 adeno_pages = rba_pages(quote(rba_uniprot_taxonomy_name(name = \"adenovirus\", search_type = \"contain\", page_number = \"pages:1:3\"))) ## You can inspect the structure of the response: str(adeno_pages, max.level = 2) #> List of 3 #> $ page_1:List of 2 #> ..$ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ pageInfo :List of 3 #> $ page_2:List of 2 #> ..$ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ pageInfo :List of 3 #> $ page_3:List of 2 #> ..$ taxonomies:'data.frame': 200 obs. of 8 variables: #> ..$ pageInfo :List of 3"},{"path":"https://rbioapi.moosa-r.com/index.html","id":"how-and-what-to-cite","dir":"","previous_headings":"","what":"How and what to cite?","title":"User-Friendly R Interface to Biologic Web Services' API","text":"rbioapi interface databases services. Thus, used rbioapi published research, addition kindly citing rbioapi, make sure fully properly cite databases/services used. Suggested citations added functions’ manuals, “references” section; Nevertheless, user’s responsibility check proper citations properly cite database/services used.","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"how-to-cite-rbioapi","dir":"","previous_headings":"","what":"How to cite rbioapi","title":"User-Friendly R Interface to Biologic Web Services' API","text":"Moosa Rezwani, Ali Akbar Pourfathollah, Farshid Noorbakhsh, rbioapi: user-friendly R interface biologic web services’ API, Bioinformatics, Volume 38, Issue 10, 15 May 2022, Pages 2952–2953, https://doi.org/10.1093/bioinformatics/btac172","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"how-to-cite-the-databases-and-web-services","dir":"","previous_headings":"","what":"How to cite the databases and web services","title":"User-Friendly R Interface to Biologic Web Services' API","text":"cite Enrichr. (See Enrichr website) cite JASPAR. (See JASPAR website) cite miEAA. (See miEAA website) cite PANTHER. (See PANTHER website) cite Reactome. (See Reactome website) cite STRING. (See STRING website) cite UniProt. (See UniProt website)","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"code-of-conduct","dir":"","previous_headings":"","what":"Code of conduct","title":"User-Friendly R Interface to Biologic Web Services' API","text":"package, rbioapi, unofficial interface implementation associated, endorsed, officially connected way original databases web services. creators maintainers rbioapi independent entities official relationship databases web services. using rbioapi, remember querying data web services; please considerate. Never flood server requests, need download unreasonably large volumes data, directly downloading databases supplied services may better alternative. see rate-limited server (HTTP 429 Many Requests response status code), know sending requests server interprets normal behavior, please seek methods use Sys.sleep() requests.","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"what-next","dir":"","previous_headings":"","what":"What next?","title":"User-Friendly R Interface to Biologic Web Services' API","text":"supported service dedicated vignette article. Make sure check . Enrichr JASPAR miEAA PANTHER Reactome STRING UniProt also adding vignette articles focusing tasks workflows: rbioapi: Enrichment (-Representation) Analysis R","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"design-philosophy-of-rbioapi","dir":"","previous_headings":"","what":"Design philosophy of rbioapi","title":"User-Friendly R Interface to Biologic Web Services' API","text":"learn design philosophy concepts behind developing rbioapi, please read paper Bioinformatics: rbioapi: user-friendly R interface biologic web services’ API","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"links","dir":"","previous_headings":"","what":"Links","title":"User-Friendly R Interface to Biologic Web Services' API","text":"article rbioapi documentation site Functions references rbioapi documentation site","code":""},{"path":"https://rbioapi.moosa-r.com/index.html","id":"session-info","dir":"","previous_headings":"","what":"Session info","title":"User-Friendly R Interface to Biologic Web Services' API","text":"","code":"#> R version 4.3.1 (2023-06-16 ucrt) #> Platform: x86_64-w64-mingw32/x64 (64-bit) #> Running under: Windows 11 x64 (build 22621) #> #> Matrix products: default #> #> #> locale: #> [1] LC_COLLATE=English_United States.utf8 #> [2] LC_CTYPE=English_United States.utf8 #> [3] LC_MONETARY=English_United States.utf8 #> [4] LC_NUMERIC=C #> [5] LC_TIME=English_United States.utf8 #> #> time zone: Europe/Brussels #> tzcode source: internal #> #> attached base packages: #> [1] stats graphics grDevices utils datasets methods base #> #> other attached packages: #> [1] rbioapi_0.7.9 #> #> loaded via a namespace (and not attached): #> [1] digest_0.6.33 R6_2.5.1 fastmap_1.1.1 xfun_0.39 #> [5] knitr_1.43 htmltools_0.5.5 rmarkdown_2.23 cli_3.6.1 #> [9] compiler_4.3.1 httr_1.4.6 rstudioapi_0.15.0 tools_4.3.1 #> [13] curl_5.0.1 evaluate_0.21 yaml_2.3.7 rlang_1.1.1 #> [17] jsonlite_1.8.7"},{"path":"https://rbioapi.moosa-r.com/reference/rba_connection_test.html","id":null,"dir":"Reference","previous_headings":"","what":"Test if the Supported Services Are Responding — rba_connection_test","title":"Test if the Supported Services Are Responding — rba_connection_test","text":"Run function test internet connectivity device current status supported Services.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_connection_test.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Test if the Supported Services Are Responding — rba_connection_test","text":"","code":"rba_connection_test(print_output = TRUE, diagnostics = FALSE)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_connection_test.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Test if the Supported Services Are Responding — rba_connection_test","text":"print_output (Logical) (default = TRUE) Send tests' output console? diagnostics (Logical) (default = FALSE) Show diagnostics detailed messages internal information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_connection_test.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Test if the Supported Services Are Responding — rba_connection_test","text":"Connection test supported servers displayed console results invisibly returned list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_connection_test.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Test if the Supported Services Are Responding — rba_connection_test","text":"function attempts send simple query supported services. service successfully responded, informed success message; , content error reported . Please run function encounter errors using rbioapi. Also, need contact support, kindly call function 'diagnostic = TRUE' include output messages support request.","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_connection_test.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Test if the Supported Services Are Responding — rba_connection_test","text":"","code":"# \\donttest{ rba_connection_test() # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":null,"dir":"Reference","previous_headings":"","what":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"function provides convenient one-step wrapper performing enrichment analysis given gene list using Enrichr. simplifies process internally calling necessary functions correct order. See details section information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"","code":"rba_enrichr( gene_list, description = NULL, gene_set_library = \"all\", regex_library_name = TRUE, organism = \"human\", background_genes = NULL, progress_bar = TRUE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"gene_list character vector Entrez gene symbols test genes. description (optional) description associated uploaded gene-set Enrichr servers. gene_set_library One : \"\" select available Enrichr gene-set libraries. gene-set library name. can retrieve available options given species using rba_enrichr_libs. regex_library_name = TRUE, partially-matching name regex pattern correspond one Enrichr library names. regex_library_name logical: TRUE (default) supplied gene_set_library considered regex pattern. FALSE, gene_set_library considered exact match. organism (default = \"human\") model organism version Enrichr use? Available options : \"human\", (H. sapiens & M. musculus), \"fly\" (D. melanogaster), \"yeast\" (S. cerevisiae), \"worm\" (C. elegans) \"fish\" (D. rerio). background_genes character vector Entrez gene symbols background genes. progress_bar logical: (default = TRUE) multiple Enrichr libraries selected, progress bar displayed? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"list containing data frames enrichment results supplied gene-list selected Enrichr libraries.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"function call rba_enrichr_*** functions following order: (necessary) Call rba_enrichr_libs obtain list available libraries Enrichr given organism. Call rba_enrichr_add_list upload gene-list obtain 'user list ID'. (necessary) Call rba_enrichr_add_background upload background gene-list obtain 'background list ID'. Call rba_enrichr_enrich perform enrichment analysis gene-list one multiple Enrichr libraries","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"\"GET https://maayanlab.cloud/Enrichr/datasetStatistics\" \"POST https://maayanlab.cloud/Enrichr/addList\" \"POST https://maayanlab.cloud/speedrichr/api/addList\" \"POST https://maayanlab.cloud/speedrichr/api/addbackground\" \"GET https://maayanlab.cloud/Enrichr/enrich\" \"POST https://maayanlab.cloud/speedrichr/api/backgroundenrich\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"A One-step Wrapper for Gene-list Enrichment Using Enrichr — rba_enrichr","text":"","code":"if (FALSE) { # \\dontrun{ rba_enrichr(gene_list = c(\"TP53\", \"TNF\", \"EGFR\")) } # } # \\donttest{ rba_enrichr(gene_list = c(\"TP53\", \"TNF\", \"EGFR\"), gene_set_library = \"GO_Molecular_Function_2017\", regex_library_name = FALSE) # } # \\donttest{ rba_enrichr(gene_list = c(\"TP53\", \"TNF\", \"EGFR\"), gene_set_library = \"go\", regex_library_name = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":null,"dir":"Reference","previous_headings":"","what":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"addition main gene list, can also submit background gene list Enrichr. gene list can used later compute statistics enrichment analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"","code":"rba_enrichr_add_background(background_genes, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"background_genes character vector Entrez gene symbols background genes. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"list unique IDs uploaded background gene list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"Please note rba_enrichr provides one-step convenient way automatically handle required function calls needed perform gene set enrichment analysis Enrichr.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"\"POST https://maayanlab.cloud/speedrichr/api/addbackground\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_background.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Upload Background Gene-List to Enrichr — rba_enrichr_add_background","text":"","code":"# \\donttest{ my_background_genes <- c( \"NSUN3\", \"POLRMT\", \"NLRX1\", \"SFXN5\", \"ZC3H12C\", \"SLC25A39\", \"ARSG\", \"DEFB29\", \"PCMTD2\", \"ACAA1A\", \"LRRC1\", \"2810432D09RIK\", \"SEPHS2\", \"SAC3D1\", \"TMLHE\", \"LOC623451\", \"TSR2\", \"PLEKHA7\", \"GYS2\", \"ARHGEF12\", \"HIBCH\", \"LYRM2\", \"ZBTB44\", \"ENTPD5\", \"RAB11FIP2\", \"LIPT1\", \"INTU\", \"ANXA13\", \"KLF12\", \"SAT2\", \"GAL3ST2\", \"VAMP8\", \"FKBPL\", \"AQP11\", \"TRAP1\", \"PMPCB\", \"TM7SF3\", \"RBM39\", \"BRI3\", \"KDR\", \"ZFP748\", \"NAP1L1\", \"DHRS1\", \"LRRC56\", \"WDR20A\", \"STXBP2\", \"KLF1\", \"UFC1\", \"CCDC16\", \"9230114K14RIK\", \"RWDD3\", \"2610528K11RIK\") rba_enrichr_add_background(background_genes = my_background_genes) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":null,"dir":"Reference","previous_headings":"","what":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"function uploads gene list Enrichr retrieves unique 'user list ID' required performing enrichment analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"","code":"rba_enrichr_add_list( gene_list, description = NULL, organism = \"human\", speedrichr = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"gene_list character vector Entrez gene symbols test genes. description (optional) description associated uploaded gene-set Enrichr servers. organism (default = \"human\") model organism version Enrichr use? Available options : \"human\", (H. sapiens & M. musculus), \"fly\" (D. melanogaster), \"yeast\" (S. cerevisiae), \"worm\" (C. elegans) \"fish\" (D. rerio). speedrichr logical (default = FALSE) Set TRUE use gene list background list; otherwise, set FALSE. available human libraries. Refer details section information. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"list unique IDs uploaded gene list. `userListId` ID required later steps.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"Enrichr uses separate APIs analysis without background gene list. Set `speedrichr = TRUE` gene list used background gene list; otherwise, set FALSE. Gene lists submitted `speedrichr = TRUE` can analyzed background set, submitted `speedrichr = FALSE` can analyzed without one. Currently, background-based enrichment supported human libraries. Please note rba_enrichr provides one-step convenient way automatically handle required function calls needed perform gene set enrichment analysis Enrichr.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"\"POST https://maayanlab.cloud/Enrichr/addList\" \"POST https://maayanlab.cloud/speedrichr/api/addList\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_add_list.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Upload Your Gene-List to Enrichr — rba_enrichr_add_list","text":"","code":"# \\donttest{ rba_enrichr_add_list(gene_list = c(\"TP53\", \"TNF\", \"EGFR\"), description = \"tumoral genes\", speedrichr = FALSE) # } # \\donttest{ rba_enrichr_add_list(gene_list = c(\"RAG1\", \"RAG2\", \"DNTT\", \"LIG4\", \"ARTEMIS\"), description = \"TCR rearrangment\", speedrichr = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Enrichr Enrichment Results — rba_enrichr_enrich","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"function retrieves enrichment analysis results supplied `user_list_id` one multiple Enrichr libraries.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"","code":"rba_enrichr_enrich( user_list_id, gene_set_library = \"all\", regex_library_name = TRUE, organism = \"human\", background_id = NULL, progress_bar = TRUE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"user_list_id ID returned uploading gene list using rba_enrichr_add_list, `speedrichr` set TRUE FALSE depending whether intend analyze gene list without background gene list, respectively. gene_set_library One : \"\" select available Enrichr gene-set libraries. gene-set library name. can retrieve available options given species using rba_enrichr_libs. regex_library_name = TRUE, partially-matching name regex pattern correspond one Enrichr library names. regex_library_name logical: TRUE (default) supplied gene_set_library considered regex pattern. FALSE, gene_set_library considered exact match. organism (default = \"human\") model organism version Enrichr use? Available options : \"human\", (H. sapiens & M. musculus), \"fly\" (D. melanogaster), \"yeast\" (S. cerevisiae), \"worm\" (C. elegans) \"fish\" (D. rerio). `background_id` provided, available option \"human\". background_id ID returned uploading background gene list using rba_enrichr_add_background progress_bar logical: (default = TRUE) multiple Enrichr libraries selected, progress bar displayed? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"list containing data frames enrichment results supplied gene-list selected Enrichr libraries.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"`background_id` supplied, function interact speedrichr API. case, `user_list_id` must obtained rba_enrichr_add_list call `speedrichr` parameter set `TRUE`. Additionally, feature available \"human\" organism. Please note rba_enrichr provides one-step convenient way automatically handle required function calls needed perform gene set enrichment analysis Enrichr.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"\"GET https://maayanlab.cloud/Enrichr/enrich\" \"POST https://maayanlab.cloud/speedrichr/api/backgroundenrich\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_enrich.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Enrichr Enrichment Results — rba_enrichr_enrich","text":"","code":"if (FALSE) { # \\dontrun{ rba_enrichr_enrich(user_list_id = \"11111\") } # } if (FALSE) { # \\dontrun{ rba_enrichr_enrich(user_list_id = \"11111\", gene_set_library = \"GO_Molecular_Function_2017\", regex_library_name = FALSE) } # } if (FALSE) { # \\dontrun{ rba_enrichr_enrich(user_list_id = \"11111\", gene_set_library = \"go\", regex_library_name = TRUE) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":null,"dir":"Reference","previous_headings":"","what":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"function search gene retrieve list Enrichr Terms contains gene.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"","code":"rba_enrichr_gene_map(gene, categorize = FALSE, organism = \"human\", ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"gene character: Entrez gene symbol. categorize logical: category information included? organism (default = \"human\") model organism version Enrichr use? Available options : \"human\", (H. sapiens & M. musculus), \"fly\" (D. melanogaster), \"yeast\" (S. cerevisiae), \"worm\" (C. elegans) \"fish\" (D. rerio). ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"nested list containing search results supplied gene.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"\"GET https://maayanlab.cloud/Enrichr/genemap\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_gene_map.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Find Enrichr Terms That Contain a Given Gene — rba_enrichr_gene_map","text":"","code":"# \\donttest{ rba_enrichr_gene_map(gene = \"p53\") # } # \\donttest{ rba_enrichr_gene_map(gene = \"p53\", categorize = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":null,"dir":"Reference","previous_headings":"","what":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"function retrieves list libraries available Enrichr along associated statistics. library represents collection gene sets can used enrichment analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"","code":"rba_enrichr_libs(organism = \"human\", store_in_options = TRUE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"organism (default = \"human\") model organism version Enrichr use? Available options : \"human\", (H. sapiens & M. musculus), \"fly\" (D. melanogaster), \"yeast\" (S. cerevisiae), \"worm\" (C. elegans) \"fish\" (D. rerio). store_in_options logical: (default = TRUE) list available Enrichr libraries saved global option? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"data frame names available library Enrichr statistics.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"default, function save library names global option (\"rba_enrichr_libs\") Enrichr functions internally require names Enrichr libraries. call function per R session argument 'store_in_options = TRUE' using rba_enrichr_enrich rba_enrichr. However, explicitly call , rbioapi automatically execute function background needed. Please note rba_enrichr provides one-step convenient way automatically handle required function calls needed perform gene set enrichment analysis Enrichr.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"\"GET https://maayanlab.cloud/Enrichr/datasetStatistics\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_libs.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Retrieve a List of available libraries from Enrichr — rba_enrichr_libs","text":"","code":"# \\donttest{ rba_enrichr_libs() # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":null,"dir":"Reference","previous_headings":"","what":"View an Uploaded Gene List — rba_enrichr_view_list","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"Retrieve list uploaded genes given 'user list ID'.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"","code":"rba_enrichr_view_list( user_list_id, organism = \"human\", speedrichr = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"user_list_id user list ID returned uploading gene list using rba_enrichr_add_list organism (default = \"human\") model organism version Enrichr use? Available options : \"human\", (H. sapiens & M. musculus), \"fly\" (D. melanogaster), \"yeast\" (S. cerevisiae), \"worm\" (C. elegans) \"fish\" (D. rerio). speedrichr logical (default = FALSE) upload gene list speedrichr API? (.e. intend use gene list along background gene list?) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"list containing genes description associated supplied user_list_id.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"\"GET https://maayanlab.cloud/Enrichr/view\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"Chen, E.Y., Tan, C.M., Kou, Y. et al. Enrichr: interactive collaborative HTML5 gene list enrichment analysis tool. Bioinformatics 14, 128 (2013). https://doi.org/10.1186/1471-2105-14-128 Maxim V. Kuleshov, Matthew R. Jones, Andrew D. Rouillard, Nicolas F. Fernandez, Qiaonan Duan, Zichen Wang, Simon Koplev, Sherry L. Jenkins, Kathleen M. Jagodnik, Alexander Lachmann, Michael G. McDermott, Caroline D. Monteiro, Gregory W. Gundersen, Avi Ma’ayan, Enrichr: comprehensive gene set enrichment analysis web server 2016 update, Nucleic Acids Research, Volume 44, Issue W1, 8 July 2016, Pages W90–W97, https://doi.org/10.1093/nar/gkw377 Xie, Z., Bailey, ., Kuleshov, M. V., Clarke, D. J. B., Evangelista, J. E., Jenkins, S. L., Lachmann, ., Wojciechowicz, M. L., Kropiwnicki, E., Jagodnik, K. M., Jeon, M., & Ma’ayan, . (2021). Gene set knowledge discovery Enrichr. Current Protocols, 1, e90. doi: 10.1002/cpz1.90 Enrichr API Documentation Citations note Enrichr website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_enrichr_view_list.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"View an Uploaded Gene List — rba_enrichr_view_list","text":"","code":"if (FALSE) { # \\dontrun{ rba_enrichr_view_list(user_list_id = 11111) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":null,"dir":"Reference","previous_headings":"","what":"List collections available in JASPAR — rba_jaspar_collections","title":"List collections available in JASPAR — rba_jaspar_collections","text":"JASPAR organizes matrix profiles collections. Using function, can retrieve list available collections JASPAR release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List collections available in JASPAR — rba_jaspar_collections","text":"","code":"rba_jaspar_collections(release = 2024, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List collections available in JASPAR — rba_jaspar_collections","text":"release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List collections available in JASPAR — rba_jaspar_collections","text":"data frame collections' names URLs.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List collections available in JASPAR — rba_jaspar_collections","text":"\"GET https://jaspar.elixir./api/v1/collections/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List collections available in JASPAR — rba_jaspar_collections","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List collections available in JASPAR — rba_jaspar_collections","text":"","code":"# \\donttest{ rba_jaspar_collections(release = 2024) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":null,"dir":"Reference","previous_headings":"","what":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"Using function can list matrix profiles available collection JASPAR release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"","code":"rba_jaspar_collections_matrices( collection, release = 2024, only_last_version = FALSE, search = NULL, order = NULL, page_size = 1000, page = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"collection JASPAR Collection's name. See JASPAR Collections information. accepted values : \"CORE\", \"CNE\", \"PHYLOFACTS\", \"SPLICE\", \"POLII\", \"FAM\", \"PBM\", \"PBM_HOMEO\", \"PBM_HLH\", \"UNVALIDATED\". release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. only_last_version Logical: (default = FALSE) TRUE, latest version matrix profile returned. search Character: search term. order Character: character string vector character strings field names used order results. Providing multiple field names supported. can alsoa use prefix \"-\" field name indicate reverse ordering. page_size Numeric: (default = 1000) resource returns paginated results. maximum numbers results want retrieve per page? Accepted values 1 1000. page Numeric: page results retrieve? accepted values depend page size number results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"list contains data frame information matrix profiles available collection.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"results paginated. can control page's size number function's arguments. Also, can use rba_pages automatically iterate multiple pages.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"\"GET https://jaspar.elixir./api/v1/collections/{collection}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_collections_matrices.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List matrices available in a JASPAR collection — rba_jaspar_collections_matrices","text":"","code":"# \\donttest{ rba_jaspar_collections_matrices(collection = \"CORE\", release = 2024, page_size = 100, page = 2) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":null,"dir":"Reference","previous_headings":"","what":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"Using function can retrieve Position Frequency Matrices (PFM) associated matrix profile Identifier along details annotations. base ID (.e. without version suffix) supplied, latest version returned.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"","code":"rba_jaspar_matrix(matrix_id, file_format = NULL, save_to = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"matrix_id Character: matrix profile Identifier. \"base_id.version\" naming schema. file_format Character: Instead returning R object, can directly download profile matrix file format. Supported formats : \"yaml\", \"jaspar\", \"transfac\", \"meme\" \"pfm\" save_to NULL Character: NULL: (file_format supplied) Save file automatically-generated path. Character string: valid file directory path save file . ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"list contains PFM along details annotations. file_format supplied, un-parsed character string file's content.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"\"GET https://jaspar.elixir./api/v1/matrix/{matrix_id}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get a Position Frequency Matrices (PFM) with annotations — rba_jaspar_matrix","text":"","code":"# \\donttest{ rba_jaspar_matrix(\"MA0600.2\") # } if (FALSE) { # \\dontrun{ rba_jaspar_matrix(matrix_id = \"MA0600.2\", file_format = \"meme\", save_to = \"my_matrix.meme\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"can use function list JASPAR matrix profiles match search query, run function without arguments return list every matrix profile available latest release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"","code":"rba_jaspar_matrix_search( term = NULL, tf_name = NULL, tf_class = NULL, tf_family = NULL, tax_group = NULL, tax_id = NULL, data_type = NULL, collection = NULL, release = 2024, only_last_version = FALSE, order = NULL, page_size = 1000, page = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"term Character: search term. tf_name Character: Transcription factor names (Case-sensitive). tf_class Character: Transcription factor class tf_family Character: Transcription factor family tax_group Character: Taxonomic group. Use rba_jaspar_taxons get list supported Taxonomic groups. tax_id Numeric: NCBI taxonomic Identifier species. Use rba_jaspar_species get list supported Species. data_type Character: Type data (.e Methodology used matrix construction). example: \"ChIP-seq\", \"PBM\" collection Character: JASPAR matrix profile collection name. USE rba_jaspar_collections get list collection names. release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. only_last_version Logical: (default = FALSE) TRUE, latest version matrix profile returned. order Character: character string vector character strings field names used order results. Providing multiple field names supported. can also use prefix \"-\" field name indicate reverse ordering. page_size Numeric: (default = 1000) resource returns paginated results. maximum numbers results want retrieve per page? Accepted values 1 1000. page Numeric: page results retrieve? accepted values depend page size number results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"list contains data frame matrix profiles' information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. results paginated. can control page's size number function's arguments. Also, can use rba_pages automatically iterate multiple pages.