From ace65e0848c48060b6fc0bbf183f68cd9c880e06 Mon Sep 17 00:00:00 2001 From: "dependabot[bot]" <49699333+dependabot[bot]@users.noreply.github.com> Date: Fri, 24 May 2024 10:32:16 +0000 Subject: [PATCH] Bump github.com/libsv/go-bc from 0.1.11 to 0.1.29 Bumps [github.com/libsv/go-bc](https://github.com/libsv/go-bc) from 0.1.11 to 0.1.29. - [Release notes](https://github.com/libsv/go-bc/releases) - [Changelog](https://github.com/libsv/go-bc/blob/master/.goreleaser.yml) - [Commits](https://github.com/libsv/go-bc/compare/v0.1.11...v0.1.29) --- updated-dependencies: - dependency-name: github.com/libsv/go-bc dependency-type: direct:production update-type: version-update:semver-patch ... Signed-off-by: dependabot[bot] --- go.mod | 14 +- go.sum | 84 +- vendor/github.com/libsv/go-bc/.golangci.yml | 5 - vendor/github.com/libsv/go-bc/.goreleaser.yml | 13 +- vendor/github.com/libsv/go-bc/Makefile | 2 +- vendor/github.com/libsv/go-bc/README.md | 2 +- vendor/github.com/libsv/go-bc/block.go | 1 + vendor/github.com/libsv/go-bc/blockheader.go | 12 +- vendor/github.com/libsv/go-bc/bump.go | 290 + vendor/github.com/libsv/go-bc/endian.go | 28 + vendor/github.com/libsv/go-bc/mapicallback.go | 1 - vendor/github.com/libsv/go-bc/merklepath.go | 137 + vendor/github.com/libsv/go-bc/merkleroot.go | 38 +- .../libsv/go-bc/merkletreeparent.go | 14 + .../github.com/libsv/go-bt/v2/.golangci.yml | 2 +- .../github.com/libsv/go-bt/v2/.goreleaser.yml | 2 +- vendor/github.com/libsv/go-bt/v2/README.md | 2 +- .../libsv/go-bt/v2/bscript/address.go | 5 +- .../libsv/go-bt/v2/bscript/errors.go | 5 + .../libsv/go-bt/v2/bscript/inscriptions.go | 15 + .../libsv/go-bt/v2/bscript/script.go | 124 +- vendor/github.com/libsv/go-bt/v2/errors.go | 22 +- vendor/github.com/libsv/go-bt/v2/fees.go | 8 +- vendor/github.com/libsv/go-bt/v2/input.go | 42 +- .../github.com/libsv/go-bt/v2/inscriptions.go | 131 + vendor/github.com/libsv/go-bt/v2/output.go | 4 +- .../github.com/libsv/go-bt/v2/sighash/flag.go | 3 +- vendor/github.com/libsv/go-bt/v2/tx.go | 190 +- vendor/github.com/libsv/go-bt/v2/txinput.go | 69 +- vendor/github.com/libsv/go-bt/v2/txoutput.go | 8 +- vendor/github.com/libsv/go-bt/v2/unlocker.go | 2 + vendor/github.com/libsv/go-bt/v2/utxo.go | 11 +- .../libsv/go-p2p/chaincfg/chainhash/README.md | 21 + .../libsv/go-p2p/chaincfg/chainhash/doc.go | 5 + .../libsv/go-p2p/chaincfg/chainhash/hash.go | 156 + .../go-p2p/chaincfg/chainhash/hashfuncs.go | 33 + .../testify/assert/assertion_compare.go | 36 +- .../testify/assert/assertion_format.go | 216 +- .../testify/assert/assertion_forward.go | 432 +- .../testify/assert/assertion_order.go | 24 +- .../stretchr/testify/assert/assertions.go | 384 +- .../github.com/stretchr/testify/assert/doc.go | 43 +- .../testify/assert/http_assertions.go | 12 +- vendor/golang.org/x/crypto/AUTHORS | 3 - vendor/golang.org/x/crypto/CONTRIBUTORS | 3 - vendor/golang.org/x/sync/AUTHORS | 3 - vendor/golang.org/x/sync/CONTRIBUTORS | 3 - vendor/golang.org/x/sync/errgroup/errgroup.go | 14 +- vendor/golang.org/x/sync/errgroup/go120.go | 14 + .../golang.org/x/sync/errgroup/pre_go120.go | 15 + .../x/sync/singleflight/singleflight.go | 11 +- vendor/golang.org/x/text/AUTHORS | 3 - vendor/golang.org/x/text/CONTRIBUTORS | 3 - .../golang.org/x/text/cases/tables13.0.0.go | 4 +- .../golang.org/x/text/cases/tables15.0.0.go | 2528 ++++++ vendor/golang.org/x/text/cases/trieval.go | 73 +- .../internal/language/compact/language.go | 2 +- .../text/internal/language/compact/tables.go | 356 +- .../x/text/internal/language/language.go | 2 +- .../x/text/internal/language/lookup.go | 4 +- .../x/text/internal/language/parse.go | 24 +- .../x/text/internal/language/tables.go | 4782 +++++----- vendor/golang.org/x/text/language/doc.go | 44 +- vendor/golang.org/x/text/language/go1_1.go | 39 - vendor/golang.org/x/text/language/go1_2.go | 12 - vendor/golang.org/x/text/language/language.go | 2 +- vendor/golang.org/x/text/language/match.go | 4 +- vendor/golang.org/x/text/language/parse.go | 8 +- vendor/golang.org/x/text/language/tables.go | 138 +- .../x/text/unicode/norm/forminfo.go | 11 +- .../x/text/unicode/norm/normalize.go | 11 +- .../x/text/unicode/norm/tables13.0.0.go | 8 +- .../x/text/unicode/norm/tables15.0.0.go | 7908 +++++++++++++++++ vendor/golang.org/x/text/unicode/norm/trie.go | 2 +- vendor/modules.txt | 21 +- 75 files changed, 15275 insertions(+), 3428 deletions(-) create mode 100644 vendor/github.com/libsv/go-bc/bump.go create mode 100644 vendor/github.com/libsv/go-bc/endian.go create mode 100644 vendor/github.com/libsv/go-bc/merklepath.go create mode 100644 vendor/github.com/libsv/go-bt/v2/bscript/inscriptions.go create mode 100644 vendor/github.com/libsv/go-bt/v2/inscriptions.go create mode 100644 vendor/github.com/libsv/go-p2p/chaincfg/chainhash/README.md create mode 100644 vendor/github.com/libsv/go-p2p/chaincfg/chainhash/doc.go create mode 100644 vendor/github.com/libsv/go-p2p/chaincfg/chainhash/hash.go create mode 100644 vendor/github.com/libsv/go-p2p/chaincfg/chainhash/hashfuncs.go delete mode 100644 vendor/golang.org/x/crypto/AUTHORS delete mode 100644 vendor/golang.org/x/crypto/CONTRIBUTORS delete mode 100644 vendor/golang.org/x/sync/AUTHORS delete mode 100644 vendor/golang.org/x/sync/CONTRIBUTORS create mode 100644 vendor/golang.org/x/sync/errgroup/go120.go create mode 100644 vendor/golang.org/x/sync/errgroup/pre_go120.go delete mode 100644 vendor/golang.org/x/text/AUTHORS delete mode 100644 vendor/golang.org/x/text/CONTRIBUTORS create mode 100644 vendor/golang.org/x/text/cases/tables15.0.0.go delete mode 100644 vendor/golang.org/x/text/language/go1_1.go delete mode 100644 vendor/golang.org/x/text/language/go1_2.go create mode 100644 vendor/golang.org/x/text/unicode/norm/tables15.0.0.go diff --git a/go.mod b/go.mod index 6783e4b..f92409c 100644 --- a/go.mod +++ b/go.mod @@ -4,20 +4,20 @@ go 1.17 require ( github.com/go-zeromq/zmq4 v0.15.0 - github.com/libsv/go-bc v0.1.11 + github.com/libsv/go-bc v0.1.29 github.com/libsv/go-bk v0.1.6 - github.com/libsv/go-bt/v2 v2.1.0-beta.4 + github.com/libsv/go-bt/v2 v2.2.5 github.com/pkg/errors v0.9.1 - github.com/stretchr/testify v1.8.0 - golang.org/x/sync v0.0.0-20220601150217-0de741cfad7f + github.com/stretchr/testify v1.8.4 + golang.org/x/sync v0.3.0 ) require ( github.com/davecgh/go-spew v1.1.1 // indirect github.com/go-zeromq/goczmq/v4 v4.2.2 // indirect - github.com/kr/text v0.2.0 // indirect + github.com/libsv/go-p2p v0.1.3 // indirect github.com/pmezard/go-difflib v1.0.0 // indirect - golang.org/x/crypto v0.0.0-20210921155107-089bfa567519 // indirect - golang.org/x/text v0.3.7 // indirect + golang.org/x/crypto v0.13.0 // indirect + golang.org/x/text v0.13.0 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect ) diff --git a/go.sum b/go.sum index 64756ed..7208232 100644 --- a/go.sum +++ b/go.sum @@ -1,5 +1,4 @@ -github.com/bitcoinsv/bsvd v0.0.0-20190609155523-4c29707f7173/go.mod h1:BZ1UcC9+tmcDEcdVXgpt13hMczwJxWzpAn68wNs7zRA= -github.com/bitcoinsv/bsvutil v0.0.0-20181216182056-1d77cf353ea9/go.mod h1:p44KuNKUH5BC8uX4ONEODaHUR4+ibC8todEAOGQEJAM= +github.com/cbeuw/connutil v0.0.0-20200411215123-966bfaa51ee3/go.mod h1:6jR2SzckGv8hIIS9zWJ160mzGVVOYp4AXZMDtacL6LE= github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= @@ -8,49 +7,96 @@ github.com/go-zeromq/goczmq/v4 v4.2.2 h1:HAJN+i+3NW55ijMJJhk7oWxHKXgAuSBkoFfvr8b github.com/go-zeromq/goczmq/v4 v4.2.2/go.mod h1:Sm/lxrfxP/Oxqs0tnHD6WAhwkWrx+S+1MRrKzcxoaYE= github.com/go-zeromq/zmq4 v0.15.0 h1:SLqukpmLTx0JsLaOaCCjwy5eBdfJ+ouJX/677HoFbJM= github.com/go-zeromq/zmq4 v0.15.0/go.mod h1:sD47DcXifeUFsVTB2ps8ijqTpEuTAlYgfuLoiWEXdCE= -github.com/kr/pretty v0.1.0 h1:L/CwN0zerZDmRFUapSPitk6f+Q3+0za1rQkzVuMiMFI= -github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= +github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI= +github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE= +github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk= github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ= github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI= github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY= github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE= -github.com/libsv/go-bc v0.1.11 h1:putnzopVpWy5i+HaVSSXya7ot4mLHFOUU39JZUFfBmM= -github.com/libsv/go-bc v0.1.11/go.mod h1:55OsjWtvaIEXy4w02icUi2lIdThuwqkAiSeF4GPU5tw= -github.com/libsv/go-bk v0.1.5/go.mod h1:xbDkeFFpP0uyFaPLnP6TwaLpAsHaslZ0LftTdWlB6HI= +github.com/libsv/go-bc v0.1.29 h1:w3ZnpZxLkTrjklwkr9x/y/xv0vJz5FVVZjd/gvtvGQs= +github.com/libsv/go-bc v0.1.29/go.mod h1:l6epTfcakN8YKId/hrpUzlu1QeT3ODF1MI3DeYhG1O8= github.com/libsv/go-bk v0.1.6 h1:c9CiT5+64HRDbzxPl1v/oiFmbvWZTuUYqywCf+MBs/c= github.com/libsv/go-bk v0.1.6/go.mod h1:khJboDoH18FPUaZlzRFKzlVN84d4YfdmlDtdX4LAjQA= -github.com/libsv/go-bt/v2 v2.1.0-beta.2/go.mod h1:u5g3GmVLffBV8sWvMqHR3JekC51OR9XYvmQp1h/XoiQ= -github.com/libsv/go-bt/v2 v2.1.0-beta.4 h1:eLp2XKPRnVrcoiGpjK9fsiTK8OT103LNvZ7VUC4mH20= -github.com/libsv/go-bt/v2 v2.1.0-beta.4/go.mod h1:KbBf6ugGNMtVwtCSUtlSAHoVhbAie4hu2VM97d1ZL8I= +github.com/libsv/go-bt/v2 v2.2.5 h1:VoggBLMRW9NYoFujqe5bSYKqnw5y+fYfufgERSoubog= +github.com/libsv/go-bt/v2 