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"\"GET https://jaspar.elixir./api/v1/api/v1/matrix/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search matrix profiles available in JASPAR — rba_jaspar_matrix_search","text":"","code":"# \\donttest{ rba_jaspar_matrix_search(term = \"FOX\") rba_jaspar_matrix_search(tf_name = \"FOXP3\") rba_jaspar_matrix_search(tf_name = \"FOXP3\", only_last_version = TRUE) rba_jaspar_matrix_search(tf_class = \"Zipper-Type\") rba_jaspar_matrix_search(tax_group = \"insects\") rba_jaspar_matrix_search(page_size = 100) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":null,"dir":"Reference","previous_headings":"","what":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"Since JASPAR release 2010, matrix profiles versioned; , matrix profile Identifier \"base_id.version\" naming schema. Using function can retrieve list matrix profiles associated base (stable) ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"","code":"rba_jaspar_matrix_versions(base_id, order = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"base_id Character: base (stable) Identifier. matrix profile identifier \"base_id.version\" naming schema order Character: character string vector character strings field names used order results. Providing multiple field names supported. can also use prefix \"-\" field name indicate reverse ordering. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"data frame matrix profiles' versions information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"\"GET https://jaspar.elixir./api/v1/matrix/{base_id}/versions/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_matrix_versions.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List matrix profile versions associated with a base ID — rba_jaspar_matrix_versions","text":"","code":"# \\donttest{ rba_jaspar_matrix_versions(\"MA0600\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":null,"dir":"Reference","previous_headings":"","what":"Get information about JASPAR database releases — rba_jaspar_releases","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"release number supplied, function return details release. Otherwise, function called without \"release\" argument, list JASPAR database releases returned.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"","code":"rba_jaspar_releases(release_number = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"release_number Numeric: JASPAR database release number information's retrieve? left NULL (default), list JASPAR database releases returned. Available options 1 8. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"list contains JASPAR database releases' information details particular release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"\"GET https://jaspar.elixir./api/v1/releases/\" \"GET https://jaspar.elixir./api/v1/releases/{release_number}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_releases.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get information about JASPAR database releases — rba_jaspar_releases","text":"","code":"# \\donttest{ rba_jaspar_releases() rba_jaspar_releases(7) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":null,"dir":"Reference","previous_headings":"","what":"Get binding sites of a matrix profile — rba_jaspar_sites","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"Use function retrieve list transcription factor binding sites associated matrix profile.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"","code":"rba_jaspar_sites(matrix_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"matrix_id Character: matrix profile Identifier. \"base_id.version\" naming schema. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"list contains data frame binding sites information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"\"GET https://jaspar.elixir./api/v1/sites/{matrix_id}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_sites.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get binding sites of a matrix profile — rba_jaspar_sites","text":"","code":"# \\donttest{ rba_jaspar_sites(\"MA0600.1\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":null,"dir":"Reference","previous_headings":"","what":"List available species in JASPAR — rba_jaspar_species","title":"List available species in JASPAR — rba_jaspar_species","text":"JASPAR organizes matrix profiles multiple species six taxonomic groups. Use function retrieve list available species JASPAR database release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List available species in JASPAR — rba_jaspar_species","text":"","code":"rba_jaspar_species(release = 2024, search = NULL, order = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List available species in JASPAR — rba_jaspar_species","text":"release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. search Character: search term. order Character: character string vector character strings field names used order results. Providing multiple field names supported. can also use prefix \"-\" field name indicate reverse ordering. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List available species in JASPAR — rba_jaspar_species","text":"data frame information available species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List available species in JASPAR — rba_jaspar_species","text":"\"GET https://jaspar.elixir./api/v1/species/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List available species in JASPAR — rba_jaspar_species","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List available species in JASPAR — rba_jaspar_species","text":"","code":"# \\donttest{ rba_jaspar_species(release = 2024) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":null,"dir":"Reference","previous_headings":"","what":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"JASPAR curates matrix profiles multiple species six taxonomic groups. Using function can list matrix profiles available JASPAR release species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"","code":"rba_jaspar_species_matrices( tax_id, release = 2024, only_last_version = FALSE, search = NULL, order = NULL, page_size = 1000, page = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"tax_id Numeric: NCBI taxonomic Identifier species. Use rba_jaspar_species get list supported Species. release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. only_last_version Logical: (default = FALSE) TRUE, latest version matrix profile returned. search Character: search term. order Character: character string vector character strings field names used order results. Providing multiple field names supported. can also use prefix \"-\" field name indicate reverse ordering. page_size Numeric: (default = 1000) resource returns paginated results. maximum numbers results want retrieve per page? Accepted values 1 1000. page Numeric: page results retrieve? accepted values depend page size number results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"list contains data frame information matrix profiles available species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"results paginated. can control page's size number function's arguments. Also, can use rba_pages automatically iterate multiple pages.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"\"GET https://jaspar.elixir./api/v1/species/{tax_id}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_species_matrices.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List matrices available in JASPAR of a species — rba_jaspar_species_matrices","text":"","code":"# \\donttest{ rba_jaspar_species_matrices(tax_id = 9606, page_size = 100) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":null,"dir":"Reference","previous_headings":"","what":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"JASPAR organizes matrix profiles multiple species six taxonomic groups. Use function retrieve list available taxonomic groups JASPAR database release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"","code":"rba_jaspar_taxons(release = 2024, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"data frame information available species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"\"GET https://jaspar.elixir./api/v1/taxon/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List available taxonomic groups in JASPAR — rba_jaspar_taxons","text":"","code":"# \\donttest{ rba_jaspar_taxons(release = 2024) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":null,"dir":"Reference","previous_headings":"","what":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"JASPAR organizes matrix profiles multiple species six taxonomic groups. Using function can list matrix profiles available JASPAR release taxonomic group.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"","code":"rba_jaspar_taxons_matrices( tax_group, release = 2024, only_last_version = FALSE, search = NULL, order = NULL, page_size = 1000, page = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"tax_group Character: Taxonomic group. Use rba_jaspar_taxons get list supported Taxonomic groups. release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. only_last_version Logical: (default = FALSE) TRUE, latest version matrix profile returned. search Character: search term. order Character: character string vector character strings field names used order results. Providing multiple field names supported. can also use prefix \"-\" field name indicate reverse ordering. page_size Numeric: (default = 1000) resource returns paginated results. maximum numbers results want retrieve per page? Accepted values 1 1000. page Numeric: page results retrieve? accepted values depend page size number results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"list contains data frame information matrix profiles available taxonomic group.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"results paginated. can control page's size number function's arguments. Also, can use rba_pages automatically iterate multiple pages.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"\"GET https://jaspar.elixir./api/v1/taxon/{tax_group}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_taxons_matrices.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"List matrices available in JASPAR of a taxonomic group — rba_jaspar_taxons_matrices","text":"","code":"# \\donttest{ rba_jaspar_taxons_matrices(tax_group = \"plants\", page_size = 100) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":null,"dir":"Reference","previous_headings":"","what":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"Using function can retrieve details annotations Transcription Factor flexible models (TFFMs) associated TFFM ID. base ID (.e. without version suffix) supplied, latest version returned.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"","code":"rba_jaspar_tffm(tffm_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"tffm_id Character: TF flexible model (TFFM) Identifier. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"list contains TFFM's information annotations.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"\"GET https://jaspar.elixir./api/v1/fttm/{tffm_id}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get a TF flexible models (TFFMs) information — rba_jaspar_tffm","text":"","code":"# \\donttest{ rba_jaspar_tffm(\"TFFM0056.3\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"can use function list JASPAR TF flexible models (TFFMs) match search query, run function without arguments return list every matrix profile available latest release.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"","code":"rba_jaspar_tffm_search( term = NULL, release = 2024, tax_group = NULL, search = NULL, order = NULL, page_size = 1000, page = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"term Character: search term. release Numeric: (default = 2024) JASPAR database release use? Available options : 2024, 2022, 2020, 2018, 2016, 2014. tax_group Character: Taxonomic group. Use rba_jaspar_taxons get list supported Taxonomic groups. search Character: search term. order Character: character string vector character strings field names used order results. Providing multiple field names supported. can also use prefix \"-\" field name indicate reverse ordering. page_size Numeric: (default = 1000) resource returns paginated results. maximum numbers results want retrieve per page? Accepted values 1 1000. page Numeric: page results retrieve? accepted values depend page size number results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"list contains data frame information query hits' TFFMs.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. results paginated. can control page's size number function's arguments. Also, can use rba_pages automatically iterate multiple pages.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"\"GET https://jaspar.elixir./api/v1/api/v1/tffm/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"Rauluseviciute , Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Chèneby J, Baranasic D, Khan , Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin , Wasserman WW, Parcy F, Mathelier JASPAR 2024: 20th anniversary open-access database transcription factor binding profiles Nucleic Acids Res. in_press; doi: 10.1093/nar/gkad1059 Khan, . Mathelier, . JASPAR RESTful API: accessing JASPAR data programming language. Bioinformatics, 2017, doi: 10.1093/bioinformatics/btx804 JASPAR API Documentation Citations note JASPAR website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_jaspar_tffm_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search TF flexible models (TFFMs) available in JASPAR — rba_jaspar_tffm_search","text":"","code":"# \\donttest{ rba_jaspar_tffm_search(term = \"FOX\") rba_jaspar_tffm_search(tax_group = \"insects\") rba_jaspar_tffm_search(page_size = 100) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"Combination species miRNA type, pre-defined categories groups supported. Use function retrieve list supported categories given combination Species miRNA type.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"","code":"rba_mieaa_cats(mirna_type, species, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"mirna_type Type miRNA accession. either \"mature\" \"precursor\". species Fully partially matching Scientific name, abbreviation NCBI taxon ID one following species: \"Homo sapiens\", \"hsa\" 9606 \"Mus musculus\", \"mmu\" 10090 \"Rattus norvegicus\", \"rno\" 10116 \"Arabidopsis thaliana\", \"ath\" 3702 \"Bos taurus\", \"bta\" 9913 \"Caenorhabditis elegans\", \"cel\" 6239 \"Drosophila melanogaster\", \"dme\" 7227 \"Danio rerio\", \"dre\" 7955 \"Gallus gallus\", \"gga\" 9031 \"Sus scrofa\", \"ssc\" 9823 ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"named character vector supported categories supplied input combination.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"\"GET https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/v1/enrichment_categories/{species}/{mirna_type}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_cats.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Supported Enrichment Categories for a Species and miRNA Type — rba_mieaa_cats","text":"","code":"# \\donttest{ rba_mieaa_cats(\"mature\", \"Homo sapiens\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":null,"dir":"Reference","previous_headings":"","what":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"miRBase miRNA accession refer either mature precursor miRNAs. (see: uniform system microRNA annotation). Use function mature miRNA accession corresponding miRNA accessions vice versa.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"","code":"rba_mieaa_convert_type( mirna, input_type, only_unique = FALSE, simple_output = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"mirna vector miRNA accessions converted. input_type Type supplied miRNA accession. either \"mature\" \"precursor\". only_unique (logical) miRBase precursor mature miRNA accessions uniquely mapped. (.e. may get one results given accession). set TRUE retrieve unique mappings. (default = FALSE) simple_output (logical) FALSE (default), result two-columned data frame input output accessions. Otherwise, TRUE, output miRNA accessions returned. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"Depending arguments, data frame character vectors containing miRNA accessions output version.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"\"POST https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/v1/mirna_precursor_converter/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_type.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Convert Between Mature and precursor miRNA Accession — rba_mieaa_convert_type","text":"","code":"# \\donttest{ Sys.sleep(1) # to prevent 429 error during R CMD check rba_mieaa_convert_type(mirna = c(\"hsa-miR-20b-5p\", \"hsa-miR-144-5p\"), input_type = \"mature\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":null,"dir":"Reference","previous_headings":"","what":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"miEAA works miRBASE v22 accession. Using function can convert set mature precursor miRNA accession two given miRBase versions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"","code":"rba_mieaa_convert_version( mirna, mirna_type, input_version, output_version, simple_output = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"mirna vector miRNA accessions converted. mirna_type Type supplied miRNA accession. either \"mature\" \"precursor\". input_version (numeric) miRBase version supplied miRNA accessions. output_version (numeric) version miRNA accessions converted? simple_output (logical) FALSE (default), result two-columned data frame input output accessions. Otherwise, TRUE, output miRNA accessions returned. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"Depending arguments, data frame character vectors containing miRNA accessions output version.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"\"POST https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/v1/mirbase_converter/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_convert_version.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Convert miRNA accession Between Different miRBase Versions — rba_mieaa_convert_version","text":"","code":"# \\donttest{ Sys.sleep(1) # to prevent 429 error during R CMD check rba_mieaa_convert_version(mirna = c(\"hsa-miR-20b-5p\", \"hsa-miR-144-5p\"), mirna_type = \"mature\", input_version = 22, output_version = 16) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":null,"dir":"Reference","previous_headings":"","what":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"function wrapper multiple function calls necessary perform enrichment analysis given miRNA list using miEAA. see details section information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"","code":"rba_mieaa_enrich( test_set, mirna_type, test_type, species, categories = NULL, p_adj_method = \"fdr\", independent_p_adj = TRUE, sig_level = 0.05, min_hits = 2, ref_set = NULL, sort_by = \"p_adjusted\", sort_asc = TRUE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"test_set character vector mature precursor miRBase miRNA accessions. Note miRBase v22 miRNA accession accepted. can use rba_mieaa_convert_version convert accessions miRBase v22. list entirely consisted either mature precursor miRNA accession. mixture accepted. mirna_type Type supplied miRNA accession. either \"mature\" \"precursor\". test_type analysis perform. can either \"ORA\" 'Representation Analysis' \"GSEA\" miRNA (Gene) 'Set Enrichment Analysis'. Note GSEA, list sorted beforehand based criterion. species Fully partially matching Scientific name, abbreviation NCBI taxon ID one following species: \"Homo sapiens\", \"hsa\" 9606 \"Mus musculus\", \"mmu\" 10090 \"Rattus norvegicus\", \"rno\" 10116 \"Arabidopsis thaliana\", \"ath\" 3702 \"Bos taurus\", \"bta\" 9913 \"Caenorhabditis elegans\", \"cel\" 6239 \"Drosophila melanogaster\", \"dme\" 7227 \"Danio rerio\", \"dre\" 7955 \"Gallus gallus\", \"gga\" 9031 \"Sus scrofa\", \"ssc\" 9823 categories one multiple Category names used miRNA set enrichment analysis. Note Available categories varies based chosen specie supplied miRNA type mature precursor. Use rba_mieaa_cats retrieve list available category names given specie miRNA type. supply NULL, analysis performed available categories. p_adj_method P-value adjustment method used. one : \"none\", \"fdr\" (default), \"bonferroni\", \"\", \"hochberg\", \"holm\" \"hommel\" independent_p_adj (logical) scope level p-value adjustment; TRUE (default), categories considered independent p-value adjusted separately category. FALSE, p-value adjusted collectively categories. sig_level (numeric) significance threshold adjusted P-value. values equal greater threshold dropped results. min_hits (numeric) many miRNA sub-category supplied test-list included results? (default 2) ref_set (Optional) applicable test_type \"ORA\". character vector used reference (background universe) set p-value calculations. sort_by column name result's table based . one : \"category\", \"subcategory\", \"enrichment\", \"p_value\", \"p_adjusted\" (default), \"q_value\" \"observed\" . sort_asc (logical) TRUE, results sorted ascending order. FALSE, results sorted descending order. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"data frame enrichment analysis results.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"function call rba_mieaa_*** functions following order: Call rba_mieaa_enrich_submit Submit enrichment analysis request miEAA servers, using supplied miRNA lists arguments. job successfully submitted, call rba_mieaa_enrich_status every 5 seconds, check status running server-side job whether analysis job finished results available. Call rba_mieaa_enrich_results retrieve results enrichment analysis. See function's manual details.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"\"GET https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"A One-step Wrapper for miRNA Enrichment Using miEAA — rba_mieaa_enrich","text":"","code":"if (FALSE) { # \\dontrun{ rba_mieaa_enrich(test_set = c(\"hsa-miR-20b-5p\", \"hsa-miR-144-5p\", \"hsa-miR-17-5p\", \"hsa-miR-20a-5p\"), mirna_type = \"mature\", test_type = \"ORA\", species = 9606, categories = \"miRPathDB_GO_Biological_process_mature\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":null,"dir":"Reference","previous_headings":"","what":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"submitted enrichment analysis request finished (check using rba_mieaa_enrich_status), can retrieve results using function.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"","code":"rba_mieaa_enrich_results(job_id, sort_by = \"p_adjusted\", sort_asc = TRUE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"job_id job-id (character string) submitted enrichment analysis. sort_by column name result's table based . one : \"category\", \"subcategory\", \"enrichment\", \"p_value\", \"p_adjusted\" (default), \"q_value\" \"observed\" . sort_asc (logical) TRUE, results sorted ascending order. FALSE, results sorted descending order. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"data frame enrichment analysis results.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"Note using rba_mieaa_enrich convenient way automatically perform required function calls perform enrichment analysis input miRNA-set using miEAA.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"\"GET https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/v1/results/{job_id}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_results.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Retrieve Results of a finished Enrichment Analysis from miEAA — rba_mieaa_enrich_results","text":"","code":"if (FALSE) { # \\dontrun{ rba_mieaa_enrich_results(\"f52d1aef-6d3d-4d51-9020-82e68fe99012\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":null,"dir":"Reference","previous_headings":"","what":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"submitted enrichment analysis (using rba_mieaa_enrich_submit) retrieved job-id, can use function check status job. Status value equal 100 means requested analysis finished may retrieve results using rba_mieaa_enrich_results.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"","code":"rba_mieaa_enrich_status(job_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"job_id job-id (character string) submitted enrichment analysis. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"list containing status value analysis corresponds supplied job-id.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"Note using rba_mieaa_enrich convenient way automatically perform required function calls perform enrichment analysis input miRNA-set using miEAA.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"\"GET https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/v1/job_status/{job_id}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_status.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Check Status of a Submitted Enrichment Analysis in miEAA — rba_mieaa_enrich_status","text":"","code":"if (FALSE) { # \\dontrun{ Sys.sleep(1) # to prevent 429 error during R CMD check rba_mieaa_enrich_status(\"f52d1aef-6d3d-4d51-9020-82e68fe99012\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":null,"dir":"Reference","previous_headings":"","what":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"Using function can submit request miEAA servers perform -representation GSEA Analysis given set miRNA identifiers. see \"arguments\" section information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"","code":"rba_mieaa_enrich_submit( test_set, mirna_type, test_type, species = \"hsa\", categories = NULL, p_adj_method = \"fdr\", independent_p_adj = TRUE, sig_level = 0.05, min_hits = 2, ref_set = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"test_set character vector mature precursor miRBase miRNA accessions. Note miRBase v22 miRNA accession accepted. can use rba_mieaa_convert_version convert accessions miRBase v22. list entirely consisted either mature precursor miRNA accession. mixture accepted. mirna_type Type supplied miRNA accession. either \"mature\" \"precursor\". test_type analysis perform. can either \"ORA\" 'Representation Analysis' \"GSEA\" miRNA (Gene) 'Set Enrichment Analysis'. Note GSEA, list sorted beforehand based criterion. species Fully partially matching Scientific name, abbreviation NCBI taxon ID one following species: \"Homo sapiens\", \"hsa\" 9606 \"Mus musculus\", \"mmu\" 10090 \"Rattus norvegicus\", \"rno\" 10116 \"Arabidopsis thaliana\", \"ath\" 3702 \"Bos taurus\", \"bta\" 9913 \"Caenorhabditis elegans\", \"cel\" 6239 \"Drosophila melanogaster\", \"dme\" 7227 \"Danio rerio\", \"dre\" 7955 \"Gallus gallus\", \"gga\" 9031 \"Sus scrofa\", \"ssc\" 9823 categories one multiple Category names used miRNA set enrichment analysis. Note Available categories varies based chosen specie supplied miRNA type mature precursor. Use rba_mieaa_cats retrieve list available category names given specie miRNA type. supply NULL, analysis performed available categories. p_adj_method P-value adjustment method used. one : \"none\", \"fdr\" (default), \"bonferroni\", \"\", \"hochberg\", \"holm\" \"hommel\" independent_p_adj (logical) scope level p-value adjustment; TRUE (default), categories considered independent p-value adjusted separately category. FALSE, p-value adjusted collectively categories. sig_level (numeric) significance threshold adjusted P-value. values equal greater threshold dropped results. min_hits (numeric) many miRNA sub-category supplied test-list included results? (default 2) ref_set (Optional) applicable test_type \"ORA\". character vector used reference (background universe) set p-value calculations. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"list contains submitted job's ID URL manually check job status.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"Note using rba_mieaa_enrich convenient way automatically perform required function calls perform enrichment analysis input miRNA-set using miEAA.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"\"POST https://ccb-compute2.cs.uni-saarland.de/mieaa2/api/v1/enrichment_analysis/{species}/{type}/{test}/\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"Fabian Kern, Tobias Fehlmann, Jeffrey Solomon, Louisa Schwed, Nadja Grammes, Christina Backes, Kendall Van Keuren-Jensen, David Wesley Craig,Eckart Meese, Andreas Keller, miEAA 2.0: integrating multi-species microRNA enrichment analysis workflow management systems, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W521–W528, https://doi.org/10.1093/nar/gkaa309 miEAA browsable API tutorial Citations note miEAA website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_mieaa_enrich_submit.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Submit miEAA miRNA Enrichment Analysis Request — rba_mieaa_enrich_submit","text":"","code":"# \\donttest{ Sys.sleep(1) # to prevent 429 error during R CMD check rba_mieaa_enrich_submit(test_set = c(\"hsa-miR-20b-5p\", \"hsa-miR-144-5p\"), mirna_type = \"mature\", test_type = \"GSEA\", species = 9606, categories = NULL) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_options.html","id":null,"dir":"Reference","previous_headings":"","what":"Set rbioapi Global Options — rba_options","title":"Set rbioapi Global Options — rba_options","text":"safe way change rbioapi's global options behavior. see \"arguments\" section available options. Note limited changing options globally, can include option names values '...' argument rbioapi function alter option(s) function call; e.g. example_function(x, diagnostics = TRUE, timeout = 300). Alternatively, can call function arguments, .e. rba_options(), retrieve data frame available rbioapi options current values.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_options.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Set rbioapi Global Options — rba_options","text":"","code":"rba_options( diagnostics = NULL, dir_name = NULL, retry_max = NULL, retry_wait = NULL, progress = NULL, save_file = NULL, skip_error = NULL, timeout = NULL, verbose = NULL )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_options.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Set rbioapi Global Options — rba_options","text":"diagnostics (Logical) (default = FALSE) Show diagnostics detailed messages internal information. dir_name (character) (default = \"rbioapi\") package needs generate file path save server's response, directory name created working directory save files. retry_max (Numeric) (default = 0) many times rbioapi retry case 5xx server responses, errors related server internet connectivity? retry_wait (Numeric) (default = 10) Time seconds wait next retry case internet connection server problems. progress (Logical) (default = FALSE) progress bar displayed? save_file (Logical character) (default = FALSE) Either: TRUE: case, raw server's response file automatically saved proper file path. use \"dir_name\" argument change file's parent directory. FALSE: (default) automatically save server's response file. Character: (changing option via \"...\" functions call) valid file path save server's response file function calling. skip_error (Logical) (default = FALSE R interactive mode, TRUE otherwise) TRUE, code execution stopped case errors (anything HTTP status 200 server); Instead error message returned function's output. However, FALSE, case error, code execution halted error message issued. timeout (Numeric) (default = 30) maximum time seconds willing wait server response giving stopping function execution. verbose (Logical) (Default = TRUE) Generate short informative messages.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_options.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Set rbioapi Global Options — rba_options","text":"called without argument, Data frame available options information; Called argument, Return NULL Alters option globally.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_options.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Set rbioapi Global Options — rba_options","text":"function validates supplied changes, please change rbioapi options using function avoid directly editing .","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_options.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Set rbioapi Global Options — rba_options","text":"","code":"rba_options() if (FALSE) { # \\dontrun{ rba_options(verbose = FALSE) } # } if (FALSE) { # \\dontrun{ rba_options(save_file = TRUE) } # } if (FALSE) { # \\dontrun{ rba_options(diagnostics = TRUE, progress = TRUE) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_pages.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Multiple Pages of a Paginated Resource — rba_pages","title":"Get Multiple Pages of a Paginated Resource — rba_pages","text":"resources return paginated results, meaning make separate calls page. Using function, can iterate 100 pages. Just supply rbioapi function change page argument \"pages:start_page:end_page\", example \"pages:1:5\".","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_pages.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Multiple Pages of a Paginated Resource — rba_pages","text":"","code":"rba_pages(input_call, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_pages.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Multiple Pages of a Paginated Resource — rba_pages","text":"input_call quoted call. supply regular rbioapi function call, two differences: : Wrap quote() around . meaning: quote(rba_example()) : Set argument corresponds page number \"pages:start_page:end_page\", example \"pages:1:5\". See \"examples\" section learn . ... Experimental internal options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_pages.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Multiple Pages of a Paginated Resource — rba_pages","text":"named list element corresponds request's page.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_pages.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Multiple Pages of a Paginated Resource — rba_pages","text":"prevent flooding server, 1 second delay calls, also user iterate 100 pages. function also override skip_error option always set TRUE. means case server response error (e.g. requesting pages exist) error message returned instead halting function's execution.","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_pages.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Multiple Pages of a Paginated Resource — rba_pages","text":"","code":"# \\donttest{ rba_pages(input_call = quote(rba_uniprot_taxonomy(ids = 189831, hierarchy = \"siblings\", page_size = 50, page_number = \"pages:1:5\"))) # } # \\donttest{ rba_pages(input_call = quote(rba_uniprot_taxonomy_name(name = \"adenovirus\", field = \"scientific\", search_type = \"contain\", page_size = 200, page_number = \"pages:1:5\", verbose = FALSE))) # } # \\donttest{ rba_pages(input_call = quote(rba_panther_info(what = \"families\", families_page = \"pages:9:11\"))) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":null,"dir":"Reference","previous_headings":"","what":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"Use PANTHER services perform -representation enrichment analysis. can either provide character vector gene IDs -representation analysis, data frame gene IDs expression analysis. Please refer details section information statistical analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"","code":"rba_panther_enrich( genes, organism, annot_dataset, test_type = NULL, correction = \"FDR\", cutoff = NULL, ref_genes = NULL, ref_organism = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"genes Either character vector data frame. Depending parameter, analysis type determined. Character vector: character vector supplied, -representation analysis performed using either Fisher's exact test (default), binomial. Data frame: data.frame supplied, statistical enrichment test performed using Mann-Whitney U (Wilcoxon Rank-Sum) test. data frame two columns: first column character vector gene identifiers second column numerical vector expression values. cases, maximum 10000 genes can supplied. gene identifiers can : Ensemble gene ID, Ensembl protein ID, Ensembl transcript ID, Entrez gene ID, gene symbol, NCBI GI, HGNC ID, International protein index ID, NCBI UniGene ID, UniProt accession UniProt ID. organism (numeric) NCBI taxon ID. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. annot_dataset PANTHER dataset ID test input . run rba_panther_info argument '= \"datasets\"' get list PANTHER's supported datasets. Note enter \"id\" dataset, label (e.g. entering \"biological_process\" incorrect, rather enter \"GO:0008150\"). test_type statistical test type calculate p values. performing -representation analysis (.e. `genes` parameter character vector), valid values \"FISHER\" (default) \"BINOMIAL\". performing statistical enrichment analysis (.e. `genes` parameter data.frame), valid value \"Mann-Whitney\" correction p value correction method. either \"FDR\" (default), \"BONFERRONI\" \"NONE\". cutoff (Numeric) (Optional) threshold filter results. correction \"FDR\", threshold applied fdr column's values; otherwise, threshold applied p value column. ref_genes (Optional, valid genes character vector) character vector genes used test's background (reference/universe) gene set. value supplied, genes specified organism used. maximum length supported IDs 'genes' argument. ref_organism (Optional, valid genes character vector) 'ref_genes' used, can specify organisms correspond supplied IDs 'ref_genes' argument. see 'organism' argument supported values. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"list parameters results. analysis successful, results data frame returned \"results\" element within list. Otherwise, error message returned \"search$error\" element returned list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"-representation Test: assesses whether specific gene sets represented input gene list differently expected chance. uses Fisher's exact test Binomial test calculate p-values. Fisher's exact test determines probability observing gene counts category based hypergeometric distribution; binomial test compares observed proportion genes category expected proportion based reference list. significant p-value indicates -representation -representation gene set. Statistical Enrichment Test: statistical enrichment test uses Mann-Whitney U (Wilcoxon Rank-Sum) test assess expression values associated genes specific category differ significantly overall distribution input list. non-parametric test first ranks numerical values computes whether expression values randomly drawn overall distribution values. small p-value indicates numerical values genes category significantly different background distribution, thus non-random patterns. Please note starting rbioapi version 0.8.2, can supply gene expression data frame perform statistical enrichment analysis. earlier versions, character vector gene IDs possible, thus -representation analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"\"POST https://www.pantherdb.org/services/oai/pantherdb/enrich/overrep\" \"POST https://www.pantherdb.org/services/oai/pantherdb/enrich/statenrich\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_enrich.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"PANTHER Over-Representation or Enrichment Analysis — rba_panther_enrich","text":"","code":"# \\donttest{ rba_panther_enrich( genes = c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\", \"CDK1\", \"KIF23\", \"PLK1\", \"RAC2\", \"RACGAP1\"), organism = 9606, annot_dataset = \"GO:0008150\", cutoff = 0.01 ) # } # \\donttest{ expression_df <- data.frame( genes = c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\", \"CDK1\", \"KIF23\", \"PLK1\", \"RAC2\", \"RACGAP1\"), expr = runif(10, 0, 100) ) rba_panther_enrich( genes = expression_df, organism = 9606, annot_dataset = \"GO:0008150\" ) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":null,"dir":"Reference","previous_headings":"","what":"Get PANTHER Families and Sub-Families — rba_panther_family","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"Using function, can retrieve Orthologs, MSA Tree topology information given PANTHER family.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"","code":"rba_panther_family(id, what, target_organisms = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"id Panther family id. retrieve? One : \"ortholog\": Orthologs ('LDO' least diverged 'O' diverged). \"msa\": Multiple Sequence Alignment Information, \"tree\": Tree topology nodes attributes. target_organisms (numeric) NCBI taxon ID(s) filter results. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"trees list otherwise data frame requested family's information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"\"GET https://www.pantherdb.org/services/oai/pantherdb/familyortholog\" \"GET https://www.pantherdb.org/services/oai/pantherdb/familymsa\" \"GET https://www.pantherdb.org/services/oai/pantherdb/treeinfo\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_family.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get PANTHER Families and Sub-Families — rba_panther_family","text":"","code":"# \\donttest{ rba_panther_family(\"PTHR10000\", what = \"ortholog\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":null,"dir":"Reference","previous_headings":"","what":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"Using function can search retrieve homolog given gene(s).","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"","code":"rba_panther_homolog(genes, organism, type = \"P\", target_organisms = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"genes Character vector genes identifiers maximum length 10 one seq_pos supplied. Can : Ensemble gene ID, Ensemble protein ID, Ensemble transcript ID, Entrez gene ID, gene symbol, NCBI GI, HGNC ID, International protein index ID, NCBI UniGene ID, UniProt accession /UniProt ID. organism (numeric) NCBI taxon ID organism supplied genes. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. type Homolog types return. either \"P\" (default) paralogs, \"X\" horizontal gene transfer \"LDX\" diverged horizontal gene transfer. target_organisms (numeric) NCBI taxon ID(s) filter results. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. Paralog, target organism organism ; Otherwise, target organism different input organism. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"dataframe homologs information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"\"GET https://www.pantherdb.org/services/oai/pantherdb/ortholog/homologOther\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_homolog.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search PANTHER for Homologs of Gene(s) — rba_panther_homolog","text":"","code":"# \\donttest{ rba_panther_homolog(\"OR4F5\", organism = 9606, type = \"P\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":null,"dir":"Reference","previous_headings":"","what":"Get PANTHER database Information — rba_panther_info","title":"Get PANTHER database Information — rba_panther_info","text":"Using function can retrieve list available organisms, annotation datasets, families, pathways supported PANTHER.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get PANTHER database Information — rba_panther_info","text":"","code":"rba_panther_info(what, organism_chr_loc = FALSE, families_page = 1, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get PANTHER database Information — rba_panther_info","text":"information retrieve? one : \"organisms\": Retrieve supported organisms PANTHER. \"datasets\": Retrieve available annotation datasets. \"families\" Retrieve available family IDs. \"species_tree\" Retrieve PANThER's species tree. \"pathways\" Retrieve available pathway IDs. organism_chr_loc (Logical) ('= \"organisms\"') TRUE, organisms chromosome location returned. FALSE (default) every organisms returned. families_page (Numeric) ('= \"families\"') Family information long, results paginated. Use argument define page retrieve. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get PANTHER database Information — rba_panther_info","text":"families species tree, list otherwise data frame pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get PANTHER database Information — rba_panther_info","text":"\"GET https://www.pantherdb.org/services/oai/pantherdb/supportedgenomes\" \"GET https://www.pantherdb.org/services/oai/pantherdb/supportedannotdatasets\" \"GET https://www.pantherdb.org/services/oai/pantherdb/supportedpantherfamilies\" \"GET https://www.pantherdb.org/services/oai/pantherdb/supportedpantherpathways\" \"GET https://www.pantherdb.org/services/oai/pantherdb/speciestree\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get PANTHER database Information — rba_panther_info","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_info.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get PANTHER database Information — rba_panther_info","text":"","code":"# \\donttest{ rba_panther_info(what = \"organisms\") # } # \\donttest{ rba_panther_info(what = \"families\", families_page = 4) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":null,"dir":"Reference","previous_headings":"","what":"Map A Gene-set to PANTHER Database — rba_panther_mapping","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"Using function, can search genes PANTHER database retrieve attributes annotations associated genes.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"","code":"rba_panther_mapping(genes, organism, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"genes Character vector genes identifiers maximum length 1000. Can : Ensemble gene ID, Ensemble protein ID, Ensemble transcript ID, Entrez gene ID, gene symbol, NCBI GI, HGNC ID, International protein index ID, NCBI UniGene ID, UniProt accession /UniProt ID. organism (numeric) NCBI taxon ID. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"list containing unmapped inputs mapped genes pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"\"GET https://www.pantherdb.org/services/oai/pantherdb/geneinfo\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_mapping.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Map A Gene-set to PANTHER Database — rba_panther_mapping","text":"","code":"# \\donttest{ rba_panther_mapping(genes = c(\"Cd40\", 7124, \"ENSG00000203747\", \"P33681\"), organism = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":null,"dir":"Reference","previous_headings":"","what":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"Using function can search retrieve orthologs given gene(s), optionally return corresponding position target organisms' protein sequences.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"","code":"rba_panther_ortholog( genes, organism, type = \"all\", target_organisms = NULL, seq_pos = NULL, include_msa = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"genes Character vector genes identifiers maximum length 10 one seq_pos supplied. Can : Ensemble gene ID, Ensemble protein ID, Ensemble transcript ID, Entrez gene ID, gene symbol, NCBI GI, HGNC ID, International protein index ID, NCBI UniGene ID, UniProt accession /UniProt ID. organism (numeric) NCBI taxon ID organism supplied genes. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. type Ortholog types return. either \"\" (default) \"LDO\" return least diverged orthologs. target_organisms (numeric) NCBI taxon ID(s) filter results. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. seq_pos (Numeric) position protein's sequence supplied gene. range protein's length. include_msa (Logical) sequence position supplied, MSA (Multiple Sequence Alignment) information included results? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"data frame Orthologs information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"\"POST https://www.pantherdb.org/services/oai/pantherdb/ortholog/matchortho\" \"POST https://www.pantherdb.org/services/oai/pantherdb/ortholog/homologpos\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_ortholog.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search PANTHER for Orthologs of Gene(s) — rba_panther_ortholog","text":"","code":"# \\donttest{ rba_panther_ortholog(\"CD40\", organism = 9606, type = \"LDO\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":null,"dir":"Reference","previous_headings":"","what":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"information, see: TreeGrafter: phylogenetic tree-based annotation proteins Gene Ontology terms annotations","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"","code":"rba_panther_tree_grafter(protein_seq, target_organisms = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"protein_seq character string protein's sequence. Maximum allowed sequence length 50kb. target_organisms (numeric) NCBI taxon ID(s) filter results. run rba_panther_info argument '= \"organisms\"' get list PANTHER's supported organisms. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"list containing PANTHER tree topology information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"\"GET https://www.pantherdb.org/services/oai/pantherdb/graftsequence\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"Huaiyu Mi, Dustin Ebert, Anushya Muruganujan, Caitlin Mills, Laurent-Philippe Albou, Tremayne Mushayamaha, Paul D Thomas, PANTHER version 16: revised family classification, tree-based classification tool, enhancer regions extensive API, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D394–D403, https://doi.org/10.1093/nar/gkaa1106 PANTHER Services Details Citations note PANTHER website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_panther_tree_grafter.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"PANTHER Tree Grafter Use this function to retrieve a PANTHER family's tree topology information with a node corresponding to your sequence grafted in the best location in that tree. — rba_panther_tree_grafter","text":"","code":"# \\donttest{ rba_panther_tree_grafter(\"MKVLWAALLVTFLAGCQAKVEQAVETE\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":null,"dir":"Reference","previous_headings":"","what":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"Using function, can perform Reactome Analysis convenient way. Analysis Type chosen depending supplied input: supply vector single-columned table, \"-Representation\" analysis performed. supply multi-column table, first column molecules identifiers rest numeral expression values, \"Expression\" analysis performed. See details section accepted input types format.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"","code":"rba_reactome_analysis( input, input_format = NULL, projection = TRUE, interactors = FALSE, species = NULL, sort_by = \"ENTITIES_PVALUE\", order = \"ASC\", resource = \"TOTAL\", p_value = 1, include_disease = TRUE, min = NULL, max = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"input vector, data frame, matrix local file path URL points data. See \"Details section\" information organize supply input. input_format (Optional) function automatically identify supplied input's format. case unexpected issues want explicit, set argument one : \"table\": supplied data frame matrix input. \"vector\": supplied simple vector (numeric character) input. \"file\": supplied local file path pointing correctly-formatted text file. \"url\": supplied URL pointing correctly-formatted text file. projection Logical (default = TRUE) non-human identifiers projected human equivalents? (using Reactome orthology data) interactors Logical (default = FALSE) IntAct interaction data used increase analysis background? species Numeric Character: NCBI Taxonomy identifier (Human 9606), species name (e.g. \"Homo sapiens\") Reactome DbId (e.g Homo sapiens 48887). See rba_reactome_species Reactome Data Schema: Entries: Species. Note supply species parameter projection parameter TRUE. sort_by Sort result based column? available choices : \"NAME\", \"TOTAL_ENTITIES\", \"TOTAL_INTERACTORS\", \"TOTAL_REACTIONS\", \"FOUND_ENTITIES\", \"FOUND_INTERACTORS\", \"FOUND_REACTIONS\", \"ENTITIES_RATIO\", \"ENTITIES_PVALUE\", \"ENTITIES_FDR\" \"REACTIONS_RATIO\" order Sort Order. Can either \"ASC\" (default) \"DESC\". resource Filter results based resource. Default \"TOTAL\", available choices : \"TOTAL\", \"UNIPROT\", \"ENSEMBL\", \"CHEBI\", \"IUPHAR\", \"MIRBASE\", \"NCBI_PROTEIN\", \"EMBL\", \"COMPOUND\", \"ENTITIES_FDR\" \"PUBCHEM_COMPOUND\". p_value Set P value threshold. results P value equal less supplied threshold returned. (default = 1, Meaning P value filtering) include_disease Logical (default = TRUE) disease pathways included results? min (numeric) Minimum number entities pathways included results. max (numeric) Maximum number entities pathways included results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"List containing results information analysis. Note can use token returned \"summary\" sub-list results (.e. results$summary$token) retrieve results later Reactome analysis functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"can supply table vector input numerous formats: R object can data frame, matrix simple vector. path local text file device contains molecules data. (file formatted correctly, see .) URL pointing text file web contains molecules data. (file formatted correctly, see . supply text file (local file path URL), TSV (Tab-Separated Values) format; Column names start \"#\" character. Note providing file \"-Representation\" analysis (.e. Single columned-data) header line optional used 'Sample Name', otherwise required. Also, form \"summary\" element function's output, can see Reactome Interpreted input subsequently type analysis performed. strict criteria type molecules Identifiers, Reactome Map IDs internal database entities. Nevertheless, can check identifiers found \"identifiersNotFound\" element function's output. Analysis, Reactome associate token analysis. can later used function requires token (e.g retrieve analysis results, download pdf). Note Reactome store token 7 days. can download full results rba_reactome_analysis_download, re-import anytime reactome (using rba_reactome_analysis_import) generate new token.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"\"POST https://reactome.org/AnalysisService/identifiers/form\" \"POST https://reactome.org/AnalysisService/identifiers/url\" \"POST https://reactome.org/AnalysisService/identifiers/form/projection\" \"POST https://reactome.org/AnalysisService/identifiers/url/projection\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Reactome Over-Representation or Expression Analysis — rba_reactome_analysis","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_analysis(input = c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\")) } # } if (FALSE) { # \\dontrun{ rba_reactome_analysis(input = \"c:/rbioapi/genes.txt\") } # } if (FALSE) { # \\dontrun{ rba_reactome_analysis(input = \"https://qazwsx.com/genes.txt\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":null,"dir":"Reference","previous_headings":"","what":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"Based \"request\" argument, can download different analysis results data associated given token.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"","code":"rba_reactome_analysis_download( token, request, save_to = NULL, resource = \"TOTAL\", ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"token token associated previous Reactome analysis. request download? one : \"found_ids\": Download CSV file containing found user-supplied identifiers analysis associated supplied token resource. \"not_found_ids\"\" Download CSV file containing user-supplied Identifiers found analysis associated supplied token. \"pathways\": Download CSV file containing Pathway analysis results analysis associated supplied token resource. \"results\": Download JSON file containing complete analysis results associated supplied token. \"results_gz\" \"results\", output compress (gzipped). save_to NULL Character: NULL: Save file automatically-generated path. Character string: valid file path save file . resource (request \"found_ids\" \"pathways\") Filter results based resource. Default \"TOTAL\", available choices :\"TOTAL\", \"UNIPROT\", \"ENSEMBL\", \"CHEBI\", \"IUPHAR\", \"MIRBASE\", \"NCBI_PROTEIN\", \"EMBL\", \"COMPOUND\", \"ENTITIES_FDR\" \"PUBCHEM_COMPOUND\". ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"NULL, CSV,JSON Gzipped JSON file saved disk based input.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"Token associated Reactome analysis results kept Reactome least 7 days. can locate rba_reactome_analysis's output, sub-list named \"summary\" (.e. results$summary$token). Use rba_reactome_analysis_pdf save full report PDF format.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"GET https://reactome.org/AnalysisService/download/{token}/entities/ found/{resource}/{filename}.csv\" GET https://reactome.org/AnalysisService/download/{token}/entities/ notfound/{filename}.csv\" GET https://reactome.org/AnalysisService/download/{token}/pathways/ {resource}/{filename}.csv\" GET https://reactome.org/AnalysisService/download/{token}/result.json\" GET https://reactome.org/AnalysisService/download/{token}/result.json.gz\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_download.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Download Different Reactome Analysis Results — rba_reactome_analysis_download","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_analysis_download(token = \"MjAyMDEwMTYwMTI3MTNfMjY1MjM\", request = \"found_ids\", save_to = \"found_ids.csv\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":null,"dir":"Reference","previous_headings":"","what":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"JSON file analysis results (obtained via rba_reactome_analysis_download result argument set \"results\", \"results_gz\"), can import results back Reactome retrieve token. useful want use Reactome services require token token token expired (.e. 7 days passed analysis).","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"","code":"rba_reactome_analysis_import(input, input_format = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"input local file path URL points -optionally gzipped- JSON file. input_format (Optional) function automatically identify supplied input's format. case unexpected issues want explicit, set argument one : \"file\": supplied local file path pointing JSON file. \"url\": supplied URL pointing JSON file. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"list containing new token information imported results.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"\"GET https://reactome.org/AnalysisService/import/\" \"GET https://reactome.org/AnalysisService/import/form\" \"GET https://reactome.org/AnalysisService/import/url\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_import.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Import Saved Analysis JSON to Reactome — rba_reactome_analysis_import","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_analysis_import(\"c:/rbioapi/res.json\") } # } if (FALSE) { # \\dontrun{ rba_reactome_analysis_import(\"https://qaz.com/res.json.gz\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":null,"dir":"Reference","previous_headings":"","what":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"Use function map molecule identifiers different species Reactome Identifiers.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"","code":"rba_reactome_analysis_mapping( input, input_format = NULL, projection = TRUE, interactors = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"input vector, local file path URL points identifiers list. input_format (Optional) function automatically identify supplied input's format. case unexpected issues want explicit, set argument one : \"vector\": supplied simple vector (numeric character) input. \"file\": supplied local file path pointing correctly-formatted text file. \"url\": supplied URL pointing correctly-formatted text file. projection Logical (default = TRUE) non-human identifiers projected human equivalents? (using Reactome orthology data) interactors Logical (default = FALSE) IntAct interaction data included? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"List containing identifiers IDS resources mapped .","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"\"GET https://reactome.org/AnalysisService/mapping\" \"GET https://reactome.org/AnalysisService/mapping/form\" \"GET https://reactome.org/AnalysisService/mapping/form/projection\" \"GET https://reactome.org/AnalysisService/mapping\" \"GET https://reactome.org/AnalysisService/mapping/url\" \"GET https://reactome.org/AnalysisService/mapping/url/projection\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_mapping.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Maps Molecule Identifiers — rba_reactome_analysis_mapping","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_analysis_mapping(c(\"Q8SQ34\", \"cd40\")) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":null,"dir":"Reference","previous_headings":"","what":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"Use function save detailed report previous analysis ( done rba_reactome_analysis). need supply 'token' associated previous analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"","code":"rba_reactome_analysis_pdf( token, species, save_to = NULL, number = 25, resource = \"TOTAL\", diagram_profile = \"Modern\", analysis_profile = \"Standard\", fireworks_profile = \"Barium Lithium\", ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"token token associated previous Reactome analysis. species Numeric Character: NCBI Taxonomy identifier (Human Taxonomy ID 9606.) species name (e.g. \"Homo sapiens\"). See rba_reactome_species Reactome Data Schema: Entries: Species. save_to NULL Character: NULL: Save file automatically-generated path. Character string: valid file path save file . number Numeric: Maximum number reported pathways. greater 50. resource Filter results based resource. Default \"TOTAL\", available choices : \"TOTAL\", \"UNIPROT\", \"ENSEMBL\", \"CHEBI\", \"IUPHAR\", \"MIRBASE\", \"NCBI_PROTEIN\", \"EMBL\", \"COMPOUND\", \"ENTITIES_FDR\" \"PUBCHEM_COMPOUND\". diagram_profile Color profile diagrams, either \"Modern\" (default) \"Standard\". analysis_profile Color profile analysis, one : \"Standard\" (default), \"Strosobar\" \"Copper Plus\". fireworks_profile Color profile overview diagram, one : \"Copper\", \"Copper Plus\", \"Barium Lithium\" \"calcium salts\". ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"NULL, PDF file saved disk.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"Token associated Reactome analysis results kept Reactome least 7 days. can locate rba_reactome_analysis's output, sub-list named \"summary\" (.e. results$summary$token). Note Reactome store token 7 days. can download full results rba_reactome_analysis_download, re-import anytime reactome (using rba_reactome_analysis_import) generate new token. Use rba_reactome_analysis_download save results formats.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"\"GET https://reactome.org/AnalysisService/report/{token}/{species}/ {filename}.pdf\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_pdf.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Generate PDF file with Reactome Analysis Results — rba_reactome_analysis_pdf","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_analysis_pdf(token = \"MjAyMDEwMTYwMTI3MTNfMjY1MjM%3D\", species = 9606, save_to = \"my_analysis.pdf\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":null,"dir":"Reference","previous_headings":"","what":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"Use function Compare human's manually-curated pathways computationally inferred pathways (orthologous) species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"","code":"rba_reactome_analysis_species( species_dbid, sort_by = \"ENTITIES_PVALUE\", order = \"ASC\", resource = \"TOTAL\", p_value = 1, min = NULL, max = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"species_dbid Numeric: Reactome DbId (e.g Mus musculus 48892) species want compare Homo sapiens. See rba_reactome_species Reactome Data Schema: Entries: Species. sort_by Sort result based column? available choices : \"NAME\", \"TOTAL_ENTITIES\", \"TOTAL_INTERACTORS\", \"TOTAL_REACTIONS\", \"FOUND_ENTITIES\", \"FOUND_INTERACTORS\", \"FOUND_REACTIONS\", \"ENTITIES_RATIO\", \"ENTITIES_PVALUE\", \"ENTITIES_FDR\" \"REACTIONS_RATIO\" order Sort Order. Can either \"ASC\" (default) \"DESC\". resource Filter results based resource. Default \"TOTAL\", available choices : \"TOTAL\", \"UNIPROT\", \"ENSEMBL\", \"CHEBI\", \"IUPHAR\", \"MIRBASE\", \"NCBI_PROTEIN\", \"EMBL\", \"COMPOUND\", \"ENTITIES_FDR\" \"PUBCHEM_COMPOUND\". p_value Set P value threshold. results P value equal less supplied threshold returned. (default = 1, Meaning P value filtering) min (numeric) Minimum number entities pathways included results. max (numeric) Maximum number entities pathways included results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"List results comparison.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"Reactome incorporate manually curated human reactions PANTHER's protein homology data Computationally infer events eukaryotic species. version 73 (11 June 2020), using orthology-based approach, Homo sapiens events projected 18,654 orthologous pathways ( 81,835 orthologous proteins) 15 non-human species. See Reactome Computationally Inferred Events information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"\"GET https://reactome.org/AnalysisService/species/homoSapiens/{species}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_species.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Compare Human Pathways with with Other Species — rba_reactome_analysis_species","text":"","code":"# \\donttest{ rba_reactome_analysis_species(species_dbid = 48892) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":null,"dir":"Reference","previous_headings":"","what":"Return the Results Associated with a Token — rba_reactome_analysis_token","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"Use token generated Reactome analysis (via rba_reactome_analysis) Retrieve analysis results. output format identical returned object rba_reactome_analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"","code":"rba_reactome_analysis_token( token, species, sort_by = \"ENTITIES_PVALUE\", order = \"ASC\", resource = \"TOTAL\", p_value = NULL, include_disease = TRUE, min = NULL, max = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"token token associated previous Reactome analysis. species Numeric Character: NCBI Taxonomy identifier (Human 9606), species name (e.g. \"Homo sapiens\") Reactome DbId (e.g Homo sapiens 48887). See rba_reactome_species Reactome Data Schema: Entries: Species. sort_by Sort result based column? available choices : \"NAME\", \"TOTAL_ENTITIES\", \"TOTAL_INTERACTORS\", \"TOTAL_REACTIONS\", \"FOUND_ENTITIES\", \"FOUND_INTERACTORS\", \"FOUND_REACTIONS\", \"ENTITIES_RATIO\", \"ENTITIES_PVALUE\", \"ENTITIES_FDR\" \"REACTIONS_RATIO\" order Sort Order. Can either \"ASC\" (default) \"DESC\". resource Filter results based resource. Default \"TOTAL\", available choices : \"TOTAL\", \"UNIPROT\", \"ENSEMBL\", \"CHEBI\", \"IUPHAR\", \"MIRBASE\", \"NCBI_PROTEIN\", \"EMBL\", \"COMPOUND\", \"ENTITIES_FDR\" \"PUBCHEM_COMPOUND\". p_value Set P value threshold. results P value equal less supplied threshold returned. (default = 1, Meaning P value filtering) include_disease Logical (default = TRUE) disease pathways included results? min (numeric) Minimum number entities pathways included results. max (numeric) Maximum number entities pathways included results. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"List containing results information analysis.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"Analysis, Reactome associate token analysis. can later used function requires token (e.g retrieve analysis results, download pdf). Note Reactome store token 7 days. can download full results rba_reactome_analysis_download, re-import anytime reactome (using rba_reactome_analysis_import) generate new token.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"\"GET https://reactome.org/AnalysisService/token/{token}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Analysis Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_analysis_token.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Return the Results Associated with a Token — rba_reactome_analysis_token","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_analysis_token(token = \"MjAyMDEwMTYwMTI3MTNfMjY1MjM\", species = 9606) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Complexes That Include a Molecule — rba_reactome_complex_list","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"function retrieve list complexes include supplied molecule component.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"","code":"rba_reactome_complex_list(id, resource, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"id Molecule's external Identifier resource resource supplied ID? see: Reactome External Identifiers ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"Data frame row complex containing supplied molecule columns pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"\"GET https://reactome.org/ContentService/data/complexes/{resource}/ {identifier}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_list.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Complexes That Include a Molecule — rba_reactome_complex_list","text":"","code":"# \\donttest{ rba_reactome_complex_list(id = \"3845\", resource = \"NCBI Gene\") # } # \\donttest{ rba_reactome_complex_list(id = \"P00533\", resource = \"UniProt\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":null,"dir":"Reference","previous_headings":"","what":"Get a Complex's Subunits — rba_reactome_complex_subunits","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"function return list subunits participants supplied complex.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"","code":"rba_reactome_complex_subunits(complex_id, exclude_structures = FALSE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"complex_id Reactome stable Identifier complex. exclude_structures (logical) contained complexes entity sets excluded results? (default = FALSE) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"Data frame row subunit supplied complex columns pertinent information subunit.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"Subunits returned recursively; means subunit complex, subunit complex also returned results.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"\"GET https://reactome.org/ContentService/data/complex/{id}/subunits\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_complex_subunits.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get a Complex's Subunits — rba_reactome_complex_subunits","text":"","code":"# \\donttest{ rba_reactome_complex_subunits(complex_id = \"R-HSA-5674003\", exclude_structures = FALSE) # } # \\donttest{ rba_reactome_complex_subunits(complex_id = \"R-HSA-109783\", exclude_structures = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":null,"dir":"Reference","previous_headings":"","what":"Reactome Diseases — rba_reactome_diseases","title":"Reactome Diseases — rba_reactome_diseases","text":"function Retrieve list diseases disease DOIDs annotated Reactome.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Reactome Diseases — rba_reactome_diseases","text":"","code":"rba_reactome_diseases(doid = FALSE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Reactome Diseases — rba_reactome_diseases","text":"doid (logical) Return disease DOIDs instead diseases? (default = FALSE) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Reactome Diseases — rba_reactome_diseases","text":"Data frame containing disease annotation available Reactome. doid set TRUE, DOID info returned instead.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Reactome Diseases — rba_reactome_diseases","text":"\"GET https://reactome.org/ContentService/data/diseases\" \"GET https://reactome.org/ContentService/data/diseases/doid\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Reactome Diseases — rba_reactome_diseases","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_diseases.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Reactome Diseases — rba_reactome_diseases","text":"","code":"# \\donttest{ rba_reactome_diseases() # } # \\donttest{ rba_reactome_diseases(doid = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"function retrieve list containing forms supplied Physical Entity ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"","code":"rba_reactome_entity_other_forms(entity_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"entity_id Reactome's entity ID. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"Data frame row forms supplied Entity ID columns pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"According Reactome API documentation, \"forms Physical Entities share Reference Entity identifier, e.g. PTEN H93R R-HSA-2318524 PTEN C124R R-HSA-2317439 two forms PTEN.\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"\"GET https://reactome.org/ContentService/data/entity/{id}/otherForms\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_entity_other_forms.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Other forms of a Reactome Entity — rba_reactome_entity_other_forms","text":"","code":"# \\donttest{ rba_reactome_entity_other_forms(\"R-HSA-199420\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"Along Reactome's events hierarchy, function retrieve events beginning supplied event \"Top level Pathway\". see \"Details section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"","code":"rba_reactome_event_ancestors(event_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"event_id Reactome event's identifier. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"List every element Data frame listing supplied event along ancestor events. given event can part one pathway hierarchy, list may contain multiple data frames.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"Reactome's definition, Events building blocks biological processes two main classes: \"Pathway\" \"Reaction-like events\". events organized hierarchical structure; event child parent another event; hierarchy always begin \"Top level pathway\" event. Also note given event part one hierarchies.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"\"GET https://reactome.org/ContentService/data/event/{id}/ancestors\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_ancestors.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Reactome Events Ancestors — rba_reactome_event_ancestors","text":"","code":"# \\donttest{ rba_reactome_event_ancestors(\"R-HSA-5673001\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"function retrieve full Events hierarchy supplied species. Directly species, child element \"top Level Pathway\". can traverse events tree following \"children\" element.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"","code":"rba_reactome_event_hierarchy(species, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"species Numeric Character: NCBI Taxonomy identifier (Human Taxonomy ID 9606.) species name (e.g. \"Homo sapiens\"). See rba_reactome_species Reactome Data Schema: Entries: Species. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"List representation species's events hierarchy described \"Details section\".","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"Reactome's definition, Events building blocks biological processes two main classes: \"Pathway\" \"Reaction-like events\". events organized hierarchical structure; event child parent another event; hierarchy always begin \"Top level pathway\" event. Also note given event part one hierarchies.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"\"GET https://reactome.org/ContentService/data/eventsHierarchy/{species}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_event_hierarchy.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Full Event Hierarchy of a Species — rba_reactome_event_hierarchy","text":"","code":"if (FALSE) { # \\dontrun{ #very large response! rba_reactome_event_hierarchy(\"Homo sapiens\") } # } if (FALSE) { # \\dontrun{ #very large response! rba_reactome_event_hierarchy(9606) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":null,"dir":"Reference","previous_headings":"","what":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"function called two scenarios: create_document = FALSE: retrieve image event's Diagram. create_document = TRUE: retrieve PDF document event's diagram image additional information. see \"Details section\" information","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"","code":"rba_reactome_exporter_diagram( event_id, save_to = NULL, create_document = FALSE, resource = \"TOTAL\", diagram_profile = \"Modern\", analysis_profile = \"Standard\", token = NULL, exp_column = NULL, document_level = 1, output_format = \"png\", image_quality = 5, flag_element = NULL, flg_interactors = TRUE, sel = NULL, title = TRUE, margin = 15, ehld = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"event_id Reactome event's identifier. save_to NULL Character: NULL: Save file automatically-generated path. Character string: valid file path save file . create_document logical: Create PDF document instead image? ( default = FALSE) resource analysis resource results overlaid top given pathways overview, diagram_profile Color profile diagrams, either \"Modern\" (default) \"Standard\". analysis_profile Color profile analysis, one : \"Standard\" (default), \"Strosobar\" \"Copper Plus\" token analysis Token results overlaid top given pathways overview. see: rba_reactome_analysis. exp_column numeric: (token supplied) Specify expression column overlay. document_level numeric: (\"create_document\" TRUE) 0 (default) event's children included PDF document. Set 1 include event's children. output_format (\"create_document\" FALSE) Image format saved diagram. Can one : png (default), jpeg, svg gif. image_quality Numeric: (\"create_document\" FALSE), number ranging 1 10. 1 lowest quality 10 highest (default = 5). flag_element (\"create_document\" FALSE) gene name, protein ID, chemical ID Reactome ID diagram's element flagged. flg_interactors Logical: (\"create_document\" FALSE) interactor considered flagging diagram element? (default = TRUE) sel (\"create_document\" FALSE) CSV line highlighting element(s) selection diagram. title Logical: (\"create_document\" FALSE) pathway name displayed image? (default = TRUE) margin Numeric: (\"create_document\" FALSE) number ranging 0 20 set image's margin. (default = 15) ehld logical: (\"create_document\" FALSE) \"Enhanced High Level Diagram\" considered? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"NULL, Based inputs, image PDF file saved disk.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"function called create_document = FALSE: result image format supplied \"output_format\" argument. supplied event ID refers pathway, image's content pathways diagram. supplied event ID refers sub-pathway reaction event, parent pathway's diagram exported, reaction sub-pathway's events highlighted. Note export image reaction-like event separately, use rba_reactome_exporter_reaction. function called create_document = TRUE: PDF document contain image event's diagram following information events: Summation, Literature references, Edit history type, location, compartments diseases. note call function \"document level = 1\", information supplied event's children also included.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"\"GET https://reactome.org/ContentService/exporter/diagram/{identifier} .{ext}\" \"GET https://reactome.org/ContentService/exporter/document/event/ {identifier}.pdf\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_diagram.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get a Reactome Event Diagram — rba_reactome_exporter_diagram","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_exporter_diagram(event_id = \"R-HSA-177929\", create_document = FALSE) } # } if (FALSE) { # \\dontrun{ rba_reactome_exporter_diagram(event_id = \"R-HSA-6787403\", create_document = FALSE) } # } if (FALSE) { # \\dontrun{ rba_reactome_exporter_diagram(event_id = \"R-HSA-177929\", create_document = TRUE) } # } if (FALSE) { # \\dontrun{ rba_reactome_exporter_diagram(event_id = \"R-HSA-177929\", output_format = \"svg\", save_to = \"reactome_event_diagram.svg\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":null,"dir":"Reference","previous_headings":"","what":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"function export supplied Reactome Event (Pathway Reaction) SBGN (Systems Biology Graphical Notation) SBML (Systems Biology Markup Language)","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"","code":"rba_reactome_exporter_event(event_id, output_format, save_to = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"event_id Reactome event's database IDs (DbId) Stable IDs (StId). output_format Either \"sbgn\" \"sbml\". save_to NULL Character: NULL: Save file automatically-generated path. Character string: valid file path save file . ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"NULL, According inputs, SBGN SBML file saved disk.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"\"GET https://reactome.org/ContentService/exporter/event/ {identifier}.sbgn\" \"GET https://reactome.org/ContentService/exporter/event/ {identifier}.sbml\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_event.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Exports A Reactome Event to SBGN or SBML — rba_reactome_exporter_event","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_exporter_event(event_id = \"R-HSA-177929\", output_format = \"sbgn\", save_to = \"R-HSA-177929.sbgn\") } # } if (FALSE) { # \\dontrun{ rba_reactome_exporter_event(event_id = \"R-HSA-177929\", output_format = \"sbgn\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":null,"dir":"Reference","previous_headings":"","what":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"function Save Pathway Overview supplied specie image file.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"","code":"rba_reactome_exporter_overview( species, output_format = \"png\", save_to = NULL, image_quality = 5, flag_element = NULL, flg_interactors = TRUE, sel = NULL, title = TRUE, margin = 15, diagram_profile = \"Copper\", token = NULL, resource = \"TOTAL\", exp_column = NULL, coverage = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"species Numeric Character: NCBI Taxonomy identifier (Human Taxonomy ID 9606.) species name (e.g. \"Homo sapiens\"). See rba_reactome_species Reactome Data Schema: Entries: Species. output_format Images format, Can one : png (default), jpeg, svg gif. save_to NULL Character: NULL: Save file automatically-generated path. Character string: valid file path save file . image_quality Numeric: number ranging 1 10. 1 lowest quality 10 highest (default = 5). flag_element Gene name, protein ID, chemical ID Reactome ID diagram's element flagged. flg_interactors Logical: interactor considered flagging diagram element? (default = TRUE) sel CSV line highlighting element(s) selection diagram. title Logical: pathway name displayed image? (default = TRUE) margin Numeric: number ranging 0 20 set image's margin. (default = 15) diagram_profile Color profile diagrams, one \"Copper\" (default), \"Copper Plus\", \"Barium Lithium\" \"calcium salts\". token analysis Token results overlaid top given pathways overview. see: rba_reactome_analysis. resource analysis resource results overlaid top given pathways overview. exp_column numeric: (token supplied) Specify expression column overlay. coverage Logical: analysis coverage values overlaid? (default = FALSE) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"NULL, Based inputs, image file saved disk.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"\"GET https://reactome.org/ContentService/exporter/fireworks/{species}.{ext}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_overview.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get a Reactome Pathway Overview — rba_reactome_exporter_overview","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_exporter_overview(species = 9606, output_format = \"svg\", save_to = \"human_pathways.svg\") } # } if (FALSE) { # \\dontrun{ rba_reactome_exporter_overview(species = 9606, token = 123456789) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":null,"dir":"Reference","previous_headings":"","what":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"function Save Reactome event class \"ReactionLikeEvent\" image file.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"","code":"rba_reactome_exporter_reaction( event_id, save_to = NULL, output_format = \"png\", resource = \"TOTAL\", diagram_profile = \"Modern\", analysis_profile = \"Standard\", token = NULL, exp_column = NULL, image_quality = 5, flag_element = NULL, flg_interactors = TRUE, sel = NULL, title = TRUE, margin = 15, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"event_id Reactome Reaction-like event's identifier. save_to NULL Character: NULL: Save file automatically-generated path. Character string: valid file path save file . output_format Images format, Can one : png (default), jpeg, svg gif. resource analysis resource results overlaid top given pathways overview. diagram_profile Color profile diagrams, one \"Copper\" (default), \"Copper Plus\", \"Barium Lithium\" \"calcium salts\". analysis_profile Color profile analysis, one : \"Standard\" (default), \"Strosobar\" \"Copper Plus\". token analysis Token results overlaid top given pathways overview. see: rba_reactome_analysis. exp_column numeric: (token supplied) Specify expression column overlay. image_quality Numeric: number ranging 1 10. 1 lowest quality 10 highest (default = 5). flag_element Gene name, protein ID, chemical ID Reactome ID diagram's element flagged. flg_interactors Logical: interactor considered flagging diagram element? (default = TRUE) sel CSV line highlighting element(s) selection diagram. title Logical: pathway name displayed image? (default = TRUE) margin Numeric: number ranging 0 20 set image's margin. (default = 15) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"NULL, Based inputs, image file saved disk.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"Note function save Reaction-like event separately parent pathway context. overlay Reaction parent pathway, use rba_reactome_exporter_diagram.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"\"GET https://reactome.org/ContentService/exporter/reaction/ {identifier}.{ext}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_exporter_reaction.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get a Reactome Reaction Event — rba_reactome_exporter_reaction","text":"","code":"if (FALSE) { # \\dontrun{ rba_reactome_exporter_diagram(event_id = \"R-HSA-6787403\", create_document = FALSE) } # } if (FALSE) { # \\dontrun{ rba_reactome_exporter_diagram(event_id = \"R-HSA-6787403\", output_format = \"svg\", save_to = \"reactome_reacion_image.svg\") } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":null,"dir":"Reference","previous_headings":"","what":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"can call function two scenarios: 1- retrieve information available PSICQUIC resources, call function without providing argument; .e rba_reactome_interactors_psicquic(). 2-retrieve list interactors specific protein(s), fill function's arguments.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"","code":"rba_reactome_interactors_psicquic( proteins = NULL, resource = NULL, details = TRUE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"proteins Proteins retrieve PSICQUIC interactors. resource PSICQUIC resource supplied proteins. Call rba_reactome_interactors_psicquic() without argument get available options. details Logical: TRUE (default) detailed list interactors returned. FALSE, summary available interactors returned. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"Depending input, list containing detailed summary PSICQUIC interactions data frame registered PSICQUIC resources.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"\"POST https://reactome.org/ContentService/interactors/psicquic/molecules/ {resource}/details\" \"POST https://reactome.org/ContentService/interactors/psicquic/molecules/ {resource}/summary\" \"GET https://reactome.org/ContentService/interactors/psicquic/resources\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_psicquic.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"The interface From Reactome to PSICQUIC — rba_reactome_interactors_psicquic","text":"","code":"# \\donttest{ rba_reactome_interactors_psicquic() # } # \\donttest{ rba_reactome_interactors_psicquic(proteins = c(\"TP53\", \"MYC\"), resource = \"BioGrid\", details = FALSE) # } # \\donttest{ rba_reactome_interactors_psicquic(proteins = c(\"TP53\", \"MYC\"), resource = \"BioGrid\", details = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"Reactome maintain locally host version IntAct(Static) interactions database. Using function, can retrieve IntAct information protein(s) two scenarios: endpoint = \"details\" \"summary\": Retrieve detailed/summary information supplied protein accession(s) IntAct database. endpoint = \"pathway\", Retrieve list Reactome pathways include supplied protein accession. Pathways class \"TopLevelPathway\" excluded.