v2.2.5/go.mod h1:cV45+jDlPOLfhJLfpLmpQoWzrIvVth9Ao2ZO1f6CcqU= +github.com/libsv/go-p2p v0.1.3 h1:70v/k7d6mtFPRP8tXYpAMGZNTxqSZAVTbYeTPuTbjTA= +github.com/libsv/go-p2p v0.1.3/go.mod h1:5+VqOblMYadFH7pmm55PcfbbWcXib8cTh9CHIrrxtZg= +github.com/mattn/go-colorable v0.1.2/go.mod h1:U0ppj6V5qS13XJ6of8GYAs25YV2eR4EVcfRqFIhoBtE= +github.com/mattn/go-colorable v0.1.13/go.mod h1:7S9/ev0klgBDR4GtXTXX8a3vIGJpMovkB8vQcUbaXHg= +github.com/mattn/go-isatty v0.0.8/go.mod h1:Iq45c/XA43vh69/j3iqttzPXn0bhXyGjM0Hdxcsrc5s= +github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= +github.com/mgutz/ansi v0.0.0-20170206155736-9520e82c474b/go.mod h1:01TrycV0kFyexm33Z7vhZRXopbI8J3TDReVlkTgMUxE= +github.com/ordishs/go-utils v1.0.24/go.mod h1:k9G7Bbv2GwoOn9fwZx70yM5jwwIymkv+90FUKLudtyc= +github.com/ordishs/gocore v1.0.33/go.mod h1:Nm48yxIUBuKvVXwLC8bB8aQDNUsBpaoVRTtcmjKlhrQ= +github.com/pkg/diff v0.0.0-20210226163009-20ebb0f2a09e/go.mod h1:pJLUxLENpZxwdsKMEsNbx1VGcRFpLqf3715MtcvvzbA= github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= +github.com/rogpeppe/go-internal v1.9.0 h1:73kH8U+JUqXU8lRuOHeVHaa/SZPifC7BkcraZVejAe8= +github.com/rogpeppe/go-internal v1.9.0/go.mod h1:WtVeX8xhTBvf0smdhujwtBcq4Qrzq/fJaraNFVN+nFs= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/objx v0.4.0/go.mod h1:YvHI0jy2hoMjB+UWwv71VJQ9isScKT/TqJzVSSt89Yw= +github.com/stretchr/objx v0.5.0/go.mod h1:Yh+to48EsGEfYuaHDzXPcE3xhTkx73EhmCGUpEOglKo= github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= github.com/stretchr/testify v1.7.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= -github.com/stretchr/testify v1.8.0 h1:pSgiaMZlXftHpm5L7V1+rVB+AZJydKsMxsQBIJw4PKk= github.com/stretchr/testify v1.8.0/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU= +github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= +github.com/stretchr/testify v1.8.2/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= +github.com/stretchr/testify v1.8.4 h1:CcVxjf3Q8PM0mHUKJCdn+eZZtm5yQwehR5yeSVQQcUk= +github.com/stretchr/testify v1.8.4/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo= +github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY= +golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= golang.org/x/crypto v0.0.0-20210421170649-83a5a9bb288b/go.mod h1:T9bdIzuCu7OtxOm1hfPfRQxPLYneinmdGuTeoZ9dtd4= -golang.org/x/crypto v0.0.0-20210711020723-a769d52b0f97/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= -golang.org/x/crypto v0.0.0-20210921155107-089bfa567519 h1:7I4JAnoQBe7ZtJcBaYHi5UtiO8tQHbUSXxL+pnGRANg= golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= +golang.org/x/crypto v0.13.0 h1:mvySKfSWJ+UKUii46M40LOvyWfN0s2U+46/jDd0e6Ck= +golang.org/x/crypto v0.13.0/go.mod h1:y6Z2r+Rw4iayiXXAIxJIDAJ1zMW4yaTpebo8fPOliYc= +golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4= +golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= +golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= golang.org/x/net v0.0.0-20210226172049-e18ecbb05110/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg= -golang.org/x/sync v0.0.0-20210220032951-036812b2e83c/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= -golang.org/x/sync v0.0.0-20220601150217-0de741cfad7f h1:Ax0t5p6N38Ga0dThY21weqDEyz2oklo4IvDkpigvkD8= +golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c= +golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs= +golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg= +golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20220601150217-0de741cfad7f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= +golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= +golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= +golang.org/x/sync v0.3.0 h1:ftCYgMx6zT/asHUrPw8BLLscYtGznsLAnjq5RH9P66E= +golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y= +golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= +golang.org/x/sys v0.0.0-20190222072716-a9d3bda3a223/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.3.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= +golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= +golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k= +golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo= +golang.org/x/term v0.12.0/go.mod h1:owVbMEjm3cBLCHdkQu9b1opXd4ETQWc3BhuQGKgXgvU= +golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= -golang.org/x/text v0.3.7 h1:olpwvP2KacW1ZWvsR7uQhoyTYvKAupfQrRGBFM352Gk= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= +golang.org/x/text v0.6.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= +golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= +golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= +golang.org/x/text v0.13.0 h1:ablQoSUd0tRdKxZewP80B+BaqeKJuVhuRxj/dkrun3k= +golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= +golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= +golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc= +golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU= +golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= -gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127 h1:qIbj1fsPNlZgppZ+VLlY7N33q108Sa+fhmuc+sWQYwY= -gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= +gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk= +gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q= gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= -gopkg.in/yaml.v3 v3.0.0-20210107192922-496545a6307b/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= diff --git a/vendor/github.com/libsv/go-bc/.golangci.yml b/vendor/github.com/libsv/go-bc/.golangci.yml index 569bc51..707752c 100644 --- a/vendor/github.com/libsv/go-bc/.golangci.yml +++ b/vendor/github.com/libsv/go-bc/.golangci.yml @@ -239,9 +239,6 @@ linters-settings: line-length: 150 # tab width in spaces. Default to 1. tab-width: 1 - maligned: - # print struct with more effective memory layout or not, false by default - suggest-new: true misspell: # Correct spellings using locale preferences for US or UK. # Default is to use a neutral variety of English. @@ -339,7 +336,6 @@ linters: - revive - unconvert - dupl - - maligned - misspell - dogsled - prealloc @@ -388,7 +384,6 @@ issues: - goconst - dupl - gosec - - maligned - lll # Exclude known linters from partially hard-vendored code, diff --git a/vendor/github.com/libsv/go-bc/.goreleaser.yml b/vendor/github.com/libsv/go-bc/.goreleaser.yml index 989c429..896c561 100644 --- a/vendor/github.com/libsv/go-bc/.goreleaser.yml +++ b/vendor/github.com/libsv/go-bc/.goreleaser.yml @@ -23,12 +23,13 @@ build: - windows - darwin archives: - - replacements: - darwin: Darwin - linux: Linux - windows: Windows - 386: i386 - amd64: x86_64 + - name_template: >- + {{- .ProjectName }}_ + {{- title .Os }}_ + {{- if eq .Arch "amd64" }}x86_64 + {{- else if eq .Arch "386" }}i386 + {{- else }}{{ .Arch }}{{ end }} + {{- if .Arm }}v{{ .Arm }}{{ end -}} checksum: name_template: 'checksums.txt' # --------------------------- diff --git a/vendor/github.com/libsv/go-bc/Makefile b/vendor/github.com/libsv/go-bc/Makefile index 693ec6c..efb5060 100644 --- a/vendor/github.com/libsv/go-bc/Makefile +++ b/vendor/github.com/libsv/go-bc/Makefile @@ -16,7 +16,7 @@ run-unit-tests-cover: open file:///$(shell pwd)/cover.html run-linter: - @golangci-lint run --deadline=480s --skip-dirs=vendor --tests + @golangci-lint run --skip-dirs=vendor --tests install-linter: @curl -sSfL https://raw.githubusercontent.com/golangci/golangci-lint/master/install.sh | sh -s -- -b $(go env GOPATH)bin v1.45.2 diff --git a/vendor/github.com/libsv/go-bc/README.md b/vendor/github.com/libsv/go-bc/README.md index 81d2a5b..c1275b5 100644 --- a/vendor/github.com/libsv/go-bc/README.md +++ b/vendor/github.com/libsv/go-bc/README.md @@ -3,7 +3,7 @@ > The go-to Bitcoin Block Chain (BC) GoLang library [![Release](https://img.shields.io/github/release-pre/libsv/go-bc.svg?logo=github&style=flat&v=1)](https://github.com/libsv/go-bc/releases) -[![Build Status](https://img.shields.io/github/workflow/status/libsv/go-bc/run-go-tests?logo=github&v=3)](https://github.com/libsv/go-bc/actions) +[![Build Status](https://img.shields.io/github/actions/workflow/status/libsv/go-bc/run-tests.yml?logo=github&v=3)](https://github.com/libsv/go-bc/actions) [![Report](https://goreportcard.com/badge/github.com/libsv/go-bc?style=flat&v=1)](https://goreportcard.com/report/github.com/libsv/go-bc) [![codecov](https://codecov.io/gh/libsv/go-bc/branch/master/graph/badge.svg?v=1)](https://codecov.io/gh/libsv/go-bc) [![Go](https://img.shields.io/github/go-mod/go-version/libsv/go-bc?v=1)](https://golang.org/) diff --git a/vendor/github.com/libsv/go-bc/block.go b/vendor/github.com/libsv/go-bc/block.go index ce117b9..d52e6e1 100644 --- a/vendor/github.com/libsv/go-bc/block.go +++ b/vendor/github.com/libsv/go-bc/block.go @@ -1,3 +1,4 @@ +// Package bc is a bitcoin blockchain library bc = block chain. package bc import ( diff --git a/vendor/github.com/libsv/go-bc/blockheader.go b/vendor/github.com/libsv/go-bc/blockheader.go index 469f1cd..0086c76 100644 --- a/vendor/github.com/libsv/go-bc/blockheader.go +++ b/vendor/github.com/libsv/go-bc/blockheader.go @@ -24,12 +24,12 @@ Nonce 32-bit number (starts at 0) 4 // A BlockHeader in the Bitcoin blockchain. type BlockHeader struct { - Version uint32 - Time uint32 - Nonce uint32 - HashPrevBlock []byte - HashMerkleRoot []byte - Bits []byte + Version uint32 `json:"version"` + Time uint32 `json:"time"` + Nonce uint32 `json:"nonce"` + HashPrevBlock []byte `json:"hashPrevBlock"` + HashMerkleRoot []byte `json:"merkleRoot"` + Bits []byte `json:"bits"` } type bhJSON struct { diff --git a/vendor/github.com/libsv/go-bc/bump.go b/vendor/github.com/libsv/go-bc/bump.go new file mode 100644 index 0000000..beffd10 --- /dev/null +++ b/vendor/github.com/libsv/go-bc/bump.go @@ -0,0 +1,290 @@ +package bc + +import ( + "encoding/hex" + "encoding/json" + "errors" + "fmt" + "math" + "sort" + + "github.com/libsv/go-bt/v2" + "github.com/libsv/go-p2p/chaincfg/chainhash" +) + +// BUMP data model json format according to BRC-74. +type BUMP struct { + BlockHeight uint64 `json:"blockHeight"` + Path [][]leaf `json:"path"` +} + +// It should be written such that the internal bytes are kept for calculations. +// and the JSON is generated from the internal struct to an external format. +// leaf represents a leaf in the Merkle tree. +type leaf struct { + Offset *uint64 `json:"offset,omitempty"` + Hash *string `json:"hash,omitempty"` + Txid *bool `json:"txid,omitempty"` + Duplicate *bool `json:"duplicate,omitempty"` +} + +// NewBUMPFromStream takes an array of bytes and contructs a BUMP from it, returning the BUMP +// and the bytes used. Despite the name, this is not actually reading a stream in the true sense: +// it is a byte slice that contains many BUMPs one after another. +func NewBUMPFromStream(bytes []byte) (*BUMP, int, error) { + if len(bytes) < 37 { + return nil, 0, errors.New("BUMP bytes do not contain enough data to be valid") + } + bump := &BUMP{} + + // first bytes are the block height. + var skip int + index, size := bt.NewVarIntFromBytes(bytes[skip:]) + skip += size + bump.BlockHeight = uint64(index) + + // Next byte is the tree height. + treeHeight := uint(bytes[skip]) + skip++ + + // We expect tree height levels. + bump.Path = make([][]leaf, treeHeight) + + for lv := uint(0); lv < treeHeight; lv++ { + // For each level we parse a bunch of nLeaves. + n, size := bt.NewVarIntFromBytes(bytes[skip:]) + skip += size + nLeavesAtThisHeight := uint64(n) + if nLeavesAtThisHeight == 0 { + return nil, 0, errors.New("There are no leaves at height: " + fmt.Sprint(lv) + " which makes this invalid") + } + bump.Path[lv] = make([]leaf, nLeavesAtThisHeight) + for lf := uint64(0); lf < nLeavesAtThisHeight; lf++ { + // For each leaf we parse the offset, hash, txid and duplicate. + offset, size := bt.NewVarIntFromBytes(bytes[skip:]) + skip += size + var l leaf + o := uint64(offset) + l.Offset = &o + flags := bytes[skip] + skip++ + dup := flags&1 > 0 + txid := flags&2 > 0 + if dup { + l.Duplicate = &dup + } else { + if len(bytes) < skip+32 { + return nil, 0, errors.New("BUMP bytes do not contain enough data to be valid") + } + h := StringFromBytesReverse(bytes[skip : skip+32]) + l.Hash = &h + skip += 32 + } + if txid { + l.Txid = &txid + } + bump.Path[lv][lf] = l + } + } + + // Sort each of the levels by the offset for consistency. + for _, level := range bump.Path { + sort.Slice(level, func(i, j int) bool { + return *level[i].Offset < *level[j].Offset + }) + } + + return bump, skip, nil +} + +// NewBUMPFromBytes creates a new BUMP from a byte slice. +func NewBUMPFromBytes(bytes []byte) (*BUMP, error) { + bump, _, err := NewBUMPFromStream(bytes) + if err != nil { + return nil, err + } + return bump, nil +} + +// NewBUMPFromStr creates a BUMP from hex string. +func NewBUMPFromStr(str string) (*BUMP, error) { + bytes, err := hex.DecodeString(str) + if err != nil { + return nil, err + } + return NewBUMPFromBytes(bytes) +} + +// NewBUMPFromJSON creates a BUMP from a JSON string. +func NewBUMPFromJSON(jsonStr string) (*BUMP, error) { + bump := &BUMP{} + err := json.Unmarshal([]byte(jsonStr), bump) + if err != nil { + return nil, err + } + return bump, nil +} + +// Bytes encodes a BUMP as a slice of bytes. BUMP Binary Format according to BRC-74 https://brc.dev/74 +func (bump *BUMP) Bytes() ([]byte, error) { + bytes := []byte{} + bytes = append(bytes, bt.VarInt(bump.BlockHeight).Bytes()...) + treeHeight := len(bump.Path) + bytes = append(bytes, byte(treeHeight)) + for level := 0; level < treeHeight; level++ { + nLeaves := len(bump.Path[level]) + bytes = append(bytes, bt.VarInt(nLeaves).Bytes()...) + for _, leaf := range bump.Path[level] { + bytes = append(bytes, bt.VarInt(*leaf.Offset).Bytes()...) + flags := byte(0) + if leaf.Duplicate != nil { + flags |= 1 + } + if leaf.Txid != nil { + flags |= 2 + } + bytes = append(bytes, flags) + if (flags & 1) == 0 { + bytes = append(bytes, BytesFromStringReverse(*leaf.Hash)...) + } + } + } + return bytes, nil +} + +// String encodes a BUMP as a hex string. +func (bump *BUMP) String() (string, error) { + bytes, err := bump.Bytes() + if err != nil { + return "", err + } + return hex.EncodeToString(bytes), nil +} + +// Txids returns the txids within the BUMP which the client is expecting. +// This allows a client to receive one BUMP for a whole block and it will know which txids it should update. +func (bump *BUMP) Txids() []string { + txids := make([]string, 0) + for _, leaf := range bump.Path[0] { + if leaf.Txid != nil { + txids = append(txids, *leaf.Hash) + } + } + return txids +} + +// CalculateRootGivenTxid calculates the root of the Merkle tree given a txid. +func (bump *BUMP) CalculateRootGivenTxid(txid string) (string, error) { + if len(bump.Path) == 1 { + // if there is only one txid in the block then the root is the txid. + if len(bump.Path[0]) == 1 { + return txid, nil + } + } + // Find the index of the txid at the lowest level of the Merkle tree + var index uint64 + txidFound := false + for _, l := range bump.Path[0] { + if *l.Hash == txid { + txidFound = true + index = *l.Offset + break + } + } + if !txidFound { + return "", errors.New("The BUMP does not contain the txid: " + txid) + } + + // Calculate the root using the index as a way to determine which direction to concatenate. + workingHash := BytesFromStringReverse(txid) + for height, leaves := range bump.Path { + offset := (index >> height) ^ 1 + var leafAtThisLevel leaf + offsetFound := false + for _, l := range leaves { + if *l.Offset == offset { + offsetFound = true + leafAtThisLevel = l + break + } + } + if !offsetFound { + return "", fmt.Errorf("We do not have a hash for this index at height: %v", height) + } + + var digest []byte + if leafAtThisLevel.Duplicate != nil { + digest = append(workingHash, workingHash...) + } else { + leafBytes := BytesFromStringReverse(*leafAtThisLevel.Hash) + if (offset % 2) != 0 { + digest = append(workingHash, leafBytes...) + } else { + digest = append(leafBytes, workingHash...) + } + } + workingHash = Sha256Sha256(digest) + } + return StringFromBytesReverse(workingHash), nil +} + +// NewBUMPFromMerkleTreeAndIndex with merkle tree we calculate the merkle path for a given transaction. +func NewBUMPFromMerkleTreeAndIndex(blockHeight uint64, merkleTree []*chainhash.Hash, txIndex uint64) (*BUMP, error) { + if len(merkleTree) == 0 { + return nil, errors.New("merkle tree is empty") + } + + bump := &BUMP{ + BlockHeight: blockHeight, + } + + truePointer := true + txid := merkleTree[txIndex].String() + txidLeaf := leaf{Txid: &truePointer, Hash: &txid, Offset: &txIndex} + + if len(merkleTree) == 1 { + // there is no merkle path to calculate + bump.Path = [][]leaf{{txidLeaf}} + return bump, nil + } + + oddTxIndex := false + + numOfTxids := (len(merkleTree) + 1) / 2 + treeHeight := int(math.Log2(float64(numOfTxids))) + numOfHashes := numOfTxids + bump.Path = make([][]leaf, treeHeight) + + levelOffset := 0 + for height := 0; height < treeHeight; height++ { + offset := txIndex >> uint64(height) + if offset&1 == 0 { + // offset is even we need to use the hash to the right. + offset++ + } else { + // we need to use the hash to the left. + oddTxIndex = true + offset-- + } + thisLeaf := leaf{Offset: &offset} + hash := merkleTree[levelOffset+int(offset)] + if hash.IsEqual(nil) { + thisLeaf.Duplicate = &truePointer + } else { + sh := hash.String() + thisLeaf.Hash = &sh + } + bump.Path[height] = []leaf{thisLeaf} + levelOffset += numOfHashes + numOfHashes >>= 1 + } + if oddTxIndex { + // if the txIndex is odd we need to add the txid to the path. + bump.Path[0] = append(bump.Path[0], txidLeaf) + } else { + // otherwise prepend it. + bump.Path[0] = append([]leaf{txidLeaf}, bump.Path[0]...) + } + + return bump, nil +} diff --git a/vendor/github.com/libsv/go-bc/endian.go b/vendor/github.com/libsv/go-bc/endian.go new file mode 100644 index 0000000..78155d3 --- /dev/null +++ b/vendor/github.com/libsv/go-bc/endian.go @@ -0,0 +1,28 @@ +package bc + +import ( + "crypto/sha256" + "encoding/hex" + + "github.com/libsv/go-bt/v2" +) + +// BytesFromStringReverse decodes a hex string into a byte slice and reverses it. +func BytesFromStringReverse(s string) []byte { + bytes, _ := hex.DecodeString(s) + rev := bt.ReverseBytes(bytes) + return rev +} + +// StringFromBytesReverse reverses a byte slice and encodes it as a hex string. +func StringFromBytesReverse(h []byte) string { + rev := bt.ReverseBytes(h) + return hex.EncodeToString(rev) +} + +// Sha256Sha256 calculates the double sha256 hash of a byte slice. +func Sha256Sha256(digest []byte) []byte { + sha := sha256.Sum256(digest) + dsha := sha256.Sum256(sha[:]) + return dsha[:] +} diff --git a/vendor/github.com/libsv/go-bc/mapicallback.go b/vendor/github.com/libsv/go-bc/mapicallback.go index 3112fb2..fc5fa58 100644 --- a/vendor/github.com/libsv/go-bc/mapicallback.go +++ b/vendor/github.com/libsv/go-bc/mapicallback.go @@ -23,7 +23,6 @@ func NewMapiCallbackFromBytes(b []byte) (*MapiCallback, error) { if err != nil { return nil, err } - // TODO check signature is valid. return &mapiCallback, nil } diff --git a/vendor/github.com/libsv/go-bc/merklepath.go b/vendor/github.com/libsv/go-bc/merklepath.go new file mode 100644 index 0000000..32b889c --- /dev/null +++ b/vendor/github.com/libsv/go-bc/merklepath.go @@ -0,0 +1,137 @@ +package bc + +import ( + "encoding/hex" + + "github.com/libsv/go-bt/v2" +) + +// MerklePath data model json format according to BRC-58. +type MerklePath struct { + Index uint64 `json:"index"` + Path []string `json:"path"` +} + +// NewMerklePathFromBytes creates a new MerklePath from a byte slice. +func NewMerklePathFromBytes(bytes []byte) (*MerklePath, error) { + mp := &MerklePath{} + mp.Path = make([]string, 0) + + // start paring transaction index. + var offset int + index, size := bt.NewVarIntFromBytes(bytes[offset:]) + offset += size + mp.Index = uint64(index) + + // next value in the byte array is nLeaves (number of leaves in merkle path). + nLeaves, size := bt.NewVarIntFromBytes(bytes[offset:]) + offset += size + + // parse each leaf from the binary path + for k := 0; k < int(nLeaves); k++ { + leaf := bytes[offset : offset+32] + mp.Path = append(mp.Path, StringFromBytesReverse(leaf)) + offset += 32 + } + + return mp, nil +} + +// NewMerklePathFromStr creates a MerklePath from hex string. +func NewMerklePathFromStr(str string) (*MerklePath, error) { + bytes, err := hex.DecodeString(str) + if err != nil { + return nil, err + } + return NewMerklePathFromBytes(bytes) +} + +// Bytes encodes a MerklePath as a slice of bytes. MerklePath Binary Format according to BRC-71 https://brc.dev/71 +func (mp *MerklePath) Bytes() ([]byte, error) { + index := bt.VarInt(mp.Index) + nLeaves := bt.VarInt(len(mp.Path)) + + // first two arguments in merkle path bynary format are index of the transaction and number of leaves. + bytes := []byte{} + bytes = append(bytes, index.Bytes()...) + bytes = append(bytes, nLeaves.Bytes()...) + + // now add each leaf into the binary path. + for _, leaf := range mp.Path { + // append leaf bytes into binary path, little endian. + bytes = append(bytes, BytesFromStringReverse(leaf)...) + } + + return bytes, nil +} + +// String encodes a MerklePath as a hex string. +func (mp *MerklePath) String() (string, error) { + bytes, err := mp.Bytes() + if err != nil { + return "", err + } + return hex.EncodeToString(bytes), nil +} + +// CalculateRoot calculates the merkle root from a transaction ID and a MerklePath. +func (mp *MerklePath) CalculateRoot(txid string) (string, error) { + // start with txid + workingHash := BytesFromStringReverse(txid) + lsb := mp.Index + // hash with each path branch + for _, leaf := range mp.Path { + var digest []byte + leafBytes := BytesFromStringReverse(leaf) + // if the least significant bit is 1 then the working hash is on the right. + if lsb&1 > 0 { + digest = append(leafBytes, workingHash...) + } else { + digest = append(workingHash, leafBytes...) + } + workingHash = Sha256Sha256(digest) + lsb = lsb >> 1 + } + return StringFromBytesReverse(workingHash), nil +} + +// getPathElements traverses the tree and returns the path to Merkle root. +func getPathElements(txIndex int, hashes []string) []string { + // if our hash index is odd the next hash of the path is the previous element in the array otherwise the next element. + var path []string + var hash string + if txIndex%2 == 0 { + hash = hashes[txIndex+1] + } else { + hash = hashes[txIndex-1] + } + + // when generating path if the neighbour is empty we append itself + if hash == "" { + path = append(path, hashes[txIndex]) + } else { + path = append(path, hash) + } + + // If we reach the Merkle root hash stop path calculation. + if len(hashes) == 3 { + return path + } + + return append(path, getPathElements(txIndex/2, hashes[(len(hashes)+1)/2:])...) +} + +// GetTxMerklePath with merkle tree we calculate the merkle path for a given transaction. +func GetTxMerklePath(txIndex int, merkleTree []string) *MerklePath { + merklePath := &MerklePath{ + Index: uint64(txIndex), + Path: nil, + } + + // if we have only one transaction in the block there is no merkle path to calculate + if len(merkleTree) != 1 { + merklePath.Path = getPathElements(txIndex, merkleTree) + } + + return merklePath +} diff --git a/vendor/github.com/libsv/go-bc/merkleroot.go b/vendor/github.com/libsv/go-bc/merkleroot.go index 8cf5f74..8404256 100644 --- a/vendor/github.com/libsv/go-bc/merkleroot.go +++ b/vendor/github.com/libsv/go-bc/merkleroot.go @@ -7,6 +7,7 @@ import ( "github.com/libsv/go-bk/crypto" "github.com/libsv/go-bt/v2" + "github.com/libsv/go-p2p/chaincfg/chainhash" ) // TxsToTxIDs takes an array of transactions @@ -67,7 +68,7 @@ func BuildMerkleRoot(txids []string) (string, error) { // // The above stored as a linear array is as follows: // -// [h1 h2 h3 h4 h12 h34 root] +// [h1 h2 h3 h4 h12 h34 root] // // As the above shows, the merkle root is always the last element in the array. // @@ -128,6 +129,41 @@ func BuildMerkleTreeStore(txids []string) ([]string, error) { return merkles, nil } +// BuildMerkleTreeStoreChainHash has the same functionality as BuildMerkleTreeStore but uses chainhash as a type to avoid string conversions. +func BuildMerkleTreeStoreChainHash(txids []*chainhash.Hash) []*chainhash.Hash { + // // Calculate how many entries are re?n array of that size. + nextPoT := nextPowerOfTwo(len(txids)) + arraySize := nextPoT*2 - 1 + merkles := make([]*chainhash.Hash, arraySize) + + // Create the base transaction hashes and populate the array with them. + copy(merkles, txids) + + // Start the array offset after the last transaction and adjusted to the + // next power of two. + offset := nextPoT + for i := 0; i < arraySize-1; i += 2 { + switch { + // When there is no left child node, the parent is nil ("") too. + case merkles[i].IsEqual(nil): + merkles[offset] = nil + + // When there is no right child, the parent is generated by + // hashing the concatenation of the left child with itself. + case merkles[i+1].IsEqual(nil): + merkles[offset] = MerkleTreeParentBytes(merkles[i], merkles[i]) + + // The normal case sets the parent node to the double sha256 + // of the concatenation of the left and right children. + default: + merkles[offset] = MerkleTreeParentBytes(merkles[i], merkles[i+1]) + } + offset++ + } + + return merkles +} + // nextPowerOfTwo returns the next highest power of two from a given number if // it is not already a power of two. This is a helper function used during the // calculation of a merkle tree. diff --git a/vendor/github.com/libsv/go-bc/merkletreeparent.go b/vendor/github.com/libsv/go-bc/merkletreeparent.go index beedc29..275f806 100644 --- a/vendor/github.com/libsv/go-bc/merkletreeparent.go +++ b/vendor/github.com/libsv/go-bc/merkletreeparent.go @@ -5,6 +5,7 @@ import ( "github.com/libsv/go-bk/crypto" "github.com/libsv/go-bt/v2" + "github.com/libsv/go-p2p/chaincfg/chainhash" ) // MerkleTreeParentStr returns the Merkle Tree parent of two Merkle @@ -38,3 +39,16 @@ func MerkleTreeParent(leftNode, rightNode []byte) []byte { // swap endianness at the end and convert to hex string return bt.ReverseBytes(hash) } + +// MerkleTreeParentBytes returns the Merkle Tree parent of two Merkle Tree children. +// The expectation is that the bytes are not reversed. +func MerkleTreeParentBytes(l *chainhash.Hash, r *chainhash.Hash) *chainhash.Hash { + lb := l.CloneBytes() + rb := r.CloneBytes() + concat := append(lb, rb...) + hash, err := chainhash.NewHash(crypto.Sha256d(concat)) + if err != nil { + return &chainhash.Hash{} + } + return hash +} diff --git a/vendor/github.com/libsv/go-bt/v2/.golangci.yml b/vendor/github.com/libsv/go-bt/v2/.golangci.yml index 895af4f..d4fc6e4 100644 --- a/vendor/github.com/libsv/go-bt/v2/.golangci.yml +++ b/vendor/github.com/libsv/go-bt/v2/.golangci.yml @@ -337,7 +337,7 @@ linters: - dupl - misspell - dogsled - - revive + # - revive - prealloc - exportloopref - exhaustive diff --git a/vendor/github.com/libsv/go-bt/v2/.goreleaser.yml b/vendor/github.com/libsv/go-bt/v2/.goreleaser.yml index 7580a49..d36e768 100644 --- a/vendor/github.com/libsv/go-bt/v2/.goreleaser.yml +++ b/vendor/github.com/libsv/go-bt/v2/.goreleaser.yml @@ -23,5 +23,5 @@ build: # Github Release # --------------------------- release: - prerelease: true + # prerelease: true name_template: "Release v{{.Version}}" \ No newline at end of file diff --git a/vendor/github.com/libsv/go-bt/v2/README.md b/vendor/github.com/libsv/go-bt/v2/README.md index e815c8d..3de560e 100644 --- a/vendor/github.com/libsv/go-bt/v2/README.md +++ b/vendor/github.com/libsv/go-bt/v2/README.md @@ -34,7 +34,7 @@ **go-bt** requires a [supported release of Go](https://golang.org/doc/devel/release.html#policy). ```shell script -go get -u github.com/libsv/go-bt +go get -u github.com/libsv/go-bt/v2 ```