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"","code":"rba_reactome_interactors_static( proteins, endpoint = \"details\", only_diagrammed = FALSE, species = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"proteins Uniprot proteins accession(s). endpoint = \"pathway\", single protein accession can supplied. endpoint Can one : \"details\": return detailed information supplied protein(s) accession. \"summary\": return summary supplied protein(s) accession \"pathway\": return list pathways containing interacting molecules (excluding TopLevelPathway class). only_diagrammed Logical: (\"endpoint = \"pathway\") TRUE, pathways without diagram excluded. (default = FALSE) species \"endpoint = \"pathway\", scientific name species search pathways. See rba_reactome_species Reactome Data Schema: Entries: Species. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"List content varies based supplied \"endpoint\" argument.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"\"POST https://reactome.org/ContentService/interactors/static/ molecules/details\" \"POST https://reactome.org/ContentService/interactors/static/ molecules/summary\" \"GET https://reactome.org/ContentService/interactors/static/ molecules/pathways\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_interactors_static.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Static(IntAct) Interaction Information of a Protein — rba_reactome_interactors_static","text":"","code":"# \\donttest{ rba_reactome_interactors_static(proteins = \"Q9BXM7-1\", endpoint = \"pathways\", species = \"Homo sapiens\") # } # \\donttest{ rba_reactome_interactors_static(proteins = c(\"Q9BXM7-1\", \"Q13501\"), endpoint = \"details\") # } # \\donttest{ rba_reactome_interactors_static(proteins = c(\"Q9BXM7-1\", \"Q13501\"), endpoint = \"summary\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":null,"dir":"Reference","previous_headings":"","what":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"providing external identifier given resource, can retrieve list pathways/reactions include supplied ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"","code":"rba_reactome_mapping(id, resource, map_to, species = \"Homo sapiens\", ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"id Molecule's external Identifier resource resource supplied ID? see: Reactome External Identifiers map_to Either \"pathways\" \"reactions\". species Numeric Character: NCBI Taxonomy identifier (Human 9606), species name (e.g. \"Homo sapiens\") Reactome DbId (e.g Homo sapiens 48887). See rba_reactome_species Reactome Data Schema: Entries: Species. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"Data frame row pathway/reaction columns pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"\"GET https://reactome.org/ContentService/data/mapping/{resource}/ {identifier}/pathways\" \"GET https://reactome.org/ContentService/data/mapping/{resource}/ {identifier}/reactions\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_mapping.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Map External ID to Reactome Pathways/Reactions — rba_reactome_mapping","text":"","code":"# \\donttest{ rba_reactome_mapping(id = \"PTEN\", resource = \"UniProt\", map_to = \"reactions\", species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"Reactome incorporate manually curated human reactions PANTHER's protein homology data Computationally infer events eukaryotic species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"","code":"rba_reactome_orthology(event_ids, species_dbid, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"event_ids Human Reactome event ID(s) retrieve orthologous events. species_dbid Reactome database ID (DbId) target species. (e.g Mus musculus 48892). See rba_reactome_species Reactome Data Schema: Entries: Species. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"List containing found Orthologous event(s) supplied species pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"version 73 (11 June 2020), using orthology-based approach, Homo sapiens events projected 18,654 orthologous pathways ( 81,835 orthologous proteins) 15 non-human species. See Reactome Computationally Inferred Events information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"\"POST https://reactome.org/ContentService/data/orthologies/ids/ species/{speciesId}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_orthology.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Orthologous (Computationally Inferred) Events — rba_reactome_orthology","text":"","code":"# \\donttest{ rba_reactome_orthology(event_ids = c(\"R-HSA-6799198\", \" R-HSA-72764\"), species_dbid = 49633) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"function retrieve list complexes sets supplied entity ID participates (e.g. complex component, reaction output).","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"","code":"rba_reactome_participant_of(entity_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"entity_id Reactome's entity ID. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"List Reactome database Entities supplied ID participant .","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"\"GET https://reactome.org/ContentService/data/entity/{id}/componentOf\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participant_of.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Larger Reactome Structures Which Include an Entity — rba_reactome_participant_of","text":"","code":"# \\donttest{ rba_reactome_participant_of(entity_id = \"R-HSA-199420\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Participants of a Reactome Event — rba_reactome_participants","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"Participating molecules Reactome comprises set 'Physical Entity' 'Reference Entities' class objects. Use function retrieve , 'Physical Entity' 'Reference Entities' participants given event.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"","code":"rba_reactome_participants( event_id, only_physical_entities = FALSE, only_reference_entities = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"event_id Reactome event's database ID (DbId) Stable ID (StId). only_physical_entities Logical: TRUe, participating 'Physical Entities' returned. only_reference_entities Logical: TRUe, participating 'Reference Entities' returned. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"List participant supplied Event ID. Data frame physical 'Reference Entities' requested.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"'Physical Entity' Instance include individual molecule, multi-molecular complex set molecule forming group based characteristics. single molecule can different 'Physical Entity' instances based associated attributes. example, IgK Ig kappa chain, two 'Physical Entity' instances; one, ID \"R-HSA-197041\" refers secreted antibody protein extra-cellular region; second one ID \"R-HSA-2038819\" refers plasma-membrane-integrated form antibody protein. make possible link multiple 'Physical Entity' instances molecule, Reactome uses data class named \"'Reference Entities'\" correspond invariant attribute molecule. example, -mentioned 'Physical Entities' see 'Reference Entities' named \"UniProt:P01834 IGKC. See Reactome Data Model information data model Physical Entities.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"\"GET https://reactome.org/ContentService/data/participants/{id}\" \"GET https://reactome.org/ContentService/data/participants/{id}/ participatingPhysicalEntities\" \"GET https://reactome.org/ContentService/data/participants/{id}/ referenceEntities\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_participants.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Participants of a Reactome Event — rba_reactome_participants","text":"","code":"# \\donttest{ rba_reactome_participants(\"R-HSA-5682012\") # } # \\donttest{ rba_reactome_participants(\"R-HSA-5682012\", only_physical_entities = TRUE) # } # \\donttest{ rba_reactome_participants(\"R-HSA-5682012\", only_reference_entities = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"Reactome Event comprised events (meaning, pathway include pathways ). Use function recursively return events reside downstream supplied event ID ( attribute events).","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"","code":"rba_reactome_pathways_events(event_id, attribute_name = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"event_id Reactome event's database ID (DbId) Stable ID (StId). attribute_name attribute events returned instead whole events. see Reactome Data Schema: Event available options. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"Data frame row contained event columns event's attributes. \"attribute_name\" argument supplied, character vector returned.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"Reactome's definition, Events building blocks biological processes two main classes: \"Pathway\" \"Reaction-like events\". events organized hierarchical structure; event child parent another event; hierarchy always begin \"Top level pathway\" event. Also note given event part one hierarchies.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"\"GET https://reactome.org/ContentService/data/pathway/{id}/ containedEvents\" \"GET https://reactome.org/ContentService/data/pathway/{id}/ containedEvents/{attributeName}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_events.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Events Contained in an Upstream Events — rba_reactome_pathways_events","text":"","code":"# \\donttest{ rba_reactome_pathways_events(event_id = \"R-HSA-5673001\") # } # \\donttest{ rba_reactome_pathways_events(event_id = \"R-HSA-5673001\", attribute_name = \"displayName\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":null,"dir":"Reference","previous_headings":"","what":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"Use function search event hierarchy retrieve list lower level pathways (non TopLevelPathway class) contain given 'Physical Entity' Event. See \"Arguments section\" modify search.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"","code":"rba_reactome_pathways_low( entity_id, with_diagram = FALSE, all_forms = FALSE, species = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"entity_id entity exist pathways. with_diagram Logical: include pathways diagram? all_forms Logical: variants supplied entity_id considered? (e.g. molecule different compartment, secretory form etc.) see rba_reactome_participants's \"Details section\" learn Reactome classifies molecules. species (optional) Numeric Character: confine search specific species providing NCBI Taxonomy identifier (Human Taxonomy ID 9606) species name (e.g. \"Homo sapiens\"). See rba_reactome_species Reactome Data Schema: Entries: Species. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"Data frame row pathway contains supplied entity columns pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"\"GET https://reactome.org/ContentService/data/pathways/low/entity/{id}\" \"GET https://reactome.org/ContentService/data/pathways/low/diagram/ entity/{id}\" \"GET https://reactome.org/ContentService/data/pathways/low/diagram/ entity/{id}/allForms\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_low.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get lower level pathways Containing a 'Physical Entity' or Event — rba_reactome_pathways_low","text":"","code":"# \\donttest{ rba_reactome_pathways_low(entity_id = \"R-HSA-199420\") # } # \\donttest{ rba_reactome_pathways_low(entity_id = \"R-HSA-199420\", with_diagram = TRUE) # } # \\donttest{ rba_reactome_pathways_low(entity_id = \"R-HSA-199420\", with_diagram = TRUE, all_forms = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"function Return list pathways class \"TopLevelPathway\" annotated supplied species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"","code":"rba_reactome_pathways_top(species, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"species Numeric Character: NCBI Taxonomy identifier (Human Taxonomy ID 9606.) species name (e.g. \"Homo sapiens\"). See rba_reactome_species Reactome Data Schema: Entries: Species. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"Data frame row Top Level Pathway columns pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"Reactome's Events hierarchy specie begin pathways class \"TopLevelPathway\" (e.g. \"Immune System\", \"Metabolism proteins\"). event's hierarchy tree, TopLevelPathway events (e.g. \"Adaptive immune system\", \"Innate immune system\"). Based chosen pathway, hierarchy tree typically goes .","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"\"GET https://reactome.org/ContentService/data/pathways/top/{species}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_pathways_top.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Top Level Pathways in a Species — rba_reactome_pathways_top","text":"","code":"# \\donttest{ rba_reactome_pathways_top(species = 9606) # } # \\donttest{ rba_reactome_pathways_top(species = \"Saccharomyces cerevisiae\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":null,"dir":"Reference","previous_headings":"","what":"A person by his identifiers — rba_reactome_people_id","title":"A person by his identifiers — rba_reactome_people_id","text":"person identifiers","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"A person by his identifiers — rba_reactome_people_id","text":"","code":"rba_reactome_people_id( person_id, authored_pathways = FALSE, publications = FALSE, attribute_name = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"A person by his identifiers — rba_reactome_people_id","text":"person_id Reactome database ID (DbId) ORCHID ID authored_pathways Logical: return Pathway list authored person? (default = FALSE) publications Logical: return publications list authored person? (Defalt = FALSE) attribute_name (optional) Reactome person attribute return . see Reactome Data Schema: person available options. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"A person by his identifiers — rba_reactome_people_id","text":"List containing requested informations supplied person.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"A person by his identifiers — rba_reactome_people_id","text":"\"GET https://reactome.org/ContentService\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"A person by his identifiers — rba_reactome_people_id","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_id.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"A person by his identifiers — rba_reactome_people_id","text":"","code":"# \\donttest{ rba_reactome_people_id(\"391309\") # } # \\donttest{ rba_reactome_people_id(person_id = \"391309\", authored_pathways = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Persons Information by Name — rba_reactome_people_name","title":"Get Persons Information by Name — rba_reactome_people_name","text":"Using function can query people partially matching exact name retrieve list matching people Reactome.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Persons Information by Name — rba_reactome_people_name","text":"","code":"rba_reactome_people_name(person_name, exact_match = FALSE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Persons Information by Name — rba_reactome_people_name","text":"person_name first last name person exact_match Logical: supplied name considered exact match? (default = FALSE) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Persons Information by Name — rba_reactome_people_name","text":"List element search hit contains person's information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Persons Information by Name — rba_reactome_people_name","text":"\"GET https://reactome.org/ContentService/data/people/name/{name}\" \"GET https://reactome.org/ContentService/data/people/name/{name}/exact\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Persons Information by Name — rba_reactome_people_name","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_people_name.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Persons Information by Name — rba_reactome_people_name","text":"","code":"# \\donttest{ rba_reactome_people_name(\"Jupe\") # } # \\donttest{ rba_reactome_people_name(\"Steve Jupe\", exact_match = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":null,"dir":"Reference","previous_headings":"","what":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"Using Comprehensive function, can Retrieve object Reactome knowledge-base","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"","code":"rba_reactome_query( ids, enhanced = FALSE, map = FALSE, attribute_name = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"ids single Multiple database IDs (DbId), Stable IDs (StId) mixture . enhanced Logical: (Default = FALSE) 'TRUE' information supplied entry returned. (can set argument 'TRUE' supply single ID). map (Default = FALSE) supplied IDs mapped? argument considered supply multiple IDs. (e.g. supply previous version stable identifiers.) attribute_name (Optional) Return Attribute supplied Database Object. (can use argument supply single ID) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"List containing query outputs.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"\"POST https://reactome.org/ContentService/data/query/ids\" \"POST https://reactome.org/ContentService/data/query/ids/map\" \"GET https://reactome.org/ContentService/data/query/{id}\" \"GET https://reactome.org/ContentService/data/query/enhanced/{id}\" \"GET https://reactome.org/ContentService/data/query/{id}/{attributeName}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_query.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Query and Retrieve any Reactome knowledge-base Object — rba_reactome_query","text":"","code":"# \\donttest{ rba_reactome_query(ids = c(\"8953958\", \"11982506\", \"R-ALL-9649879\")) # } # \\donttest{ rba_reactome_query(ids = \"R-HSA-9656256\", enhanced = TRUE) # } # \\donttest{ rba_reactome_query(ids = \"8863054\", attribute_name = \"displayName\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Reactome Species — rba_reactome_species","title":"Get Reactome Species — rba_reactome_species","text":"Use function retrieve table Available species Reactome.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Reactome Species — rba_reactome_species","text":"","code":"rba_reactome_species(only_main = FALSE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Reactome Species — rba_reactome_species","text":"only_main Logical: set TRUE, return species either manually-curated computationally inferred pathways. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Reactome Species — rba_reactome_species","text":"Data frame row species columns pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Reactome Species — rba_reactome_species","text":"\"GET https://reactome.org/ContentService/data/species/\" \"GET https://reactome.org/ContentService/data/species/main\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Reactome Species — rba_reactome_species","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_species.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Reactome Species — rba_reactome_species","text":"","code":"# \\donttest{ rba_reactome_species() # } # \\donttest{ rba_reactome_species(only_main = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":null,"dir":"Reference","previous_headings":"","what":"The version number of current database — rba_reactome_version","title":"The version number of current database — rba_reactome_version","text":"Returns current version Reactome database.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"The version number of current database — rba_reactome_version","text":"","code":"rba_reactome_version(...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"The version number of current database — rba_reactome_version","text":"... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"The version number of current database — rba_reactome_version","text":"Character string containing version Reactome database.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"The version number of current database — rba_reactome_version","text":"\"GET https://reactome.org/ContentService/data/database/version\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"The version number of current database — rba_reactome_version","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_version.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"The version number of current database — rba_reactome_version","text":"","code":"# \\donttest{ rba_reactome_version() # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":null,"dir":"Reference","previous_headings":"","what":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"Use function retrieve list Reactome ReferenceEntity associated supplied Cross Reference (.e. External) ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"","code":"rba_reactome_xref(xref_id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"xref_id molecule's cross-reference (external) identifier. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"List containing ReferenceEntity corresponding supplied cross-reference (external) ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"Reactome cross-references external database's identifiers database Entries named ReferenceEntity, resembles invariant aspect molecule. Thus one--many relationship Reactome's ReferenceEntity object molecule's ID external databases, Reactome's terms called Cross Reference. See rba_reactome_participants's \"Details section\" learn Reactome classifies molecules.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"\"GET https://reactome.org/ContentService/references/mapping/{identifier}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"Marc Gillespie, Bijay Jassal, Ralf Stephan, Marija Milacic, Karen Rothfels, Andrea Senff-Ribeiro, Johannes Griss, Cristoffer Sevilla, Lisa Matthews, Chuqiao Gong, Chuan Deng, Thawfeek Varusai, Eliot Ragueneau, Yusra Haider, Bruce May, Veronica Shamovsky, Joel Weiser, Timothy Brunson, Nasim Sanati, Liam Beckman, Xiang Shao, Antonio Fabregat, Konstantinos Sidiropoulos, Julieth Murillo, Guilherme Viteri, Justin Cook, Solomon Shorser, Gary Bader, Emek Demir, Chris Sander, Robin Haw, Guanming Wu, Lincoln Stein, Henning Hermjakob, Peter D’Eustachio, reactome pathway knowledgebase 2022, Nucleic Acids Research, 2021;, kab1028, https://doi.org/10.1093/nar/gkab1028 Griss J, Viteri G, Sidiropoulos K, Nguyen V, Fabregat , Hermjakob H. ReactomeGSA - Efficient Multi-Omics Comparative Pathway Analysis. Mol Cell Proteomics. 2020 Sep 9. doi: 10.1074/mcp. PubMed PMID: 32907876. Reactome Content Services API Documentation Citations note Reactome website","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_reactome_xref.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Map Cross References IDs to Reactome ReferenceEntity — rba_reactome_xref","text":"","code":"# \\donttest{ rba_reactome_xref(\"CD40\") # } # \\donttest{ rba_reactome_xref(\"ENSP00000361350\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":null,"dir":"Reference","previous_headings":"","what":"Retrieving Functional Annotation — rba_string_annotations","title":"Retrieving Functional Annotation — rba_string_annotations","text":"STRING cross-reference proteins several databases (see \"Details\" section). providing input set o proteins (optionally background universe protein set), can use function retrieve full set terms (annotations) pertinent input proteins database, among information term.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Retrieving Functional Annotation — rba_string_annotations","text":"","code":"rba_string_annotations( ids, species = NULL, allow_pubmed = FALSE, split_df = TRUE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Retrieving Functional Annotation — rba_string_annotations","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) allow_pubmed logical: (default = FALSE) PubMed usually assigns large number reference publications protein. order reduce output size, PubMed's results excluded results, unless stated otherwise setting argument TRUE. split_df (logical, default = TRUE), TRUE, instead one data frame, results different categories split multiple data frames based 'category'. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Retrieving Functional Annotation — rba_string_annotations","text":"data frame every row assigned terms columns terms category, description, number genes, pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Retrieving Functional Annotation — rba_string_annotations","text":"STRING currently maps retrieve enrichment results based Gene Ontology (GO), KEGG pathways, UniProt Keywords, PubMed publications, Pfam domains, InterPro domains, SMART domains. Note function return full list terms containing supplied proteins. perform enrichment retrieve enriched subset terms, use rba_string_enrichment.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Retrieving Functional Annotation — rba_string_annotations","text":"\"POST https://string-db.org/api/{output_format}/functional_annotation? identifiers={your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Retrieving Functional Annotation — rba_string_annotations","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_annotations.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Retrieving Functional Annotation — rba_string_annotations","text":"","code":"# \\donttest{ rba_string_annotations(ids = \"TP53\", species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":null,"dir":"Reference","previous_headings":"","what":"Getting Functional Enrichment — rba_string_enrichment","title":"Getting Functional Enrichment — rba_string_enrichment","text":"STRING cross-reference proteins several databases (see \"Details\" section). providing input set o proteins (optionally background universe protein set), can use function perform enrichment test retrieve list enriched terms database, among pertinent information term. Use rba_string_enrichment_image retrieve analysis results plot.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Getting Functional Enrichment — rba_string_enrichment","text":"","code":"rba_string_enrichment( ids, species = NULL, background = NULL, split_df = TRUE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Getting Functional Enrichment — rba_string_enrichment","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. Note one id supplied, STRING expands network 10 proteins. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) background character vector: set STRING protein IDs used statistical background (universe) computing P-value terms. STRING IDs acceptable. (See rba_string_map_ids map IDs.) split_df (logical, default = TRUE), TRUE, instead one data frame, results different categories split multiple data frames based 'category'. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Getting Functional Enrichment — rba_string_enrichment","text":"list data frames every row enriched terms p-value smaller 0.1 columns terms category, description, number genes, p-value, fdr pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Getting Functional Enrichment — rba_string_enrichment","text":"STRING currently maps retrieve enrichment results based Gene Ontology (GO), KEGG pathways, UniProt Keywords, PubMed publications, Pfam domains, InterPro domains, SMART domains. Note function return enriched terms pertinent proteins p-value lesser 0.1. retrieve full list terms -unfiltered enrichment p-values-, use rba_string_annotations.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Getting Functional Enrichment — rba_string_enrichment","text":"\"POST https://string-db.org/api/{output_format}/enrichment?identifiers= {your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Getting Functional Enrichment — rba_string_enrichment","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Getting Functional Enrichment — rba_string_enrichment","text":"","code":"# \\donttest{ rba_string_enrichment(ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":null,"dir":"Reference","previous_headings":"","what":"Get STRING Enrichment Plot — rba_string_enrichment_image","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"addition performing enrichment analysis, STRING allows also visualize analysis results. Use rba_string_enrichment retrieve analysis results data frame.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"","code":"rba_string_enrichment_image( ids, species, category = \"Process\", image_format = \"image\", save_image = TRUE, group_by_similarity = NULL, color_palette = \"mint_blue\", number_of_term_shown = 10, x_axis = \"signal\", ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. Note one id supplied, STRING expands network 10 proteins. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. category terms set use perform enrichment analysis. valid values (See details info): \"Process\" (default), \"Function\", \"Component\", \"Keyword\", \"KEGG\", \"RCTM\", \"HPO\", \"MPO\", \"DPO\", \"WPO\", \"ZPO\", \"FYPO\", \"Pfam\", \"SMART\", \"InterPro\", \"PMID\", \"NetworkNeighborAL\", \"COMPARTMENTS\", \"TISSUES\", \"DISEASES\", \"WikiPathways\" image_format one : \"image\": PNG image normal resolution. \"highres_image\": High-resolution PNG image. \"svg\": Scalable Vector Graphics image. save_image Logical Character: TRUE: Save image automatically-generated path. FALSE: save image, just return R object. Character string: valid file path save image . group_by_similarity Jackard index treshold visually group related terms. Valid values 0.1 1 increment 0.1. Default value NULL (.e. grouping). color_palette Color pallet code FDR values. Valid values : \"mint_blue\" (default), \"lime_emerald\", \"green_blue\", \"peach_purple\", \"straw_navy\", \"yellow_pink\" number_of_term_shown (default: 10) Maximum number results include plot. x_axis variable show x axis rank results based . Valid values : \"signal\" (default), \"strength\", \"FDR\", \"gene_count\" ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"plot summarizing enrichment results, can PNG SVG depending inputs.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"Available values category follow. Default value \"Process\". Process: Biological Process (Gene Ontology) Function: Molecular Function (Gene Ontology) Component: Cellular Component (Gene Ontology) Keyword: Annotated Keywords (UniProt) KEGG: KEGG Pathways RCTM: Reactome Pathways HPO: Human Phenotype (Monarch) MPO: Mammalian Phenotype Ontology (Monarch) DPO: Drosophila Phenotype (Monarch) WPO: C. elegans Phenotype Ontology (Monarch) ZPO: Zebrafish Phenotype Ontology (Monarch) FYPO: Fission Yeast Phenotype Ontology (Monarch) Pfam: Protein Domains (Pfam) SMART: Protein Domains (SMART) InterPro: Protein Domains Features (InterPro) PMID: Reference Publications (PubMed) NetworkNeighborAL: Local Network Cluster (STRING) COMPARTMENTS: Subcellular Localization (COMPARTMENTS) TISSUES: Tissue Expression (TISSUES) DISEASES: Disease-gene Associations (DISEASES) WikiPathways: WikiPathways","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"\"POST https://string-db.org/api/{output_format}/enrichmentfigure\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_image.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get STRING Enrichment Plot — rba_string_enrichment_image","text":"","code":"if (FALSE) { # \\dontrun{ rba_string_enrichment( ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606) } # } if (FALSE) { # \\dontrun{ rba_string_enrichment( ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606, category = \"KEGG\") } # } if (FALSE) { # \\dontrun{ rba_string_enrichment( ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606, x_axis = \"strength\", number_of_term_shown = 20 ) } # } if (FALSE) { # \\dontrun{ rba_string_enrichment( ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606, color_palette = \"straw_navy\" ) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"Even annotation input proteins, STRING can Compare Given proteins interactions pattern background proteome-wide interaction distribution determine given set proteins functionally related.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"","code":"rba_string_enrichment_ppi( ids, species = NULL, required_score = NULL, background = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) required_score Numeric: minimum interaction score interaction included image. supplied, threshold applied STRING Based network. (low Confidence = 150, Medium Confidence = 400, High Confidence = 700, Highest confidence = 900) background character vector: set STRING protein IDs used background proteome. STRING IDs acceptable. (See rba_string_map_ids map IDs.) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"list protein-protein interaction enrichment results.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"\"POST https://string-db.org/api/{output_format}/ppi_enrichment?identifiers= {your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_enrichment_ppi.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Protein-Protein Interaction Enrichment — rba_string_enrichment_ppi","text":"","code":"# \\donttest{ rba_string_enrichment_ppi(ids = c(\"p53\", \"BRCA1\", \"cdk2\", \"Q99835\", \"CDC42\", \"CDK1\", \"KIF23\", \"PLK1\", \"RAC2\", \"RACGAP1\"), species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"Using function, can retrieve highest Smith-Waterman bit scores among input proteins proteins every STRING species (e.g. closest homologous protein input protein species). Bit Scores serve similarity scores protein sequence; , according STRING documentations, proxy protein homology.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"","code":"rba_string_homology_inter(ids, species = NULL, species_b = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. species Numeric: NCBI Taxonomy identifier input proteins; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) species_b (optional) Numeric: one NCBI Taxonomy identifiers species limit closets homologous proteins search. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"data frame input proteins closest homologous proteins among (defined) STRING species.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"Note function return highest similarity score hits given protein(s) closets homologous proteins species. retrieve similarity scores different proteins within species see rba_string_homology_intra. Similarity matrix imported -STRING- : Similarity Matrix Proteins (SIMAP)","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"\"POST https://string-db.org/api/{output-format}/homology_best? identifiers={your_identifiers}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_inter.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Similarity Scores Hits of Proteins in Different Species — rba_string_homology_inter","text":"","code":"# \\donttest{ rba_string_homology_inter(ids = \"p53\", species = 9606, species_b = 7070) # } # \\donttest{ rba_string_homology_inter(ids = \"ENSP00000269305\", species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"Using function, can retrieve Smith-Waterman bit scores among proteins species. Bit Scores serve similarity scores protein sequence; , according STRING documentations, proxy protein homology.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"","code":"rba_string_homology_intra(ids, species = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"data frame bit scores supplied proteins self-hit. Reduce transferred data, STRING returns one half similarity matrix; pose problem similarity matrix symmetrical.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"Note function retrieve similarity scores different proteins \"within species\". Get similarity scores given protein closets homologous proteins species, see rba_string_homology_inter. Similarity matrix imported -STRING- : Similarity Matrix Proteins (SIMAP)","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"\"POST https://string-db.org/api/{output-format}/homology?identifiers= {your_identifiers}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_homology_intra.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Similarity Scores Hits of Proteins in a Species — rba_string_homology_intra","text":"","code":"# \\donttest{ rba_string_homology_intra(ids = c(\"CDK1\", \"CDK2\"), species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":null,"dir":"Reference","previous_headings":"","what":"Get All STRING Interaction Partners — rba_string_interaction_partners","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"function retrieve STRING interactions include proteins one party interaction. (e.g. interaction proteins every STRING proteins.) Given size STRING database, function return long results. See \"Arguments\" section information filter interactions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"","code":"rba_string_interaction_partners( ids, species = NULL, required_score = NULL, network_type = \"functional\", limit = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) required_score Numeric: minimum interaction score interaction included image. supplied, threshold applied STRING Based network. (low Confidence = 150, Medium Confidence = 400, High Confidence = 700, Highest confidence = 900) network_type one : \"functional\": (default) edge's indicate physical functional associations. limit Limit number returned interaction partners per input proteins. (e.g. Number confident interaction partner return per input protein.) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"data frame row network interaction columns contains interactor information interaction scores.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"Note function retrieve interactions input proteins every STRING proteins. retrieve interaction among input protein-set, see rba_string_interactions_network.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"\"POST https://string-db.org/api/{output-format}/ interaction_partners?identifiers={your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interaction_partners.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get All STRING Interaction Partners — rba_string_interaction_partners","text":"","code":"# \\donttest{ rba_string_interaction_partners(ids = c(\"9606.ENSP00000269305\", \"9606.ENSP00000398698\", \"9606.ENSP00000275493\"), network_type = \"functional\") # } # \\donttest{ rba_string_interaction_partners(ids = \"9606.ENSP00000269305\", species = 9606, required_score = 700) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":null,"dir":"Reference","previous_headings":"","what":"Get STRING Network Interactions — rba_string_interactions_network","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"function retrieve Sting interaction pairs among input protein ids, combined score separate score STRING score channels. can expand network defined size providing \"add_node\" parameter.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"","code":"rba_string_interactions_network( ids, species = NULL, required_score = NULL, add_nodes = NULL, network_type = \"functional\", use_query_labels = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"ids protein IDs. strongly recommended supply STRING IDs. See rba_string_map_ids information. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) required_score Numeric: minimum interaction score interaction included image. supplied, threshold applied STRING Based network. (low Confidence = 150, Medium Confidence = 400, High Confidence = 700, Highest confidence = 900) add_nodes Numeric: Number neighboring proteins added network. none supplied user, argument value depend number supplied \"ids\" argument: Single id: add_node set 10 retrieve interaction neighborhood input protein. Multiple ids: add_node set 0, thus output interactions input proteins. network_type one : \"functional\": (default) edge's indicate physical functional associations. \"physical\": edges indicate two proteins physical interaction parts complex. use_query_labels Logical: (Default = FALSE) Use names supplied 'ids' argument nodes labels instead STRING's default ones. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"data frame row network interaction columns contains interactor information interaction scores: stringId_A: STRING identifier (protein ) stringId_B:STRING identifier (protein B) preferredName_A: common protein name (protein ) preferredName_B: common protein name (protein B) ncbiTaxonId: NCBI taxon identifier score: combined score nscore: gene neighborhood score fscore: gene fusion score pscore: phylogenetic profile score ascore: co-expression score escore: experimental score dscore: database score tscore: textmining score","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"Note function return interactions set supplied proteins, , expand interaction network given parameters. retrieve list possible interacting proteins given input, see rba_string_interaction_partners.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"\"POST https://string-db.org/api/{output-format}/network?identifiers= {your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_interactions_network.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get STRING Network Interactions — rba_string_interactions_network","text":"","code":"# \\donttest{ rba_string_interactions_network(ids = c(\"9606.ENSP00000269305\", \"9606.ENSP00000398698\", \"9606.ENSP00000275493\"), network_type = \"functional\") # } # \\donttest{ rba_string_interactions_network(ids = c(\"9606.ENSP00000269305\", \"9606.ENSP00000398698\", \"9606.ENSP00000275493\"), species = 9606, add_nodes = 10) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":null,"dir":"Reference","previous_headings":"","what":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"function Calls STRING's API Convert set identifiers STRING Identifiers. Although can call STRING services variety common identifiers, recommended STRING's documentations first map Protein/genes IDs STRING IDs proceed STRING's functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"","code":"rba_string_map_ids(ids, species = NULL, echo_query = FALSE, limit = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"ids Common gene/protein Identifier(s) mapped. species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) echo_query (default = FALSE) Include input IDs column results. limit (Numeric, Optional) limit number matches per input ID. output sorted best matches first. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"data frame mapped STRING IDs pertinent information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"\"POST https://string-db.org/api/{output-format}/get_string_ids?identifiers= {your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_map_ids.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Map a Set of Identifiers to STRING Identifiers — rba_string_map_ids","text":"","code":"# \\donttest{ rba_string_map_ids(ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":null,"dir":"Reference","previous_headings":"","what":"Get STRING Network Image — rba_string_network_image","title":"Get STRING Network Image — rba_string_network_image","text":"Depending supplied single protein ID one protein ID, function produce static image interaction networks among input proteins /proteins. See \"Arguments\" section learn can modify network image.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get STRING Network Image — rba_string_network_image","text":"","code":"rba_string_network_image( ids, image_format = \"image\", save_image = TRUE, species = NULL, add_color_nodes = NULL, add_white_nodes = NULL, required_score = NULL, network_flavor = \"evidence\", network_type = \"functional\", hide_node_labels = FALSE, use_query_labels = FALSE, hide_disconnected_nodes = FALSE, hide_structure_pics = FALSE, flat_nodes = FALSE, node_labels_center = FALSE, node_labels_font_size = 12, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get STRING Network Image — rba_string_network_image","text":"ids protein ID(s). strongly recommended supply STRING IDs. See rba_string_map_ids information. image_format one : \"image\": PNG image normal resolution. \"highres_image\": High-resolution PNG image. \"svg\": Scalable Vector Graphics image. save_image Logical Character: TRUE: Save image automatically-generated path. FALSE: save image, just return R object. Character string: valid file path save image . species Numeric: NCBI Taxonomy identifier; Human Taxonomy ID 9606. (Recommended, optional input less 100 IDs.) add_color_nodes Numeric: number colored nodes (queried proteins first shell interactors) added. add_white_nodes Numeric: number white nodes (second shell interactors) added colored nodes. required_score Numeric (0 1000): minimum interaction score interaction included image. supplied, threshold applied STRING Based network. (low Confidence = 150, Medium Confidence = 400, High Confidence = 700, Highest confidence = 900) network_flavor style network edges, one : \"evidence\": (default) Line's color based type evidences support interaction. \"confidence\": Line's thickness indicator interaction's confidence score. \"action\": Line's Shape indicator interaction's predicted mode actions. network_type one : \"functional\": (default) edge's indicate physical functional associations. \"physical\": edges indicate two proteins physical interaction parts complex. hide_node_labels Logical: (Default = FALSE) Hide proteins names image use_query_labels Logical: (Default = FALSE) Use names supplied 'ids' argument nodes labels instead STRING's default ones. hide_disconnected_nodes Logical: (Default = FALSE) Hide proteins connected proteins image hide_structure_pics Logical: (Default = FALSE) Hide protein's structure picture inside bubbles flat_nodes Logical: (Default = FALSE) Make nodes design flat instead default 3D design node_labels_center Logical: (Default = FALSE) Position protein names labels center aligned nodes node_labels_font_size Numeric (5 50, Default = 12) Font size protein nodes labels ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get STRING Network Image — rba_string_network_image","text":"network images can PNG SVG depending inputs.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get STRING Network Image — rba_string_network_image","text":"\"POST https://string-db.org/api/{output-format}/network?identifiers= {your_identifiers}&{optional_parameters}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get STRING Network Image — rba_string_network_image","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_network_image.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get STRING Network Image — rba_string_network_image","text":"","code":"if (FALSE) { # \\dontrun{ rba_string_network_image(ids = c(\"9606.ENSP00000269305\", \"9606.ENSP00000398698\", \"9606.ENSP00000275493\"), network_type = \"functional\", save_image = FALSE) } # } if (FALSE) { # \\dontrun{ rba_string_network_image(ids = c(\"TP53\", \"TNF\", \"EGFR\"), species = 9606, save_image = TRUE) } # } if (FALSE) { # \\dontrun{ rba_string_network_image(ids = \"9606.ENSP00000269305\", image_format = \"highres_image\", save_image = file.path(getwd(), \"TP53_network.png\")) } # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Current STRING Version — rba_string_version","title":"Get Current STRING Version — rba_string_version","text":"Get STRING version stable Address package currently uses.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Current STRING Version — rba_string_version","text":"","code":"rba_string_version(...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Current STRING Version — rba_string_version","text":"... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Current STRING Version — rba_string_version","text":"list STRING version stable address.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Current STRING Version — rba_string_version","text":"Note STRING releases new version approximately 2 years cycle. Nevertheless, insure reproducibility, STRING dedicates stable address release. Thus can always reproduce research results obtained via certain STRING version. version rbioapi returns outdated, Kindly contact .","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Current STRING Version — rba_string_version","text":"\"GET https://string-db.org/api/{output_format}/version\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Current STRING Version — rba_string_version","text":"Damian Szklarczyk, Rebecca Kirsch, Mikaela Koutrouli, Katerina Nastou, Farrokh Mehryary, Radja Hachilif, Annika L Gable, Tao Fang, Nadezhda T Doncheva, Sampo Pyysalo, Peer Bork, Lars J Jensen, Christian von Mering, STRING database 2023: protein–protein association networks functional enrichment analyses sequenced genome interest, Nucleic Acids Research, Volume 51, Issue D1, 6 January 2023, Pages D638–D646, https://doi.org/10.1093/nar/gkac1000 STRING API Documentation Citations note STRING website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_string_version.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Current STRING Version — rba_string_version","text":"","code":"# \\donttest{ rba_string_version() # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Antigens by UniProt Accession — rba_uniprot_antigens","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"UniProt maps Antigenic features different sources proteins' sequences. Using function, can retrieve Antigenic features map given UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"","code":"rba_uniprot_antigens(accession, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"accession UniProtKB primary secondary accession(s). ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"list containing Antigenic features supplied UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"\"GET https://www.ebi.ac.uk/proteins/api/antigen/{accession}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Antigens by UniProt Accession — rba_uniprot_antigens","text":"","code":"# \\donttest{ rba_uniprot_antigens(\"P04626\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Antigens in UniProt — rba_uniprot_antigens_search","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"UniProt maps Antigenic (Antibody-binding) features different sources proteins' sequences. Using function, can search Antigenic sequences map UniProt proteins. may also refine search modifiers score etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"","code":"rba_uniprot_antigens_search( accession = NULL, antigen_sequence = NULL, antigen_id = NULL, ensembl_id = NULL, match_score = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. antigen_sequence Protein sequence antigenic site. antigen_id Human Protein Atlas (HPA) antigen ID. can supply 20 IDs. ensembl_id Ensembl Stable Transcript ID. can supply 20 IDs. match_score (Numeric) Minimum alignment score antigen sequence target protein sequence. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"list element correspond UniProt protein (search hit) Antigenic features organized \"features\" sub-list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/antigen\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_antigens_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Antigens in UniProt — rba_uniprot_antigens_search","text":"","code":"# \\donttest{ rba_uniprot_antigens_search(antigen_id = \"HPA001060\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"Using function can retrieve genomic Coordinates Protein either providing protein's UniProt accession ID cross-reference database (Ensembl, CCDC, HGNC RefSeq). supply either 'accession' alone 'db_type' 'db_id' together.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"","code":"rba_uniprot_coordinates(accession = NULL, db_type = NULL, db_id = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"accession UniProtKB primary secondary accession. db_type cross-reference database name, one : \"Ensembl\", \"CCDC\", \"HGNC\" \"RefSeq\". db_id Protein's ID cross-reference database ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"list genome coordinates supplied protein.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"information UniProt imports calculates genomic coordinates data, see: McGarvey, P. B., Nightingale, ., Luo, J., Huang, H., Martin, M. J., Wu, C., & UniProt Consortium (2019). UniProt genomic mapping deciphering functional effects missense variants. Human mutation, 40(6), 694–705. https://doi.org/10.1002/humu.23738","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"\"GET https://ebi.ac.uk/proteins/api/coordinates/{accession}\" \"GET https://ebi.ac.uk/proteins/api/coordinates/{dbtype}:{dbid}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Genomic Coordinates of a Protein — rba_uniprot_coordinates","text":"","code":"# \\donttest{ rba_uniprot_coordinates(accession = \"P25942\") # } # \\donttest{ rba_uniprot_coordinates(db_type = \"HGNC\", db_id = \"CD40\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"information UniProt imports calculates genomic coordinates data, see: McGarvey, P. B., Nightingale, ., Luo, J., Huang, H., Martin, M. J., Wu, C., & UniProt Consortium (2019). UniProt genomic mapping deciphering functional effects missense variants. Human mutation, 40(6), 694–705. https://doi.org/10.1002/humu.23738","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"","code":"rba_uniprot_coordinates_location( taxid, locations, in_range = TRUE, feature = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"taxid NIH-NCBI Taxon ID. locations genomic location formatted : chromosome:start-end. (e.g. \"Y:17100001-19600000\"). omit chromosome, interpreted chromosome (e.g. \"1-10000\"). in_range return proteins range. feature (logical) Get features? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"list containing UniProt proteins match supplied genomic location taxonomy ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"\"GET https://ebi.ac.uk/proteins/api/coordinates /{taxonomy}/{locations}/feature\" \"GET https://ebi.ac.uk/proteins/api/coordinates /{taxonomy}/{locations}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniProt entries by taxonomy and genomic coordinates — rba_uniprot_coordinates_location","text":"","code":"# \\donttest{ rba_uniprot_coordinates_location(taxid = 9606, locations = \"Y:17100001-19600000\", in_range = TRUE) # } # \\donttest{ rba_uniprot_coordinates_location(taxid = 9606, locations = \"20:39000001\", in_range = FALSE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"Using function can retrieve genome coordinates given UniProt protein providing Genome location position range. can either supply 'g_position' alone supply 'g_start' 'g_end' together.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"","code":"rba_uniprot_coordinates_location_genome( taxid, chromosome, g_position = NULL, g_start = NULL, g_end = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. chromosome (Character Numeric): Chromosome name, e.g. 1, 20, X. g_position (numeric) Genome location position g_start (numeric) Genome location position start g_end (numeric) Genome location position end ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"Genome coordinates supplied proteins.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"information UniProt imports calculates genomic coordinates data, see: McGarvey, P. B., Nightingale, ., Luo, J., Huang, H., Martin, M. J., Wu, C., & UniProt Consortium (2019). UniProt genomic mapping deciphering functional effects missense variants. Human mutation, 40(6), 694–705. https://doi.org/10.1002/humu.23738","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"\"GET https://ebi.ac.uk/proteins/api/coordinates/glocation /{accession}:{pPosition}\" \"GET https://ebi.ac.uk/proteins/api/coordinates/glocation /{accession}:{pStart}-{pEnd}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_genome.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Genome coordinate by Gene Sequence position — rba_uniprot_coordinates_location_genome","text":"","code":"# \\donttest{ rba_uniprot_coordinates_location_genome( taxid = 9606, chromosome = 11, g_position = 36573305) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"Using function can retrieve genome coordinates given UniProt protein providing protein position position range. can either supply 'p_position' alone supply 'p_start' 'p_end' together.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"","code":"rba_uniprot_coordinates_location_protein( accession, p_position = NULL, p_start = NULL, p_end = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"accession UniProtKB primary secondary accession. p_position (numeric) Protein sequence position p_start (numeric) Protein sequence position start p_end (numeric) Protein sequence position end ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"Genome coordinates supplied proteins.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"information UniProt imports calculates genomic coordinates data, see: McGarvey, P. B., Nightingale, ., Luo, J., Huang, H., Martin, M. J., Wu, C., & UniProt Consortium (2019). UniProt genomic mapping deciphering functional effects missense variants. Human mutation, 40(6), 694–705. https://doi.org/10.1002/humu.23738","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"\"GET https://ebi.ac.uk/proteins/api/coordinates/location /{accession}:{pPosition}\" \"GET https://ebi.ac.uk/proteins/api/coordinates/location /{accession}:{pStart}-{pEnd}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_location_protein.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Genome coordinate by Protein Sequence position — rba_uniprot_coordinates_location_protein","text":"","code":"# \\donttest{ rba_uniprot_coordinates_location_protein(accession = \"P25942\", p_position = 1) # } # \\donttest{ rba_uniprot_coordinates_location_protein(accession = \"P25942\", p_start = 1, p_end = 277) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"Use function search genomic coordinates UniProt entries. may also refine search modifiers chromosome, taxon id etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"","code":"rba_uniprot_coordinates_search( accession = NULL, chromosome = NULL, ensembl_id = NULL, gene = NULL, protein = NULL, taxid = NULL, location = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. chromosome chromosome name, \"X\", \"Y\", 1, 20, etc. can supply 20 values. ensembl_id Ensembl Stable gene ID, transcript ID translation ID. can supply 20 IDs. gene UniProt gene name(s). can supply 20 gene names. protein UniProt protein name taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. location Genome location range \"58205437-58219305\" ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"List element corresponds one UniProt entity returned search query. element sub-list containing protein's coordinates information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. information UniProt imports calculates genomic coordinates data, see: McGarvey, P. B., Nightingale, ., Luo, J., Huang, H., Martin, M. J., Wu, C., & UniProt Consortium (2019). UniProt genomic mapping deciphering functional effects missense variants. Human mutation, 40(6), 694–705. https://doi.org/10.1002/humu.23738","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"\"GET https://ebi.ac.uk/proteins/api/coordinates\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_coordinates_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Genomic Coordinates of UniProt entries — rba_uniprot_coordinates_search","text":"","code":"# \\donttest{ rba_uniprot_coordinates_search(taxid = 9606, chromosome = \"y\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope.html","id":null,"dir":"Reference","previous_headings":"","what":"Retrieve Epitopes by Accession — rba_uniprot_epitope","title":"Retrieve Epitopes by Accession — rba_uniprot_epitope","text":"Use function retrieve epitope annotations linked UniProt entry.