diff --git a/vendor/github.com/libsv/go-bt/v2/bscript/address.go b/vendor/github.com/libsv/go-bt/v2/bscript/address.go index 6b7455f..b530be8 100644 --- a/vendor/github.com/libsv/go-bt/v2/bscript/address.go +++ b/vendor/github.com/libsv/go-bt/v2/bscript/address.go @@ -1,3 +1,4 @@ +// Package bscript comment package bscript import ( @@ -83,7 +84,7 @@ func NewAddressFromPublicKeyHash(hash []byte, mainnet bool) (*Address, error) { if !mainnet { bb[0] = 111 } - // nolint: makezero // we need to set up the array with 1 + //nolint: makezero // we need to set up the array with 1 bb = append(bb, hash...) return &Address{ @@ -105,7 +106,7 @@ func NewAddressFromPublicKey(pubKey *bec.PublicKey, mainnet bool) (*Address, err if !mainnet { bb[0] = 111 } - // nolint: makezero // we need to set up the array with 1 + //nolint: makezero // we need to set up the array with 1 bb = append(bb, hash...) return &Address{ diff --git a/vendor/github.com/libsv/go-bt/v2/bscript/errors.go b/vendor/github.com/libsv/go-bt/v2/bscript/errors.go index 0f2256e..87aada9 100644 --- a/vendor/github.com/libsv/go-bt/v2/bscript/errors.go +++ b/vendor/github.com/libsv/go-bt/v2/bscript/errors.go @@ -15,6 +15,11 @@ var ( ErrUnsupportedAddress = errors.New("address not supported") ) +// Sentinel errors raised by inscriptions. +var ( + ErrP2PKHInscriptionNotFound = errors.New("no P2PKH inscription found") +) + // Sentinel errors raised through encoding. var ( ErrEncodingBadChar = errors.New("bad char") diff --git a/vendor/github.com/libsv/go-bt/v2/bscript/inscriptions.go b/vendor/github.com/libsv/go-bt/v2/bscript/inscriptions.go new file mode 100644 index 0000000..4a93a99 --- /dev/null +++ b/vendor/github.com/libsv/go-bt/v2/bscript/inscriptions.go @@ -0,0 +1,15 @@ +package bscript + +// InscriptionArgs contains the Ordinal inscription data. +type InscriptionArgs struct { + LockingScriptPrefix *Script + Data []byte + ContentType string + EnrichedArgs *EnrichedInscriptionArgs +} + +// EnrichedInscriptionArgs contains data needed for enriched inscription +// functionality found here: https://docs.1satordinals.com/op_return. +type EnrichedInscriptionArgs struct { + OpReturnData [][]byte +} diff --git a/vendor/github.com/libsv/go-bt/v2/bscript/script.go b/vendor/github.com/libsv/go-bt/v2/bscript/script.go index 0ff6dad..216106e 100644 --- a/vendor/github.com/libsv/go-bt/v2/bscript/script.go +++ b/vendor/github.com/libsv/go-bt/v2/bscript/script.go @@ -6,6 +6,7 @@ import ( "encoding/binary" "encoding/hex" "fmt" + "math/bits" "strings" "github.com/libsv/go-bk/bec" @@ -15,13 +16,14 @@ import ( // ScriptKey types. const ( - ScriptTypePubKey = "pubkey" - ScriptTypePubKeyHash = "pubkeyhash" - ScriptTypeNonStandard = "nonstandard" - ScriptTypeEmpty = "empty" - ScriptTypeSecureHash = "securehash" - ScriptTypeMultiSig = "multisig" - ScriptTypeNullData = "nulldata" + // TODO: change to p2pk/p2pkh + ScriptTypePubKey = "pubkey" + ScriptTypePubKeyHash = "pubkeyhash" + ScriptTypeNonStandard = "nonstandard" + ScriptTypeEmpty = "empty" + ScriptTypeMultiSig = "multisig" + ScriptTypeNullData = "nulldata" + ScriptTypePubKeyHashInscription = "pubkeyhashinscription" ) // Script type @@ -233,13 +235,32 @@ func (s *Script) ToASM() (string, error) { parts, err := DecodeParts(*s) // if err != nil, we will append [error] to the ASM script below (as done in the node). + data := false + if len(*s) > 1 && ((*s)[0] == OpRETURN || ((*s)[0] == OpFALSE && (*s)[1] == OpRETURN)) { + data = true + } + var asm strings.Builder + for _, p := range parts { asm.WriteRune(' ') if len(p) == 1 { - asm.WriteString(opCodeValues[p[0]]) + if data && p[0] != 0x6a { + asm.WriteString(fmt.Sprintf("%d", p[0])) + } else { + asm.WriteString(opCodeValues[p[0]]) + } } else { - asm.WriteString(hex.EncodeToString(p)) + if data && len(p) <= 4 { + b := make([]byte, 0) + b = append(b, p...) + for i := 0; i < 4-len(p); i++ { + b = append(b, 0) + } + asm.WriteString(fmt.Sprintf("%d", binary.LittleEndian.Uint32(b))) + } else { + asm.WriteString(hex.EncodeToString(p)) + } } } @@ -301,6 +322,82 @@ func (s *Script) IsData() bool { (len(b) > 1 && b[0] == OpFALSE && b[1] == OpRETURN) } +// IsInscribed returns true if this script includes an +// inscription with any prepended script (not just p2pkh). +func (s *Script) IsInscribed() bool { + isncPattern, _ := hex.DecodeString("0063036f7264") + return bytes.Contains(*s, isncPattern) +} + +// IsP2PKHInscription checks if it's a standard +// inscription with a P2PKH prefix script. +func (s *Script) IsP2PKHInscription() bool { + p, err := DecodeParts(*s) + if err != nil { + return false + } + + return isP2PKHInscriptionHelper(p) +} + +// isP2PKHInscriptionHelper helper so that we don't need to call +// `DecodeParts()` multiple times, such as in `ParseInscription()` +func isP2PKHInscriptionHelper(parts [][]byte) bool { + if len(parts) < 13 { + return false + } + valid := parts[0][0] == OpDUP && + parts[1][0] == OpHASH160 && + parts[3][0] == OpEQUALVERIFY && + parts[4][0] == OpCHECKSIG && + parts[5][0] == OpFALSE && + parts[6][0] == OpIF && + parts[7][0] == 0x6f && parts[7][1] == 0x72 && parts[7][2] == 0x64 && // op_push "ord" + parts[8][0] == OpTRUE && + parts[10][0] == OpFALSE && + parts[12][0] == OpENDIF + + if len(parts) > 13 { + return parts[13][0] == OpRETURN && valid + } + return valid +} + +// ParseInscription parses the script to +// return the inscription found. Will return +// an error if the script doesn't contain +// any inscriptions. +func (s *Script) ParseInscription() (*InscriptionArgs, error) { + p, err := DecodeParts(*s) + if err != nil { + return nil, err + } + + if !isP2PKHInscriptionHelper(p) { + return nil, ErrP2PKHInscriptionNotFound + } + + // FIXME: make it dynamic based on order. + // right now if the content type and the content change order + // then this will fail. My understanding is that the content + // always needs to be last and the previous fields can be + // reordered - this is based on the original ordinals + // indexer: https://github.com/casey/ord + return &InscriptionArgs{ + LockingScriptPrefix: s.Slice(0, 25), + Data: p[11], + ContentType: string(p[9]), + // EnrichedArgs: , // TODO: + }, nil +} + +// Slice a script to get back a subset of that script. +func (s *Script) Slice(start, end uint64) *Script { + ss := *s + sss := ss[start:end] + return &sss +} + // IsMultiSigOut returns true if this is a multisig output script. func (s *Script) IsMultiSigOut() bool { parts, err := DecodeParts(*s) @@ -336,7 +433,7 @@ func (s *Script) PublicKeyHash() ([]byte, error) { return nil, ErrEmptyScript } - if (*s)[0] != OpDUP || (*s)[1] != OpHASH160 { + if (*s)[0] != OpDUP || len(*s) <= 2 || (*s)[1] != OpHASH160 { return nil, ErrNotP2PKH } @@ -365,6 +462,9 @@ func (s *Script) ScriptType() string { if s.IsData() { return ScriptTypeNullData } + if s.IsP2PKHInscription() { + return ScriptTypePubKeyHashInscription + } return ScriptTypeNonStandard } @@ -408,8 +508,8 @@ func (s *Script) EqualsHex(h string) bool { func MinPushSize(bb []byte) int { l := len(bb) - // data length is larger than max supported - if l > 0xffffffff { + // data length is larger than max supported by the bitcoin protocol + if bits.UintSize == 64 && int64(l) > 0xffffffff { return 0 } diff --git a/vendor/github.com/libsv/go-bt/v2/errors.go b/vendor/github.com/libsv/go-bt/v2/errors.go index 86f5100..2caa8dc 100644 --- a/vendor/github.com/libsv/go-bt/v2/errors.go +++ b/vendor/github.com/libsv/go-bt/v2/errors.go @@ -18,6 +18,10 @@ var ( var ( ErrInputNoExist = errors.New("specified input does not exist") ErrInputTooShort = errors.New("input length too short") + + // You should not be able to spend an input with 0 Satoshi value. + // Most likely the input Satoshi value is not provided. + ErrInputSatsZero = errors.New("input satoshi value is not provided") ) // Sentinal errors reported by outputs. @@ -46,7 +50,7 @@ var ( ErrUnknownFeeType = errors.New("unknown fee type") ) -// Sentinel errors reported by Fund +// Sentinel errors reported by Fund. var ( // ErrNoUTXO signals the UTXOGetterFunc has reached the end of its input. ErrNoUTXO = errors.New("no remaining utxos") @@ -54,3 +58,19 @@ var ( // ErrInsufficientFunds insufficient funds provided for funding ErrInsufficientFunds = errors.New("insufficient funds provided") ) + +// Sentinal errors reported by ordinal inscriptions. +var ( + ErrOutputsNotEmpty = errors.New("transaction outputs must be empty to avoid messing with Ordinal ordering scheme") +) + +// Sentinal errors reported by PSBTs. +var ( + ErrDummyInput = errors.New("failed to add dummy input 0") + ErrInsufficientUTXOs = errors.New("need at least 2 utxos") + ErrInsufficientUTXOValue = errors.New("need at least 1 utxos which is > ordinal price") + ErrUTXOInputMismatch = errors.New("utxo and input mismatch") + ErrInvalidSellOffer = errors.New("invalid sell offer (partially signed tx)") + ErrEmptyScripts = errors.New("at least one of needed scripts is empty") + ErrInsufficientFees = errors.New("fee paid not enough with new locking script") +) diff --git a/vendor/github.com/libsv/go-bt/v2/fees.go b/vendor/github.com/libsv/go-bt/v2/fees.go index 6c2f4a6..2afa6e4 100644 --- a/vendor/github.com/libsv/go-bt/v2/fees.go +++ b/vendor/github.com/libsv/go-bt/v2/fees.go @@ -294,11 +294,11 @@ func defaultStandardFee() *Fee { FeeType: FeeTypeStandard, MiningFee: FeeUnit{ Satoshis: 5, - Bytes: 10, + Bytes: 100, }, RelayFee: FeeUnit{ Satoshis: 5, - Bytes: 10, + Bytes: 100, }, } } @@ -310,11 +310,11 @@ func defaultDataFee() *Fee { FeeType: FeeTypeData, MiningFee: FeeUnit{ Satoshis: 5, - Bytes: 10, + Bytes: 100, }, RelayFee: FeeUnit{ Satoshis: 5, - Bytes: 10, + Bytes: 100, }, } } diff --git a/vendor/github.com/libsv/go-bt/v2/input.go b/vendor/github.com/libsv/go-bt/v2/input.go index 93452bd..0601809 100644 --- a/vendor/github.com/libsv/go-bt/v2/input.go +++ b/vendor/github.com/libsv/go-bt/v2/input.go @@ -28,7 +28,6 @@ const DefaultSequenceNumber uint32 = 0xFFFFFFFF // Input is a representation of a transaction input // // DO NOT CHANGE ORDER - Optimised for memory via maligned -// type Input struct { previousTxID []byte PreviousTxSatoshis uint64 @@ -40,6 +39,16 @@ type Input struct { // ReadFrom reads from the `io.Reader` into the `bt.Input`. func (i *Input) ReadFrom(r io.Reader) (int64, error) { + return i.readFrom(r, false) +} + +// ReadFromExtended reads the `io.Reader` into the `bt.Input` when the reader is +// consuming an extended format transaction. +func (i *Input) ReadFromExtended(r io.Reader) (int64, error) { + return i.readFrom(r, true) +} + +func (i *Input) readFrom(r io.Reader, extended bool) (int64, error) { *i = Input{} var bytesRead int64 @@ -83,6 +92,37 @@ func (i *Input) ReadFrom(r io.Reader) (int64, error) { i.UnlockingScript = bscript.NewFromBytes(script) i.SequenceNumber = binary.LittleEndian.Uint32(sequence) + if extended { + prevSatoshis := make([]byte, 8) + var prevTxLockingScript bscript.Script + + n, err = io.ReadFull(r, prevSatoshis) + bytesRead += int64(n) + if err != nil { + return bytesRead, errors.Wrapf(err, "prevSatoshis(8): got %d bytes", n) + } + + // Read in the prevTxLockingScript + var scriptLen VarInt + n64, err := scriptLen.ReadFrom(r) + bytesRead += n64 + if err != nil { + return bytesRead, err + } + + script := make([]byte, scriptLen) + n, err := io.ReadFull(r, script) + bytesRead += int64(n) + if err != nil { + return bytesRead, errors.Wrapf(err, "script(%d): got %d bytes", scriptLen.Length(), n) + } + + prevTxLockingScript = *bscript.NewFromBytes(script) + + i.PreviousTxSatoshis = binary.LittleEndian.Uint64(prevSatoshis) + i.PreviousTxScript = bscript.NewFromBytes(prevTxLockingScript) + } + return bytesRead, nil } diff --git a/vendor/github.com/libsv/go-bt/v2/inscriptions.go b/vendor/github.com/libsv/go-bt/v2/inscriptions.go new file mode 100644 index 0000000..bbe20af --- /dev/null +++ b/vendor/github.com/libsv/go-bt/v2/inscriptions.go @@ -0,0 +1,131 @@ +package bt + +import ( + "github.com/libsv/go-bt/v2/bscript" +) + +// OrdinalsPrefix contains 'ORD' the inscription protocol prefix. +// +// Check the docs here: https://docs.1satordinals.com/ +const OrdinalsPrefix = "ord" + +// Inscribe adds an output to the transaction with an inscription. +func (tx *Tx) Inscribe(ia *bscript.InscriptionArgs) error { + s := *ia.LockingScriptPrefix // deep copy + + // add Inscription data + // (Example: OP_FALSE + // OP_IF + // OP_PUSH + // "ord" + // OP_1 + // OP_PUSH + // "text/plain;charset=utf-8" + // OP_0 + // OP_PUSH + // "Hello, world!" + // OP_ENDIF + // ) + // see: https://docs.ordinals.com/inscriptions.html + _ = s.AppendOpcodes(bscript.OpFALSE, bscript.OpIF) + err := s.AppendPushDataString(OrdinalsPrefix) + if err != nil { + return err + } + _ = s.AppendOpcodes(bscript.Op1) + err = s.AppendPushData([]byte(ia.ContentType)) + if err != nil { + return err + } + _ = s.AppendOpcodes(bscript.Op0) + err = s.AppendPushData(ia.Data) + if err != nil { + return err + } + _ = s.AppendOpcodes(bscript.OpENDIF) + + if ia.EnrichedArgs != nil { + if len(ia.EnrichedArgs.OpReturnData) > 0 { + + // FIXME: import cycle + // // Sign with AIP + // _, outData, _, err := aip.SignOpReturnData(*signingKey, "BITCOIN_ECDSA", opReturn) + // if err != nil { + // return nil, err + // } + + _ = s.AppendOpcodes(bscript.OpRETURN) + if err := s.AppendPushDataArray(ia.EnrichedArgs.OpReturnData); err != nil { + return err + } + } + } + + tx.AddOutput(&Output{ + Satoshis: 1, + LockingScript: &s, + }) + return nil +} + +// InscribeSpecificOrdinal gives you the functionality to choose +// a specific ordinal from the inputs to inscribe. +// +// You need to provide the input and Satoshi range indices in order +// to specify the ordinal you would like to inscribe, along with the +// change addresses to be used for the rest of the Satoshis. +// +// One output will be created with the extra Satoshis and then another +// output will be created with 1 Satoshi with the inscription in it. +func (tx *Tx) InscribeSpecificOrdinal(ia *bscript.InscriptionArgs, inputIdx uint32, satoshiIdx uint64, + extraOutputScript *bscript.Script) error { + amount, err := rangeAbove(tx.Inputs, inputIdx, satoshiIdx) + if err != nil { + return err + } + + if tx.OutputCount() > 0 { + return ErrOutputsNotEmpty + } + + tx.AddOutput(&Output{ + Satoshis: amount, + LockingScript: extraOutputScript, + }) + + err = tx.Inscribe(ia) + if err != nil { + return err + } + + return nil +} + +// This function returns the Satoshi amount needed for the output slot +// above the ordinal required so that we can separate the out the ordinal +// from the inputs to the outputs. +// +// This is the way ordinals go from inputs to outputs: +// [a b] [c] [d e f] → [? ? ? ?] [? ?] +// To figure out which satoshi goes to which output, go through the input +// satoshis in order and assign each to a question mark: +// [a b] [c] [d e f] → [a b c d] [e f] +// +// For more info check the Ordinals Theory Handbook (https://docs.ordinals.com/faq.html). +func rangeAbove(is []*Input, inputIdx uint32, satIdx uint64) (uint64, error) { + if uint32(len(is)) < inputIdx { + return 0, ErrOutputNoExist + } + + var acc uint64 + for i, in := range is { + if uint32(i) >= inputIdx { + break + } + if in.PreviousTxSatoshis == 0 { + return 0, ErrInputSatsZero + } + acc += in.PreviousTxSatoshis + } + return acc + satIdx, nil +} diff --git a/vendor/github.com/libsv/go-bt/v2/output.go b/vendor/github.com/libsv/go-bt/v2/output.go index 2a48910..37e0e7e 100644 --- a/vendor/github.com/libsv/go-bt/v2/output.go +++ b/vendor/github.com/libsv/go-bt/v2/output.go @@ -24,8 +24,8 @@ Txout-script / scriptPubKey Script 0 || extended { + // Re-read the actual output count... + n64, err = outputCount.ReadFrom(r) + bytesRead += n64 + if err != nil { + return bytesRead, err + } } for i := uint64(0); i < uint64(outputCount); i++ { @@ -178,7 +191,6 @@ func (tx *Tx) ReadFrom(r io.Reader) (int64, error) { tx.Outputs = append(tx.Outputs, output) } - locktime := make([]byte, 4) n, err = io.ReadFull(r, locktime) bytesRead += int64(n) if err != nil { @@ -297,19 +309,28 @@ func IsValidTxID(txid []byte) bool { // Bytes encodes the transaction into a byte array. // See https://chainquery.com/bitcoin-cli/decoderawtransaction func (tx *Tx) Bytes() []byte { - return tx.toBytesHelper(0, nil) + return tx.toBytesHelper(0, nil, false) +} + +// ExtendedBytes outputs the transaction into a byte array in extended format +// (with PreviousTxSatoshis and PreviousTXScript included) +func (tx *Tx) ExtendedBytes() []byte { + return tx.toBytesHelper(0, nil, true) } // BytesWithClearedInputs encodes the transaction into a byte array but clears its Inputs first. // This is used when signing transactions. func (tx *Tx) BytesWithClearedInputs(index int, lockingScript []byte) []byte { - return tx.toBytesHelper(index, lockingScript) + return tx.toBytesHelper(index, lockingScript, false) } // Clone returns a clone of the tx func (tx *Tx) Clone() *Tx { // Ignore err as byte slice passed in is created from valid tx - clone, _ := NewTxFromBytes(tx.Bytes()) + clone, err := NewTxFromBytes(tx.Bytes()) + if err != nil { + log.Fatal(err) + } for i, input := range tx.Inputs { clone.Inputs[i].PreviousTxSatoshis = input.PreviousTxSatoshis @@ -322,11 +343,13 @@ func (tx *Tx) Clone() *Tx { // NodeJSON returns a wrapped *bt.Tx for marshalling/unmarshalling into a node tx format. // // Marshalling usage example: -// bb, err := json.Marshal(tx.NodeJSON()) +// +// bb, err := json.Marshal(tx.NodeJSON()) // // Unmarshalling usage example: -// tx := bt.NewTx() -// if err := json.Unmarshal(bb, tx.NodeJSON()); err != nil {} +// +// tx := bt.NewTx() +// if err := json.Unmarshal(bb, tx.NodeJSON()); err != nil {} func (tx *Tx) NodeJSON() interface{} { return &nodeTxWrapper{Tx: tx} } @@ -334,20 +357,26 @@ func (tx *Tx) NodeJSON() interface{} { // NodeJSON returns a wrapped bt.Txs for marshalling/unmarshalling into a node tx format. // // Marshalling usage example: -// bb, err := json.Marshal(txs.NodeJSON()) +// +// bb, err := json.Marshal(txs.NodeJSON()) // // Unmarshalling usage example: -// var txs bt.Txs -// if err := json.Unmarshal(bb, txs.NodeJSON()); err != nil {} +// +// var txs bt.Txs +// if err := json.Unmarshal(bb, txs.NodeJSON()); err != nil {} func (tt *Txs) NodeJSON() interface{} { return (*nodeTxsWrapper)(tt) } -func (tx *Tx) toBytesHelper(index int, lockingScript []byte) []byte { +func (tx *Tx) toBytesHelper(index int, lockingScript []byte, extended bool) []byte { h := make([]byte, 0) h = append(h, LittleEndianBytes(tx.Version, 4)...) + if extended { + h = append(h, []byte{0x00, 0x00, 0x00, 0x00, 0x00, 0xEF}...) + } + h = append(h, VarInt(uint64(len(tx.Inputs))).Bytes()...) for i, in := range tx.Inputs { @@ -358,6 +387,20 @@ func (tx *Tx) toBytesHelper(index int, lockingScript []byte) []byte { } else { h = append(h, s...) } + + if extended { + b := make([]byte, 8) + binary.LittleEndian.PutUint64(b, in.PreviousTxSatoshis) + h = append(h, b...) + + if in.PreviousTxScript != nil { + l := uint64(len(*in.PreviousTxScript)) + h = append(h, VarInt(l).Bytes()...) + h = append(h, *in.PreviousTxScript...) + } else { + h = append(h, 0x00) // The length of the script is zero + } + } } h = append(h, VarInt(uint64(len(tx.Outputs))).Bytes()...) @@ -435,12 +478,15 @@ func (tx *Tx) EstimateSizeWithTypes() (*TxSize, error) { func (tx *Tx) estimatedFinalTx() (*Tx, error) { tempTx := tx.Clone() - for _, in := range tempTx.Inputs { - if !in.PreviousTxScript.IsP2PKH() { + for i, in := range tempTx.Inputs { + if in.PreviousTxScript == nil { + return nil, fmt.Errorf("%w at index %d in order to calc expected UnlockingScript", ErrEmptyPreviousTxScript, i) + } + if !(in.PreviousTxScript.IsP2PKH() || in.PreviousTxScript.IsP2PKHInscription()) { return nil, ErrUnsupportedScript } if in.UnlockingScript == nil || len(*in.UnlockingScript) == 0 { - // nolint:lll // insert dummy p2pkh unlocking script (sig + pubkey) + //nolint:lll // insert dummy p2pkh unlocking script (sig + pubkey) dummyUnlockingScript, _ := hex.DecodeString("4830450221009c13cbcbb16f2cfedc7abf3a4af1c3fe77df1180c0e7eee30d9bcc53ebda39da02207b258005f1bc3cf9dffa06edb358d6db2bcfc87f50516fac8e3f4686fc2a03df412103107feff22788a1fc8357240bf450fd7bca4bd45d5f8bac63818c5a7b67b03876") in.UnlockingScript = bscript.NewFromBytes(dummyUnlockingScript) } @@ -524,12 +570,12 @@ func (tx *Tx) feesPaid(size *TxSize, fees *FeeQuote) (*TxFees, error) { return nil, err } - resp := &TxFees{ + txFees := &TxFees{ StdFeePaid: size.TotalStdBytes * uint64(stdFee.MiningFee.Satoshis) / uint64(stdFee.MiningFee.Bytes), DataFeePaid: size.TotalDataBytes * uint64(dataFee.MiningFee.Satoshis) / uint64(dataFee.MiningFee.Bytes), } - resp.TotalFeePaid = resp.StdFeePaid + resp.DataFeePaid - return resp, nil + txFees.TotalFeePaid = txFees.StdFeePaid + txFees.DataFeePaid + return txFees, nil } diff --git a/vendor/github.com/libsv/go-bt/v2/txinput.go b/vendor/github.com/libsv/go-bt/v2/txinput.go index b12caf3..0f787f0 100644 --- a/vendor/github.com/libsv/go-bt/v2/txinput.go +++ b/vendor/github.com/libsv/go-bt/v2/txinput.go @@ -23,30 +23,6 @@ import ( // It is expected that bt.ErrNoUTXO will be returned once the utxo source is depleted. type UTXOGetterFunc func(ctx context.Context, deficit uint64) ([]*UTXO, error) -// newInputFromBytes returns a transaction input from the bytes provided. -func newInputFromBytes(bytes []byte) (*Input, int, error) { - if len(bytes) < 36 { - return nil, 0, fmt.Errorf("%w < 36", ErrInputTooShort) - } - - offset := 36 - l, size := NewVarIntFromBytes(bytes[offset:]) - offset += size - - totalLength := offset + int(l) + 4 // 4 bytes for nSeq - - if len(bytes) < totalLength { - return nil, 0, fmt.Errorf("%w < 36 + script + 4", ErrInputTooShort) - } - - return &Input{ - previousTxID: ReverseBytes(bytes[0:32]), - PreviousTxOutIndex: binary.LittleEndian.Uint32(bytes[32:36]), - SequenceNumber: binary.LittleEndian.Uint32(bytes[offset+int(l):]), - UnlockingScript: bscript.NewFromBytes(bytes[offset : offset+int(l)]), - }, totalLength, nil -} - // TotalInputSatoshis returns the total Satoshis inputted to the transaction. func (tx *Tx) TotalInputSatoshis() (total uint64) { for _, in := range tx.Inputs { @@ -137,25 +113,26 @@ func (tx *Tx) FromUTXOs(utxos ...*UTXO) error { // If insufficient utxos are provided from the UTXOGetterFunc, a bt.ErrInsufficientFunds is returned. // // Example usage: -// if err := tx.Fund(ctx, bt.NewFeeQuote(), func(ctx context.Context, deficit satoshis) ([]*bt.UTXO, error) { -// utxos := make([]*bt.UTXO, 0) -// for _, f := range funds { -// deficit -= satoshis -// utxos := append(utxos, &bt.UTXO{ -// TxID: f.TxID, -// Vout: f.Vout, -// LockingScript: f.Script, -// Satoshis: f.Satoshis, -// }) -// if deficit == 0 { -// return utxos, nil -// } -// } -// return nil, bt.ErrNoUTXO -// }); err != nil { -// if errors.Is(err, bt.ErrInsufficientFunds) { /* handle */ } -// return err -// } +// +// if err := tx.Fund(ctx, bt.NewFeeQuote(), func(ctx context.Context, deficit satoshis) ([]*bt.UTXO, error) { +// utxos := make([]*bt.UTXO, 0) +// for _, f := range funds { +// deficit -= satoshis +// utxos := append(utxos, &bt.UTXO{ +// TxID: f.TxID, +// Vout: f.Vout, +// LockingScript: f.Script, +// Satoshis: f.Satoshis, +// }) +// if deficit == 0 { +// return utxos, nil +// } +// } +// return nil, bt.ErrNoUTXO +// }); err != nil { +// if errors.Is(err, bt.ErrInsufficientFunds) { /* handle */ } +// return err +// } func (tx *Tx) Fund(ctx context.Context, fq *FeeQuote, next UTXOGetterFunc) error { deficit, err := tx.estimateDeficit(fq) if err != nil { @@ -234,7 +211,7 @@ func (tx *Tx) InsertInputUnlockingScript(index uint32, s *bscript.Script) error // It takes an Unlocker interface as a parameter so that different // unlocking implementations can be used to unlock the transaction - // for example local or external unlocking (hardware wallet), or -// signature/nonsignature based. +// signature / non-signature based. func (tx *Tx) FillInput(ctx context.Context, unlocker Unlocker, params UnlockerParams) error { if unlocker == nil { return ErrNoUnlocker @@ -244,12 +221,12 @@ func (tx *Tx) FillInput(ctx context.Context, unlocker Unlocker, params UnlockerP params.SigHashFlags = sighash.AllForkID } - uscript, err := unlocker.UnlockingScript(ctx, tx, params) + unlockingScript, err := unlocker.UnlockingScript(ctx, tx, params) if err != nil { return err } - return tx.InsertInputUnlockingScript(params.InputIdx, uscript) + return tx.InsertInputUnlockingScript(params.InputIdx, unlockingScript) } // FillAllInputs is used to sign all inputs. It takes an UnlockerGetter interface diff --git a/vendor/github.com/libsv/go-bt/v2/txoutput.go b/vendor/github.com/libsv/go-bt/v2/txoutput.go index e6a241e..be72f76 100644 --- a/vendor/github.com/libsv/go-bt/v2/txoutput.go +++ b/vendor/github.com/libsv/go-bt/v2/txoutput.go @@ -158,7 +158,7 @@ func (tx *Tx) AddHashPuzzleOutput(secret, publicKeyHash string, satoshis uint64) // AddOpReturnOutput creates a new Output with OP_FALSE OP_RETURN and then the data // passed in encoded as hex. func (tx *Tx) AddOpReturnOutput(data []byte) error { - o, err := createOpReturnOutput([][]byte{data}) + o, err := CreateOpReturnOutput([][]byte{data}) if err != nil { return err } @@ -170,7 +170,7 @@ func (tx *Tx) AddOpReturnOutput(data []byte) error { // AddOpReturnPartsOutput creates a new Output with OP_FALSE OP_RETURN and then // uses OP_PUSHDATA format to encode the multiple byte arrays passed in. func (tx *Tx) AddOpReturnPartsOutput(data [][]byte) error { - o, err := createOpReturnOutput(data) + o, err := CreateOpReturnOutput(data) if err != nil { return err } @@ -178,7 +178,9 @@ func (tx *Tx) AddOpReturnPartsOutput(data [][]byte) error { return nil } -func createOpReturnOutput(data [][]byte) (*Output, error) { +// CreateOpReturnOutput creates a new Output with OP_FALSE OP_RETURN and then +// uses OP_PUSHDATA format to encode the multiple byte arrays passed in. +func CreateOpReturnOutput(data [][]byte) (*Output, error) { s := &bscript.Script{} _ = s.AppendOpcodes(bscript.OpFALSE, bscript.OpRETURN) diff --git a/vendor/github.com/libsv/go-bt/v2/unlocker.go b/vendor/github.com/libsv/go-bt/v2/unlocker.go index 8db5984..c69e010 100644 --- a/vendor/github.com/libsv/go-bt/v2/unlocker.go +++ b/vendor/github.com/libsv/go-bt/v2/unlocker.go @@ -13,6 +13,8 @@ type UnlockerParams struct { InputIdx uint32 // SigHashFlags the be applied [DEFAULT ALL|FORKID] SigHashFlags sighash.Flag + // TODO: add previous tx script and sats here instead of in + // input (and potentially remove from input) - see issue #143 } // Unlocker interface to allow custom implementations of different unlocking mechanisms. diff --git a/vendor/github.com/libsv/go-bt/v2/utxo.go b/vendor/github.com/libsv/go-bt/v2/utxo.go index 324fc5e..d4dacdb 100644 --- a/vendor/github.com/libsv/go-bt/v2/utxo.go +++ b/vendor/github.com/libsv/go-bt/v2/utxo.go @@ -8,11 +8,12 @@ import ( // UTXO an unspent transaction