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Retrieve Epitopes by Accession — rba_uniprot_epitope","text":"","code":"rba_uniprot_epitope(accession, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Retrieve Epitopes by Accession — rba_uniprot_epitope","text":"accession UniProtKB primary secondary accession. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Retrieve Epitopes by Accession — rba_uniprot_epitope","text":"list containing UniProt epitope features details given accession.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Retrieve Epitopes by Accession — rba_uniprot_epitope","text":"\"GET https://www.ebi.ac.uk/proteins/api/epitope/accession\"","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Retrieve Epitopes by Accession — rba_uniprot_epitope","text":"","code":"# \\donttest{ rba_uniprot_epitope(accession = \"P36222\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniProt Epitopes — rba_uniprot_epitope_search","title":"Search UniProt Epitopes — rba_uniprot_epitope_search","text":"Use function search epitope data associated UniProt entities, using various criteria UniProt accession, epitope sequence, IEDB ID, match score.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniProt Epitopes — rba_uniprot_epitope_search","text":"","code":"rba_uniprot_epitope_search( accession = NULL, epitope_sequence = NULL, iedb_id = NULL, match_score = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniProt Epitopes — rba_uniprot_epitope_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. epitope_sequence (Character) Epitope's proteins sequence iedb_id (Numeric) EIDB epitope Identifier(s). can supply 20 accession numbers. match_score Integer: Minimum alignment score antigen sequence target protein sequence. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniProt Epitopes — rba_uniprot_epitope_search","text":"List element corresponds one UniProt entity returned search query. element sub-list containing information UniProt entity.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniProt Epitopes — rba_uniprot_epitope_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/epitope\"","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_epitope_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniProt Epitopes — rba_uniprot_epitope_search","text":"","code":"# \\donttest{ rba_uniprot_epitope_search(accession = c(\"Q84ZX5\", \"P36222\")) # } # \\donttest{ rba_uniprot_epitope_search(epitope_sequence = \"DKKCIEWEKAQHGA\") # } # \\donttest{ rba_uniprot_epitope_search(iedb_id = 20354) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniProt protein sequence features by accession — rba_uniprot_features","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"Use function retrieve sequence annotations (features) protein UniProt accession.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"","code":"rba_uniprot_features( accession, types = NULL, categories = NULL, location = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"accession UniProtKB primary secondary accession. types Sequence annotation (Features) types. accepted values : \"INIT_MET\", \"SIGNAL\", \"PROPEP\", \"TRANSIT\", \"CHAIN\", \"PEPTIDE\", \"TOPO_DOM\", \"TRANSMEM\", \"DOMAIN\", \"REPEAT\", \"CA_BIND\", \"ZN_FING\", \"DNA_BIND\", \"NP_BIND\", \"REGION\", \"COILED\", \"MOTIF\", \"COMPBIAS\", \"ACT_SITE\", \"METAL\", \"BINDING\", \"SITE\", \"NON_STD\", \"MOD_RES\", \"LIPID\", \"CARBOHYD\", \"DISULFID\", \"CROSSLNK\", \"VAR_SEQ\", \"VARIANT\", \"MUTAGEN\", \"UNSURE\", \"CONFLICT\", \"NON_CONS\", \"NON_TER\", \"HELIX\", \"TURN\", \"STRAND\" /\"INTRAMEM\". can supply 20 types. categories Sequence annotation (Features) categories (subsection). accepted values : \"MOLECULE_PROCESSING\", \"TOPOLOGY\", \"SEQUENCE_INFORMATION\", \"STRUCTURAL\", \"DOMAINS_AND_SITES\", \"PTM\", \"VARIANTS\" /\"MUTAGENESIS\". can supply 8 categories. location (character) Filter features amino acid position sequence(s). Provide range character string format \"begin-end\", e.g. \"35-70\" ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"list can find given protein's sequence annotations sub-list named \"features\".","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"\"GET https://www.ebi.ac.uk/proteins/api/features/{accession}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniProt protein sequence features by accession — rba_uniprot_features","text":"","code":"# \\donttest{ rba_uniprot_features(\"Q99616\") # } # \\donttest{ rba_uniprot_features(accession = \"Q99616\", types = \"DISULFID\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniProt protein sequence features — rba_uniprot_features_search","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"UniProt maintains sequence annotations (features) describe regions protein sequence. Using function, can search retrieve UniProt proteins' sequence annotations (features). may also refine search query variety modifiers.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"","code":"rba_uniprot_features_search( accession = NULL, gene = NULL, exact_gene = NULL, protein = NULL, reviewed = NULL, organism = NULL, taxid = NULL, categories = NULL, types = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. gene UniProt gene name(s). can supply 20 gene names. e.g. supply \"CD40\", \"CD40 ligand\" also included. exact_gene UniProt exact gene name(s). can supply 20 exact gene names. e.g. supply \"CD40\", \"CD40 ligand\" included results. protein UniProt protein name reviewed Logical: TRUE, return \"UniProtKB/Swiss-Prot\" (reviewed) entries; FALSE, return TrEMBL (un-reviewed) entries. organism Organism name. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. categories Sequence annotation (Features) categories (subsection). accepted values : \"MOLECULE_PROCESSING\", \"TOPOLOGY\", \"SEQUENCE_INFORMATION\", \"STRUCTURAL\", \"DOMAINS_AND_SITES\", \"PTM\", \"VARIANTS\" /\"MUTAGENESIS\". can supply 8 categories. types Sequence annotation (Features) types. accepted values : \"INIT_MET\", \"SIGNAL\", \"PROPEP\", \"TRANSIT\", \"CHAIN\", \"PEPTIDE\", \"TOPO_DOM\", \"TRANSMEM\", \"DOMAIN\", \"REPEAT\", \"CA_BIND\", \"ZN_FING\", \"DNA_BIND\", \"NP_BIND\", \"REGION\", \"COILED\", \"MOTIF\", \"COMPBIAS\", \"ACT_SITE\", \"METAL\", \"BINDING\", \"SITE\", \"NON_STD\", \"MOD_RES\", \"LIPID\", \"CARBOHYD\", \"DISULFID\", \"CROSSLNK\", \"VAR_SEQ\", \"VARIANT\", \"MUTAGEN\", \"UNSURE\", \"CONFLICT\", \"NON_CONS\", \"NON_TER\", \"HELIX\", \"TURN\", \"STRAND\" /\"INTRAMEM\". can supply 20 types. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"List element corresponds one UniProt entity returned search query. element sub-list containing information UniProt entity.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. UniProt Entries grouped two sections: Reviewed(Swiss-Prot): Manually annotated records information extracted literature curator-evaluated computational analysis. Unreviewed (TrEMBL): Computationally analyzed records await full manual annotation.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/features\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_features_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniProt protein sequence features — rba_uniprot_features_search","text":"","code":"# \\donttest{ rba_uniprot_features_search(accession = \"Q99616\") # } # \\donttest{ rba_uniprot_features_search(gene = \"cd40\") # } # \\donttest{ rba_uniprot_features_search(gene = \"cd40 ligand\") # } # \\donttest{ rba_uniprot_features_search(gene = \"cd40\", reviewed = TRUE) # } # \\donttest{ rba_uniprot_features_search(accession = \"Q99616\", categories = c(\"MOLECULE_PROCESSING\", \"TOPOLOGY\")) # } # \\donttest{ rba_uniprot_features_search(accession = \"Q99616\", types = \"DISULFID\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"Using function can retrieve gene-centrics data. information, see proteomes? Automatic gene-centric isoform mapping eukaryotic reference proteome entries..","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"","code":"rba_uniprot_genecentric(accession, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"accession UniProtKB primary secondary accession. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"list containing information Gene-Centric proteins.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"\"GET https://ebi.ac.uk/proteins/api/genecentric/{accession}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Gene-Centric proteins by UniProt Accession — rba_uniprot_genecentric","text":"","code":"# \\donttest{ rba_uniprot_genecentric(\"P29965\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"Using function can search UniProt available gene-centrics proteomes. information, see proteomes? Automatic gene-centric isoform mapping eukaryotic reference proteome entries. may also refine search modifiers upid, accession gene. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"","code":"rba_uniprot_genecentric_search(upid = NULL, accession = NULL, gene = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. gene unique gene identifier(s) found MOD, Ensembl, Ensembl Genomes, OLN, ORF UniProt Gene Name. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"list containing gene-centric proteins search hits.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"\"GET https://ebi.ac.uk/proteins/api/genecentric\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_genecentric_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Gene-Centric Proteins — rba_uniprot_genecentric_search","text":"","code":"# \\donttest{ rba_uniprot_genecentric_search(accession = \"P59594\") # } # \\donttest{ rba_uniprot_genecentric_search(gene = \"Spike\") # } # \\donttest{ rba_uniprot_genecentric_search(upid = \"UP000000354\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"UniProt describes effects mutations proteins' amino acid sequence biological properties protein, cell organism. Using function, can get Mutagenesis description mapped given UniProt protein.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"","code":"rba_uniprot_mutagenesis(accession, location = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"accession UniProtKB primary secondary accession(s). location valid amino acid range (e.g. 10-25) within sequence range given proein. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"list containing mutagenesis description supplied UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"\"GET https://www.ebi.ac.uk/proteins/api/mutagenesis/{accession}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Mutagenesis by UniProt Accession — rba_uniprot_mutagenesis","text":"","code":"# \\donttest{ rba_uniprot_mutagenesis(accession = \"P0DTC2\", location = \"300-400\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"UniProt describes effects mutations proteins' amino acid sequence biological properties protein, cell organism. Using function, can search mutagenesis description UniProt proteins. may also refine search. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"","code":"rba_uniprot_mutagenesis_search( accession = NULL, taxid = NULL, db_id = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. db_id ID Cross-reference (external) database. can supply 20 values. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"list element correspond UniProt protein (search hit) mutagenesis description organized \"features\" sub-list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/mutagenesis\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_mutagenesis_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Mutagenesis in UniProt — rba_uniprot_mutagenesis_search","text":"","code":"# \\donttest{ #search all mutations in COVID19 proteins rba_uniprot_mutagenesis_search(taxid = 2697049) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniProt entry by accession — rba_uniprot_proteins","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"Use function retrieve UniProt Entry UniProt accession. can also use \"isoform\" \"interaction\" arguments retrieve isoforms interactor proteins entry. Note one function call can set none one \"isoform\" \"interaction\" TRUE, .","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"","code":"rba_uniprot_proteins(accession, interaction = FALSE, isoforms = FALSE, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"accession UniProtKB primary secondary accession. interaction Logical: (default = FALSE) retrieve interaction information supplied UniProt entity? isoforms Logical: (default = FALSE) retrieve isoforms supplied UniProt entity? ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"list contains UniProt protein informations supplied accession.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"\"GET https://ebi.ac.uk/proteins/api/proteins/{accession}\" \"GET https://ebi.ac.uk/proteins/api/proteins/interaction/{accession}\" \"GET https://ebi.ac.uk/proteins/api/proteins/{accession}/isoforms\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniProt entry by accession — rba_uniprot_proteins","text":"","code":"# \\donttest{ rba_uniprot_proteins(accession = \"P01730\") # } # \\donttest{ rba_uniprot_proteins(accession = \"P01730\", interaction = TRUE) # } # \\donttest{ rba_uniprot_proteins(accession = \"Q29983\", isoforms = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"UniProt Cross-Reference links protein Entities cross-reference (external) databases. Using function, can retrieve UniProt entity using external database name protein ID database.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"","code":"rba_uniprot_proteins_crossref( db_id, db_name, reviewed = NULL, isoform = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"db_id protein ID cross-reference (external) database. db_name cross-reference (external database) name. reviewed Logical: (Optional) TRUE, returns \"UniProtKB/Swiss-Prot\" (reviewed) entries; FALSE, returns TrEMBL (un-reviewed) entries. isoform Numeric: (Optional) two options: 0: Exclude isoforms. 1: Return isoforms . see: Alternative products ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"List element UniProt entity correspond supplied cross-reference database name ID.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteins/{dbtype}:{dbid}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_crossref.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniProt Entry by UniProt Cross-Reference Database and ID — rba_uniprot_proteins_crossref","text":"","code":"# \\donttest{ rba_uniprot_proteins_crossref(\"cd40\", \"hgnc\") # } # \\donttest{ rba_uniprot_proteins_crossref(\"cd40\", \"hgnc\", reviewed = TRUE) # } # \\donttest{ rba_uniprot_proteins_crossref(\"mica\", \"hgnc\", isoform = 0) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniProt entries — rba_uniprot_proteins_search","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"Using function, can search retrieve UniProt Knowledge-base (UniProtKB) protein entries using variety options. may also refine search modifiers sequence length, review status etc. See \"Arguments\" section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"","code":"rba_uniprot_proteins_search( accession = NULL, reviewed = NULL, isoform = NULL, go_term = NULL, keyword = NULL, ec = NULL, gene = NULL, exact_gene = NULL, protein = NULL, organism = NULL, taxid = NULL, pubmed = NULL, seq_length = NULL, md5 = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. reviewed Logical: TRUE, return \"UniProtKB/Swiss-Prot\" (reviewed) entries; FALSE, return TrEMBL (un-reviewed) entries. isoform Numeric: three options: 0: Exclude isoforms. 1: Return isoforms . 2: Return . see: Alternative products go_term Limit search entries associated supplied GO (Gene Ontology) term. can supply Either GO ID character string -partially fully- matching term. e.g. \"GO:0001776\" \"leukocyte homeostasis\". supply \"leukocyte\", term containing word included, e.g \"leukocyte chemotaxis\", \"leukocyte activation\". keyword Limit search entries contain supplied keyword. see: UniProt Keywords ec EC (Enzyme Commission) number(s). can supply 20 EC numbers. gene UniProt gene name(s). can supply 20 gene names. e.g. supply \"CD40\", \"CD40 ligand\" also included. exact_gene UniProt exact gene name(s). can supply 20 exact gene names. e.g. supply \"CD40\", \"CD40 ligand\" included results. protein UniProt protein name organism Organism name. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. pubmed Entries cite article supplied PubMed ID. seq_length exact sequence length (e.g. 150) range sequence lengths (e.g. \"130-158\"). md5 Sequence md5 value. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"List element corresponds one UniProt entity returned search query. element sub-list containing information UniProt entity.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.s UniProt Entries grouped two sections: Reviewed(Swiss-Prot): Manually annotated records information extracted literature curator-evaluated computational analysis. Unreviewed (TrEMBL): Computationally analyzed records await full manual annotation.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteins\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteins_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniProt entries — rba_uniprot_proteins_search","text":"","code":"# \\donttest{ rba_uniprot_proteins_search(accession = \"Q99616\") # } # \\donttest{ rba_uniprot_proteins_search(gene = \"cd40\") # } # \\donttest{ rba_uniprot_proteins_search(gene = \"cd40 ligand\") # } # \\donttest{ rba_uniprot_proteins_search(gene = \"cd40\", reviewed = TRUE) # } # \\donttest{ rba_uniprot_proteins_search(gene = \"cd40\", reviewed = TRUE, isoform = 1) # } # \\donttest{ rba_uniprot_proteins_search(keyword = \"Inhibition of host chemokines by virus\") # } # \\donttest{ rba_uniprot_proteins_search(keyword = \"chemokines\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":null,"dir":"Reference","previous_headings":"","what":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"UniProt collects annotates proteomes(Protein sets expressed organism). Using function can search UniProt available proteomes. see proteomes? information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"","code":"rba_uniprot_proteomes(upid, get_proteins = FALSE, reviewed = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. get_proteins logical: set FALSE (default) return information proteome supplied UPID, set TRUE also return proteins supplied proteome UPID. reviewed Logical: considered get_proteins TRUE. TRUE, return \"UniProtKB/Swiss-Prot\" (reviewed) proteins; FALSE, return TrEMBL (un-reviewed) entries. leave NULL want filter proteins based review status. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"list containing information proteome supplied UPID can contain proteomes protein entries based value get_proteins argument.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"\"GET https://ebi.ac.uk/proteins/api/proteomes/proteins/{upid}\" \"GET https://ebi.ac.uk/proteins/api/proteomes/{upid}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get proteome by proteome/proteins UPID — rba_uniprot_proteomes","text":"","code":"# \\donttest{ rba_uniprot_proteomes(upid = \"UP000000354\") # } # \\donttest{ rba_uniprot_proteomes(upid = \"UP000000354\", get_proteins = TRUE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"UniProt collects annotates proteomes (Protein sets expressed organism). Using function can search UniProt available proteomes. see proteomes? information. may also refine search modifiers keyword, taxon id etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"","code":"rba_uniprot_proteomes_search( name = NULL, upid = NULL, taxid = NULL, keyword = NULL, xref = NULL, genome_acc = NULL, is_ref_proteome = NULL, is_redundant = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"name keyword proteome's name upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. keyword Limit search entries contain supplied keyword. see: UniProt Keywords xref Proteome cross-references Genome assembly ID Biosample ID. can supply 20 cross-reference IDs. genome_acc Genome accession associated proteome's components. is_ref_proteome (logical) TRUE, return reference proteomes; FALSE, returns non-reference proteomes; NULL (default), results filtered criteria see 'reference proteomes?' information. is_redundant (logical) TRUE, return redundant proteomes; FALSE, returns non-redundant proteomes; NULL (default), results filtered redundancy. see 'Reducing proteome redundancy' information. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"list element list corresponds single proteome (search hit) contains informations pertinent proteome.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"\"GET https://ebi.ac.uk/proteins/api/proteomes\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomes_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Proteomes in UniProt — rba_uniprot_proteomes_search","text":"","code":"# \\donttest{ rba_uniprot_proteomes_search(name = \"SARS-CoV\") # } # \\donttest{ rba_uniprot_proteomes_search(name = \"SARS-CoV\", is_ref_proteome = TRUE) # } # \\donttest{ rba_uniprot_proteomes_search(name = \"SARS-CoV\", is_ref_proteome = TRUE) # } # \\donttest{ rba_uniprot_proteomes_search(genome_acc = \"AY274119\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":null,"dir":"Reference","previous_headings":"","what":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"UniProt maps post-translational modification proteomics data different sources proteins' sequences. Using function, can retrieve HPP (Human Proteome Project) proteomics features map given UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"","code":"rba_uniprot_proteomics_hpp(accession, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"accession UniProtKB primary secondary accession. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"list containing proteomics data features supplied UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteomics/nonPtm/accession\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp","text":"","code":"# \\donttest{ rba_uniprot_proteomics_hpp(accession = \"P04234\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"Using function, can search HPP (Human Proteome Project) proteomics features map UniProt proteins. may also refine search modifiers data_source, peptide etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"","code":"rba_uniprot_proteomics_hpp_search( accession = NULL, taxid = NULL, data_source = NULL, upid = NULL, peptide = NULL, unique = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. data_source Proteomics data source. addition manual curation, UniProt also import PTM annotations following databases: \"HPP\" Please use `rba_uniprot_proteomics_species()` information available data sources given species. upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. peptide Peptide sequence(s). can supply 20 sequences. unique Logical: results filtered based Peptide's uniqueness (fact peptide maps 1 protein). TRUE, unique peptides returned, FALSE un-unique peptides returned; NULL (default) results filtered based . ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"list element correspond UniProt protein proteomics data organized \"features\" sub-list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteomics/ptm\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_hpp_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search HPP Proteomics data in UniProt — rba_uniprot_proteomics_hpp_search","text":"","code":"# \\donttest{ rba_uniprot_proteomics_hpp_search(peptide = \"NDQVYQPLRDRDDAQYSHLGGNWAR\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"UniProt maps proteomics data different sources proteins' sequences. Using function, can retrieve non-post-translational modification proteomics features map given UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"","code":"rba_uniprot_proteomics_non_ptm(accession, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"accession UniProtKB primary secondary accession. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"list containing proteomics data features supplied UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteomics/nonPtm/accession\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm","text":"","code":"# \\donttest{ rba_uniprot_proteomics_non_ptm(accession = \"P04234\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"Using function, can search non-Post-Translational Modification proteomics features map UniProt proteins. may also refine search modifiers data_source, peptide etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"","code":"rba_uniprot_proteomics_non_ptm_search( accession = NULL, taxid = NULL, data_source = NULL, upid = NULL, peptide = NULL, unique = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. data_source Proteomics data source. addition manual curation, UniProt also import PTM annotations following databases: \"MaxQB\" \"PeptideAtlas\" \"EPD\" \"ProteomicsDB\" Please use `rba_uniprot_proteomics_species()` information available data sources given species. upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. peptide Peptide sequence(s). can supply 20 sequences. unique Logical: results filtered based Peptide's uniqueness (fact peptide maps 1 protein). TRUE, unique peptides returned, FALSE un-unique peptides returned; NULL (default) results filtered based . ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"list element correspond UniProt protein proteomics data organized \"features\" sub-list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteomics/nonPtm\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_non_ptm_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Proteomics data in UniProt — rba_uniprot_proteomics_non_ptm_search","text":"","code":"# \\donttest{ rba_uniprot_proteomics_non_ptm_search(peptide = \"NDQVYQPLRDRDDAQYSHLGGNWAR\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"UniProt maps post-translational modification proteomics data different sources proteins' sequences. Using function, can retrieve post-translational modification features map given UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"","code":"rba_uniprot_proteomics_ptm(accession, confidence_score = NULL, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"accession UniProtKB primary secondary accession. confidence_score (Character) Valid values: \"Bronze\", \"Silver\", \"gold\". UniProt classifies modified residues three categories based false localization rate (FLR) across multiple dataset. See Large scale modified residue information. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"list containing post-translational modification features supplied UniProt protein's sequence.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"see also: PTM / Processing section UniProtKB UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteomics/ptm/accession\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Post-Translational Modification of UniProt Protein — rba_uniprot_proteomics_ptm","text":"","code":"# \\donttest{ rba_uniprot_proteomics_ptm(accession = \"P04234\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"Using function, can search Post-Translational Modification proteomics features map UniProt proteins. may also refine search modifiers data_source, peptide etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"","code":"rba_uniprot_proteomics_ptm_search( accession = NULL, ptm = NULL, taxid = NULL, data_source = NULL, upid = NULL, peptide = NULL, unique = NULL, confidence_score = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. ptm Post-translational modification name. Valid values : \"Acetylation \", \"ADP-ribosylation \", \"Amidation \", \"Autocatalytic cleavage \", \"Bromination \", \"Citrullination \", \"Cleavage pair basic residues \", \"Covalent protein-DNA linkage \", \"Covalent protein-RNA linkage \", \"CTQ \", \"D-amino acid \", \"Disulfide bond \", \"Formylation \", \"Gamma-carboxyglutamic acid \", \"Glutathionylation \", \"Glycoprotein \", \"Lipoprotein \", \"Hydroxylation \", \"Hypusine \", \"Iodination \", \"Isopeptide bond \", \"LTQ \", \"Methylation \", \"Nitration \", \"Organic radical \", \"Oxidation \", \"Peptidoglycan-anchor \", \"Phosphopantetheine \", \"Phosphoprotein \", \"Pyrrolidone carboxylic acid \", \"Quinone \", \"S-nitrosylation \", \"Sulfation \", \"Thioester bond \", \"Thioether bond \", \"TPQ \", \"TTQ \", \"Ubl conjugation \", \"Zymogen\". taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. data_source Proteomics data source. addition manual curation, UniProt also import PTM annotations following databases: \"PRIDE\" \"PTMeXchange\" Please use `rba_uniprot_proteomics_species()` information available data sources given species. upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. peptide Peptide sequence(s). can supply 20 sequences. unique Logical: results filtered based Peptide's uniqueness (fact peptide maps 1 protein). TRUE, unique peptides returned, FALSE un-unique peptides returned; NULL (default) results filtered based . confidence_score (Character) Valid values: \"Bronze\", \"Silver\", \"gold\". UniProt classifies modified residues three categories based false localization rate (FLR) across multiple dataset. See Large scale modified residue information. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"list element correspond UniProt protein post-translational modification organized \"features\" sub-list.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query. see also: PTM / Processing section UniProtKB UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"\"GET https://www.ebi.ac.uk/proteins/api//proteomics/ptm\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_ptm_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search Post-Translational Modification Proteomics in UniProt — rba_uniprot_proteomics_ptm_search","text":"","code":"# \\donttest{ rba_uniprot_proteomics_ptm_search(peptide = \"NDQVYQPLRDRDDAQYSHLGGNWAR\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"Retrieve information available Species proteomics data sources UniProt.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"","code":"rba_uniprot_proteomics_species(...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"data frame available species rows, columns indicating proteomics data sources, separated three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project)","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"UniProt categorizes proteomics data sources three main data categories: PTM (Post-Translational Modification), non-PTM, HPP (Human Proteome Project); corresponding API endpoints, thus, rbioapi functions.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"\"GET https://www.ebi.ac.uk/proteins/api/proteomics/species\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_proteomics_species.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniProt Proteomics Metadata — rba_uniprot_proteomics_species","text":"","code":"# \\donttest{ rba_uniprot_proteomics_species() # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit.html","id":null,"dir":"Reference","previous_headings":"","what":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","title":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","text":"Use function retrieve RNA-editing events (conversion, insertion, deletion nucleotides) annotations linked UniProt entry.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","text":"","code":"rba_uniprot_rna_edit(accession, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","text":"accession UniProtKB primary secondary accession. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","text":"list containing UniProt RNA-editing features details given accession.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","text":"\"GET https://www.ebi.ac.uk/proteins/api/rna-edit/accession\"","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Retrieve Epitope by Accession — rba_uniprot_rna_edit","text":"","code":"# \\donttest{ rba_uniprot_rna_edit(accession = \"Q16851\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","title":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","text":"UniProt Curates RNA-editing events (conversion, insertion, deletion nucleotides). Use function search RNA editing records UniProt using various criteria accession, taxon ID, variant location.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","text":"","code":"rba_uniprot_rna_edit_search( accession = NULL, taxid = NULL, variantlocation = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. taxid (Numeric) NIH-NCBI Taxon ID. can supply 20 taxon IDs. variantlocation Character: RNA editing variant location(s). can supply 20 taxon IDs. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","text":"List element corresponds one UniProt entity returned search query. element sub-list containing information UniProt entity.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/rna-editing\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_rna_edit_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search RNA Editing in UniProt — rba_uniprot_rna_edit_search","text":"","code":"# \\donttest{ rba_uniprot_rna_edit_search(accession = c(\"Q16851\", \"Q16849\")) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"Using function, can retrieve taxonomic nodes information providing NCBI taxonomic identifiers. also, can explicitly retrieve nodes relation supplied node's hierarchy UniProt Taxonomy database.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"","code":"rba_uniprot_taxonomy( ids, hierarchy = NULL, node_only = TRUE, page_size = 200, page_number = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"ids (numeric) single numeric vector NCBI taxonomic identifier(s) hierarchy Retrieve taxonomic nodes specific hierarchical relation supplied taxonomic node. one : \"children\", \"parent\" \"siblings\". node_only Retrieve node(s) information exclude URL links parents, siblings children nodes. page_size (numeric) hierarchy supplied. hierarchy information may long, thus UniProt API paginate results, may use argument control pagination. maximum value 200. page_number (numeric) hierarchy supplied. hierarchy information may long, thus UniProt API paginate results, may use argument control pagination. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"list containing supplied nodes related nodes taxonomic information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"\"GET https://ebi.ac.uk/proteins/api/ids/{ids}\" \"GET https://ebi.ac.uk/proteins/api/ids/id/{id}/node\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/node\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/children\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/children/node\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/parent\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/parent/node\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/siblings\" \"GET https://ebi.ac.uk/proteins/api/id/{id}/siblings/node\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniProt Taxonomy Nodes — rba_uniprot_taxonomy","text":"","code":"# \\donttest{ rba_uniprot_taxonomy(ids = c(9606, 10090)) # } # \\donttest{ rba_uniprot_taxonomy(ids = 9989, hierarchy = \"children\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"Use function retrieve lowest common ancestor (LCA) two taxonomy nodes UniProt Taxonomy database","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"","code":"rba_uniprot_taxonomy_lca(ids, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"ids (numeric) Numeric vector NCBI taxonomic identifiers, minimum length two. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"list UniProt taxonomy information supplied taxonomy elements.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"\"GET https://ebi.ac.uk/proteins/api/ancestor/{ids}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lca.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Lowest Common Ancestor (LCA) of Two Taxonomy Nodes — rba_uniprot_taxonomy_lca","text":"","code":"# \\donttest{ rba_uniprot_taxonomy_lca(c(9606,10090,9823,7712)) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"Use function retrieve taxonomic lineage supplied taxonomy node.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"","code":"rba_uniprot_taxonomy_lineage(id, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"id (numeric) NCBI taxonomic identifier ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"list data frame containing nodes preceded supplied node taxonomic tree. node first row root node last row.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"\"GET https://ebi.ac.uk/proteins/api/lineage/{id}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_lineage.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Taxonomic Lineage — rba_uniprot_taxonomy_lineage","text":"","code":"# \\donttest{ rba_uniprot_taxonomy_lineage(id = 9989) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"Using function, can search retrieve taxonomic nodes using names UniProt Taxonomy database.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"","code":"rba_uniprot_taxonomy_name( name, field = \"scientific\", search_type = \"equal_to\", node_only = TRUE, page_size = 200, page_number = 1, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"name name used search query. field Specify field supplied name searched. one : \"scientific\" (default), \"common\" \"mnemonic\". search_type logical relationship supplied search query taxonomic name field. one \"equal_to\" (default), \"start_with\", \"end_with\" \"contain\". node_only (logical) Retrieve node(s) information exclude URL links parents, siblings children nodes. default = TRUE page_size (numeric) search results may long, thus UniProt API paginate results, may use argument control pagination. maximum value 200. page_number (numeric) search results may long, thus UniProt API paginate results, may use argument control pagination. maximum value 200. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"list containing taxonomic nodes match supplied inputs.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"\"GET https://ebi.ac.uk/proteins/api/name/{name}\" \"GET https://ebi.ac.uk/proteins/api/name/{name}/node\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_name.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniProt Taxonomic Names — rba_uniprot_taxonomy_name","text":"","code":"# \\donttest{ rba_uniprot_taxonomy_name(name = \"homo\", field = \"scientific\", search_type = \"start_with\") # } # \\donttest{ rba_uniprot_taxonomy_name(name = \"adenovirus\", field = \"scientific\", search_type = \"contain\", page_size = 200, page_number = 2) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":null,"dir":"Reference","previous_headings":"","what":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"Using function can retrieve nodes located top bottom supplied node UniProt Taxonomy database tree","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"","code":"rba_uniprot_taxonomy_path(id, direction, depth = 5, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"id (numeric) NCBI taxonomic identifier direction direction taxonomic path, either \"TOP\" \"BOTTOM\". depth (numeric) many levels traversed taxonomic tree? (1 5, default = 5) ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"nested list containing node path specified supplied argument UniProt taxonomic tree.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"\"GET https://ebi.ac.uk/proteins/api/path\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_path.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Traverse UniProt Taxonomic Tree Path — rba_uniprot_taxonomy_path","text":"","code":"# \\donttest{ rba_uniprot_taxonomy_path(id = 9606, direction = \"TOP\", depth = 3) # } # \\donttest{ rba_uniprot_taxonomy_path(id = 207598, direction = \"BOTTOM\", depth = 3) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":null,"dir":"Reference","previous_headings":"","what":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"Use function retrieve shortest path two nodes taxonomy tree UniProt Taxonomy database.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"","code":"rba_uniprot_taxonomy_relationship(from, to, ...)"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"NCBI taxonomic identifier initial node. NCBI taxonomic identifier final node. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"nested list containing node shortest path supplied nodes.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"\"GET https://ebi.ac.uk/proteins/api/relationship\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_taxonomy_relationship.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get Shortest Path Between Two Taxonomy Nodes — rba_uniprot_taxonomy_relationship","text":"","code":"# \\donttest{ rba_uniprot_taxonomy_relationship(from = 9606, to = 10090) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniParc entry — rba_uniprot_uniparc","title":"Get UniParc entry — rba_uniprot_uniparc","text":"Use function retrieve UniParc entries. can use either - one - UniProt accession, Cross-reference database id, UniParc ID UniProt Proteome UPID. can also filter returned content returned UniParc entry. see \"Argument\" section details.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniParc entry — rba_uniprot_uniparc","text":"","code":"rba_uniprot_uniparc( upi = NULL, accession = NULL, db_id = NULL, upid = NULL, rf_dd_type = NULL, rf_db_id = NULL, rf_active = NULL, rf_tax_id = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniParc entry — rba_uniprot_uniparc","text":"upi unique UniParc Identifier. accession UniProtKB primary secondary accession. db_id Protein ID cross-reference (external) database. upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. rf_dd_type Filter content UniParc entry cross-reference names. can supply multiple values. rf_db_id Filter content UniParc entry protein identifiers cross-reference database. can supply multiple values. rf_active (logical ) Filter content UniParc entry based active status source database: NULL: (default) filter contents based active status. TRUE: return contents still active. FALSE: return contents active. rf_tax_id (Numeric) Filter content UniParc entry NIH-NCBI Taxon ID. can supply multiple values. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniParc entry — rba_uniprot_uniparc","text":"list correspond UniParc entry.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniParc entry — rba_uniprot_uniparc","text":"\"GET https://ebi.ac.uk/proteins/api/uniparc/accession/{accession} \" \"GET https://ebi.ac.uk/proteins/api/uniparc/dbreference/{dbid}\" \"GET https://ebi.ac.uk/proteins/api/uniparc/proteome/{upid}\" \"GET https://ebi.ac.uk/proteins/api/uniparc/upi/{upi}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniParc entry — rba_uniprot_uniparc","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniParc entry — rba_uniprot_uniparc","text":"","code":"# \\donttest{ rba_uniprot_uniparc(upi = \"UPI00000000C9\") # } # \\donttest{ rba_uniprot_uniparc(upi = \"UPI00000000C9\") # } # \\donttest{ rba_uniprot_uniparc(upi = \"UPI00000000C9\", rf_active = FALSE) # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"function returns UniParc Entry cross-reference longest active UniProtKB sequence (preferably Swiss-Prot TrEMBL). finds one longest active UniProtKB sequence returns 400 (Bad Request) error response list cross references found.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"","code":"rba_uniprot_uniparc_bestguess( upi = NULL, accession = NULL, db_id = NULL, gene = NULL, taxid = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"upi unique UniParc Identifier. accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. db_id Protein ID cross-reference (external) database. can supply 100 IDs. gene UniProt gene name(s). can supply 20 gene names. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"list element correspond UniParc entry.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"\"GET https://ebi.ac.uk/proteins/api/uniparc/bestguess\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_bestguess.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniParc Longest Sequence for Entries — rba_uniprot_uniparc_bestguess","text":"","code":"# \\donttest{ rba_uniprot_uniparc_bestguess(\"UPI00000000C9\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniParc Entries — rba_uniprot_uniparc_search","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"Use function search UniProt Archive (UniParc) entries.may also refine search modifiers sequence length, taxon id etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"","code":"rba_uniprot_uniparc_search( upi = NULL, accession = NULL, db_type = NULL, db_id = NULL, gene = NULL, protein = NULL, taxid = NULL, organism = NULL, sequence_checksum = NULL, ipr = NULL, signature_db = NULL, signature_id = NULL, upid = NULL, seq_length = NULL, rf_dd_type = NULL, rf_db_id = NULL, rf_active = NULL, rf_tax_id = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"upi unique UniParc Identifier(s). can supply 100 IDs. accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. db_type cross-reference (external database) name. db_id Protein ID cross-reference (external) database. can supply 100 IDs. gene UniProt gene name(s). can supply 20 gene names. protein UniProt protein name. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. organism Organism name. sequence_checksum Sequence CRC64 checksum. ipr InterPro identifier(s). can supply 20 IDs. signature_db InterPro's signature database. can supply 13 following values: \"CATH\", \"CDD\", \"HAMAP\", \"MobiDB Lite\", \"Panther\", \"Pfam\", \"PIRSF\", \"PRINTS\", \"Prosite\", \"SFLD\", \"SMART\", \"SUPERFAMILY\" /\"TIGRfams\" signature_id Signature ID InterPro's signature database. can supply 20 IDs. upid UniProt Proteome identifier (UPID). can supply 100 UPIDs. seq_length exact sequence length (e.g. 150) range sequence lengths (e.g. \"130-158\"). rf_dd_type Filter content UniParc entry cross-reference names. can supply multiple values. rf_db_id Filter content UniParc entry protein identifiers cross-reference database. can supply multiple values. rf_active (logical ) Filter content UniParc entry based active status source database: NULL: (default) filter contents based active status. TRUE: return contents still active. FALSE: return contents active. rf_tax_id (Numeric) Filter content UniParc entry NIH-NCBI Taxon ID. can supply multiple values. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"List element corresponds one UniParc entry returned search query. element sub-list containing sequence information reference entries.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"\"GET https://ebi.ac.uk/proteins/api/uniparc\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniParc Entries — rba_uniprot_uniparc_search","text":"","code":"# \\donttest{ rba_uniprot_uniparc_search(upi = \"UPI00000000C9\") # } # \\donttest{ rba_uniprot_uniparc_search(accession = \"P30914\") # } # \\donttest{ rba_uniprot_uniparc_search(accession = \"P30914\", rf_active = TRUE) # } # \\donttest{ rba_uniprot_uniparc_search(taxid = \"694009\", protein = \"Nucleoprotein\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":null,"dir":"Reference","previous_headings":"","what":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"Retrieve UniParc Entry providing exact sequence. Note partial matches accepted. can also filter returned content returned UniParc entry. see \"Argument\" section details.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"","code":"rba_uniprot_uniparc_sequence( sequence, rf_dd_type = NULL, rf_db_id = NULL, rf_active = NULL, rf_tax_id = NULL, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"sequence Exact UniParc protein sequence. Partial matches accepted. rf_dd_type Filter content UniParc entry cross-reference names. can supply multiple values. rf_db_id Filter content UniParc entry protein identifiers cross-reference database. can supply multiple values. rf_active (logical ) Filter content UniParc entry based active status source database: NULL: (default) filter contents based active status. TRUE: return contents still active. FALSE: return contents active. rf_tax_id (Numeric) Filter content UniParc entry NIH-NCBI Taxon ID. can supply multiple values. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"list correspond UniParc entry.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"\"POST https://ebi.ac.uk/proteins/api/uniparc/sequence\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_uniparc_sequence.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get UniParc Entries by Sequence — rba_uniprot_uniparc_sequence","text":"","code":"# \\donttest{ rba_uniprot_uniparc_sequence(\"GMRSCPRGCSQRGRCENGRCVCNPGYTGEDC\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":null,"dir":"Reference","previous_headings":"","what":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"Retrieve natural variant annotations sequence using UniProt protein accession, dbSNP HGVS expression.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"","code":"rba_uniprot_variation( id, id_type, source_type = NULL, consequence_type = NULL, wild_type = NULL, alternative_sequence = NULL, location = NULL, save_peff = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"id ID can either UniProt primary secondary accession, NIH-NCBI dbSNP ID HGVS expression. NIH-NCBI dbSNP id HGVS Expression. id_type type supplied ID argument, one : \"uniprot\", \"dbsnp\" \"hgvs\" source_type Variation's source type. can choose two : \"UniProt\", \"large scale study\" /\"mixed\". consequence_type Variation's consequence type. can choose two : \"missense\", \"stop gained\" \"stop lost\". wild_type Wild type amino acid. Accepted values IUPAC single-letter amino acid (e.g. D Aspartic acid) \"*\" stop codon. can supply 20 values. alternative_sequence Alternative amino acid. Accepted values IUPAC single-letter amino acid (e.g. D Aspartic acid) \"*\" stop codon \"-\" deletion. can supply 20 values. location valid amino acid range (e.g. 10-25) within sequence range variation occurs. can supply 20 values. save_peff Logical Character: FALSE: (default) save PEFF file, just return list object. TRUE: Save PEFF file automatically-generated path. Character string: valid file path save PEFF file. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"list element list corresponds UniProt protein entry.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"\"GET https://www.ebi.ac.uk/proteins/api/variation/dbsnp/{dbid}\" \"GET https://www.ebi.ac.uk/proteins/api/variation/hgvs/{hgvs}\" \"GET https://www.ebi.ac.uk/proteins/api/variation/{accession}\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Get natural variants in UniProt by NIH-NCBI SNP database identifier — rba_uniprot_variation","text":"","code":"# \\donttest{ rba_uniprot_variation(id = \"rs121434451\", id_type = \"dbsnp\") # } # \\donttest{ rba_uniprot_variation(id = \"NC_000008.11:g.22119227C>T\", id_type = \"hgvs\") # } # \\donttest{ rba_uniprot_variation(id = \"O43593\", id_type = \"uniprot\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":null,"dir":"Reference","previous_headings":"","what":"Search UniProt Natural Variants — rba_uniprot_variation_search","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"Using function, can search retrieve Natural variant(s) annotated protein's sequences. may also refine search modifiers source type, disease etc. See \"Arguments section\" information.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"ref-usage","dir":"Reference","previous_headings":"","what":"Usage","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"","code":"rba_uniprot_variation_search( accession = NULL, source_type = NULL, consequence_type = NULL, wild_type = NULL, alternative_sequence = NULL, location = NULL, disease = NULL, omim = NULL, evidence = NULL, taxid = NULL, db_type = NULL, db_id = NULL, save_peff = FALSE, ... )"},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"arguments","dir":"Reference","previous_headings":"","what":"Arguments","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"accession UniProtKB primary secondary accession(s). can supply 100 accession numbers. source_type Variation's source type. can choose two : \"UniProt\", \"large scale study\" /\"mixed\". consequence_type Variation's consequence type. can choose two : \"missense\", \"stop gained\" \"stop lost\". wild_type Wild type amino acid. Accepted values IUPAC single-letter amino acid (e.g. D Aspartic acid) \"*\" stop codon. can supply 20 values. alternative_sequence Alternative amino acid. Accepted values IUPAC single-letter amino acid (e.g. D Aspartic acid) \"*\" stop codon \"-\" deletion. can supply 20 values. location valid amino acid range (e.g. 10-25) within sequence range variation occurs. can supply 20 values. disease Human disease associated sequence variation. Accepted values disease name (e.g. Alzheimer disease 18), partial disease name (Alzheimer) /disease acronym (e.g. AD). can supply 20 values. omim OMIM ID associated variation. can supply 20 values. evidence Pubmed ID variation's citation can supply 20 values. taxid NIH-NCBI Taxon ID. can supply 20 taxon IDs. db_type cross-reference database variation. can supply two following: \"dbSNP\": NIH-NCBI dbSNP database. \"cosmic curate\": COSMIC (Catalogue Somatic Mutations Cancer) \"ClinVar\": NIH-NCBI ClinVar db_id variation ID Cross-reference (external) database. can supply 20 values. save_peff Logical Character: FALSE: (default) save PEFF file, just return list object. TRUE: Save PEFF file automatically-generated path. Character string: valid file path save PEFF file. ... rbioapi option(s). See rba_options's arguments manual information available options.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"value","dir":"Reference","previous_headings":"","what":"Value","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"List element corresponds one UniProt entity returned search query. element sub-list containing information UniProt Variation.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"details","dir":"Reference","previous_headings":"","what":"Details","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"Note search function. Thus, required fill every argument; may use whatever combinations arguments see fit query.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"corresponding-api-resources","dir":"Reference","previous_headings":"","what":"Corresponding API Resources","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"\"GET https://www.ebi.ac.uk/proteins/api/variation\"","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"references","dir":"Reference","previous_headings":"","what":"References","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"UniProt Consortium , UniProt: Universal Protein Knowledgebase 2025, Nucleic Acids Research, 2024;, gkae1010, https://doi.org/10.1093/nar/gkae1010 Andrew Nightingale, Ricardo Antunes, Emanuele Alpi, Borisas Bursteinas, Leonardo Gonzales, Wudong Liu, Jie Luo, Guoying Qi, Edd Turner, Maria Martin, Proteins API: accessing key integrated protein genome information, Nucleic Acids Research, Volume 45, Issue W1, 3 July 2017, Pages W539–W544, https://doi.org/10.1093/nar/gkx237 Proteins API Documentation Citations note UniProt website","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rba_uniprot_variation_search.html","id":"ref-examples","dir":"Reference","previous_headings":"","what":"Examples","title":"Search UniProt Natural Variants — rba_uniprot_variation_search","text":"","code":"# \\donttest{ rba_uniprot_variation_search(accession = \"P05067\") # } # \\donttest{ rba_uniprot_variation_search(disease = \"alzheimer disease, 18\") # } # \\donttest{ rba_uniprot_variation_search(disease = \"alzheimer\", wild_type = \"A\", alternative_sequence = \"T\") # }"},{"path":"https://rbioapi.moosa-r.com/reference/rbioapi.html","id":null,"dir":"Reference","previous_headings":"","what":"rbioapi: User-Friendly R Interface to Biologic Web Services' API — rbioapi","title":"rbioapi: User-Friendly R Interface to Biologic Web Services' API — rbioapi","text":"Currently fully supports Enrichr, JASPAR, miEAA, PANTHER, Reactome, STRING, UniProt! goal rbioapi provide user-friendly consistent interface biological databases services. way insulates user technicalities using web services API creates unified easy--use interface biological medical web services. ongoing project; New databases services added periodically. Feel free suggest databases services often use.","code":""},{"path":"https://rbioapi.moosa-r.com/reference/rbioapi.html","id":"supported-database-services","dir":"Reference","previous_headings":"","what":"Supported Database/Services","title":"rbioapi: User-Friendly R Interface to Biologic Web Services' API — rbioapi","text":"Enrichr JASPAR MiEAA PANTHER Reactome STRING UniProt","code":""},{"path":[]},{"path":"https://rbioapi.moosa-r.com/reference/rbioapi.html","id":"author","dir":"Reference","previous_headings":"","what":"Author","title":"rbioapi: User-Friendly R Interface to Biologic Web Services' API — rbioapi","text":"Maintainer: Moosa Rezwani moosa.rezwani@gmail.com (ORCID)","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-081-current-cran-version","dir":"Changelog","previous_headings":"","what":"rbioapi 0.8.1 (Current CRAN version)","title":"rbioapi 0.8.1 (Current CRAN version)","text":"CRAN release: 2024-03-30 Move JASPAR 2024. Minor improvements fixes.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-080","dir":"Changelog","previous_headings":"","what":"rbioapi 0.8.0","title":"rbioapi 0.8.0","text":"CRAN release: 2023-09-30 Move STRING v12. Incorporate recent changes PANTHER MIEAA API. Minor improvements fixes.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-079","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.9","title":"rbioapi 0.7.9","text":"CRAN release: 2023-05-09 Stability improvements.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-078","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.8","title":"rbioapi 0.7.8","text":"CRAN release: 2023-05-02 Bug fixes minor improvements.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-077","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.7","title":"rbioapi 0.7.7","text":"CRAN release: 2022-08-08 Bug fixes minor improvements.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-076","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.6","title":"rbioapi 0.7.6","text":"CRAN release: 2022-04-05 Submitted paper Bioinformatics journal (DOI: 10.1093/bioinformatics/btac172). Added vignette article: “-Representation (Enrichment) Analysis”” Updated citations information. Moved JASPAR 2022. Added new API endpoints UniProt PANTHER. Minor internal improvements.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-075","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.5","title":"rbioapi 0.7.5","text":"Moved STRING database version 11.5","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-074","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.4","title":"rbioapi 0.7.4","text":"CRAN release: 2021-06-22 Bug fixes minor improvements.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-073","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.3","title":"rbioapi 0.7.3","text":"Improved internal functions.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-072","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.2","title":"rbioapi 0.7.2","text":"JASPAR supported.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-071","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.1","title":"rbioapi 0.7.1","text":"Enrichr supported.","code":""},{"path":"https://rbioapi.moosa-r.com/news/index.html","id":"rbioapi-070","dir":"Changelog","previous_headings":"","what":"rbioapi 0.7.0","title":"rbioapi 0.7.0","text":"CRAN release: 2021-04-30 package submitted CRAN","code":""}]