output, used for creating inputs type UTXO struct { - TxID []byte - Vout uint32 - LockingScript *bscript.Script - Satoshis uint64 - SequenceNumber uint32 + TxID []byte `json:"txid"` + Vout uint32 `json:"vout"` + LockingScript *bscript.Script `json:"locking_script"` + Satoshis uint64 `json:"satoshis"` + SequenceNumber uint32 `json:"sequence_number"` + Unlocker *Unlocker `json:"-"` } // UTXOs a collection of *bt.UTXO. diff --git a/vendor/github.com/libsv/go-p2p/chaincfg/chainhash/README.md b/vendor/github.com/libsv/go-p2p/chaincfg/chainhash/README.md new file mode 100644 index 0000000..a8279e3 --- /dev/null +++ b/vendor/github.com/libsv/go-p2p/chaincfg/chainhash/README.md @@ -0,0 +1,21 @@ +chainhash +========= + +[![Build Status](https://travis-ci.org/bitcoinsv/bsvd.png?branch=master)](https://travis-ci.org/bitcoinsv/bsvd) +[![ISC License](http://img.shields.io/badge/license-ISC-blue.svg)](http://copyfree.org) +[![GoDoc](https://img.shields.io/badge/godoc-reference-blue.svg)](http://godoc.org/arc/p2p/chaincfg/chainhash) +======= + +chainhash provides a generic hash type and associated functions that allows the +specific hash algorithm to be abstracted. + +## Installation and Updating + +```bash +$ go get -u arc/p2p/chaincfg/chainhash +``` + +## License + +Package chainhash is licensed under the [copyfree](http://copyfree.org) ISC +License. diff --git a/vendor/github.com/libsv/go-p2p/chaincfg/chainhash/doc.go b/vendor/github.com/libsv/go-p2p/chaincfg/chainhash/doc.go new file mode 100644 index 0000000..c3eb43d --- /dev/null +++ b/vendor/github.com/libsv/go-p2p/chaincfg/chainhash/doc.go @@ -0,0 +1,5 @@ +// Package chainhash provides abstracted hash functionality. +// +// This package provides a generic hash type and associated functions that +// allows the specific hash algorithm to be abstracted. +package chainhash diff --git a/vendor/github.com/libsv/go-p2p/chaincfg/chainhash/hash.go b/vendor/github.com/libsv/go-p2p/chaincfg/chainhash/hash.go new file mode 100644 index 0000000..42fb1ec --- /dev/null +++ b/vendor/github.com/libsv/go-p2p/chaincfg/chainhash/hash.go @@ -0,0 +1,156 @@ +// Copyright (c) 2013-2016 The btcsuite developers +// Copyright (c) 2015 The Decred developers +// Use of this source code is governed by an ISC +// license that can be found in the LICENSE file. + +package chainhash + +import ( + "encoding/hex" + "encoding/json" + "fmt" +) + +// HashSize of array used to store hashes. See Hash. +const HashSize = 32 + +// MaxHashStringSize is the maximum length of a Hash hash string. +const MaxHashStringSize = HashSize * 2 + +// ErrHashStrSize describes an error that indicates the caller specified a hash +// string that has too many characters. +var ErrHashStrSize = fmt.Errorf("max hash string length is %v bytes", MaxHashStringSize) + +// Hash is used in several of the bitcoin messages and common structures. It +// typically represents the double sha256 of data. +type Hash [HashSize]byte + +// String returns the Hash as the hexadecimal string of the byte-reversed +// hash. +func (hash Hash) String() string { + for i := 0; i < HashSize/2; i++ { + hash[i], hash[HashSize-1-i] = hash[HashSize-1-i], hash[i] + } + return hex.EncodeToString(hash[:]) +} + +// CloneBytes returns a copy of the bytes which represent the hash as a byte +// slice. +// +// NOTE: It is generally cheaper to just slice the hash directly thereby reusing +// the same bytes rather than calling this method. +func (hash *Hash) CloneBytes() []byte { + newHash := make([]byte, HashSize) + copy(newHash, hash[:]) + + return newHash +} + +// SetBytes sets the bytes which represent the hash. An error is returned if +// the number of bytes passed in is not HashSize. +func (hash *Hash) SetBytes(newHash []byte) error { + nhlen := len(newHash) + if nhlen != HashSize { + return fmt.Errorf("invalid hash length of %v, want %v", nhlen, + HashSize) + } + copy(hash[:], newHash) + + return nil +} + +// IsEqual returns true if target is the same as hash. +func (hash *Hash) IsEqual(target *Hash) bool { + if hash == nil && target == nil { + return true + } + if hash == nil || target == nil { + return false + } + return *hash == *target +} + +func (hash *Hash) MarshalJSON() ([]byte, error) { + return json.Marshal(hash.String()) +} + +func (hash *Hash) UnmarshalJSON(data []byte) error { + var s string + if err := json.Unmarshal(data, &s); err != nil { + return err + } + h, err := NewHashFromStr(s) + if err != nil { + return err + } + *hash = *h + return nil +} + +// NewHash returns a new Hash from a byte slice. An error is returned if +// the number of bytes passed in is not HashSize. +func NewHash(newHash []byte) (*Hash, error) { + var sh Hash + err := sh.SetBytes(newHash) + if err != nil { + return nil, err + } + return &sh, err +} + +// func NewHashNoError(newHash []byte) *Hash { +// sh, _ := NewHash(newHash) +// return sh +// } + +// NewHashFromStr creates a Hash from a hash string. The string should be +// the hexadecimal string of a byte-reversed hash, but any missing characters +// result in zero padding at the end of the Hash. +func NewHashFromStr(hash string) (*Hash, error) { + ret := new(Hash) + err := Decode(ret, hash) + if err != nil { + return nil, err + } + return ret, nil +} + +// func NewHashFromStrNoError(hash string) *Hash { +// sh, _ := NewHashFromStr(hash) +// return sh +// } + +// Decode decodes the byte-reversed hexadecimal string encoding of a Hash to a +// destination. +func Decode(dst *Hash, src string) error { + // Return error if hash string is too long. + if len(src) > MaxHashStringSize { + return ErrHashStrSize + } + + // Hex decoder expects the hash to be a multiple of two. When not, pad + // with a leading zero. + var srcBytes []byte + if len(src)%2 == 0 { + srcBytes = []byte(src) + } else { + srcBytes = make([]byte, 1+len(src)) + srcBytes[0] = '0' + copy(srcBytes[1:], src) + } + + // Hex decode the source bytes to a temporary destination. + var reversedHash Hash + _, err := hex.Decode(reversedHash[HashSize-hex.DecodedLen(len(srcBytes)):], srcBytes) + if err != nil { + return err + } + + // Reverse copy from the temporary hash to destination. Because the + // temporary was zeroed, the written result will be correctly padded. + for i, b := range reversedHash[:HashSize/2] { + dst[i], dst[HashSize-1-i] = reversedHash[HashSize-1-i], b + } + + return nil +} diff --git a/vendor/github.com/libsv/go-p2p/chaincfg/chainhash/hashfuncs.go b/vendor/github.com/libsv/go-p2p/chaincfg/chainhash/hashfuncs.go new file mode 100644 index 0000000..bf74f73 --- /dev/null +++ b/vendor/github.com/libsv/go-p2p/chaincfg/chainhash/hashfuncs.go @@ -0,0 +1,33 @@ +// Copyright (c) 2015 The Decred developers +// Copyright (c) 2016-2017 The btcsuite developers +// Use of this source code is governed by an ISC +// license that can be found in the LICENSE file. + +package chainhash + +import "crypto/sha256" + +// HashB calculates hash(b) and returns the resulting bytes. +func HashB(b []byte) []byte { + hash := sha256.Sum256(b) + return hash[:] +} + +// HashH calculates hash(b) and returns the resulting bytes as a Hash. +func HashH(b []byte) Hash { + return Hash(sha256.Sum256(b)) +} + +// DoubleHashB calculates hash(hash(b)) and returns the resulting bytes. +func DoubleHashB(b []byte) []byte { + first := sha256.Sum256(b) + second := sha256.Sum256(first[:]) + return second[:] +} + +// DoubleHashH calculates hash(hash(b)) and returns the resulting bytes as a +// Hash. +func DoubleHashH(b []byte) Hash { + first := sha256.Sum256(b) + return Hash(sha256.Sum256(first[:])) +} diff --git a/vendor/github.com/stretchr/testify/assert/assertion_compare.go b/vendor/github.com/stretchr/testify/assert/assertion_compare.go index 95d8e59..b774da8 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_compare.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_compare.go @@ -352,9 +352,9 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { // Greater asserts that the first element is greater than the second // -// assert.Greater(t, 2, 1) -// assert.Greater(t, float64(2), float64(1)) -// assert.Greater(t, "b", "a") +// assert.Greater(t, 2, 1) +// assert.Greater(t, float64(2), float64(1)) +// assert.Greater(t, "b", "a") func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -364,10 +364,10 @@ func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface // GreaterOrEqual asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqual(t, 2, 1) -// assert.GreaterOrEqual(t, 2, 2) -// assert.GreaterOrEqual(t, "b", "a") -// assert.GreaterOrEqual(t, "b", "b") +// assert.GreaterOrEqual(t, 2, 1) +// assert.GreaterOrEqual(t, 2, 2) +// assert.GreaterOrEqual(t, "b", "a") +// assert.GreaterOrEqual(t, "b", "b") func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -377,9 +377,9 @@ func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...in // Less asserts that the first element is less than the second // -// assert.Less(t, 1, 2) -// assert.Less(t, float64(1), float64(2)) -// assert.Less(t, "a", "b") +// assert.Less(t, 1, 2) +// assert.Less(t, float64(1), float64(2)) +// assert.Less(t, "a", "b") func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -389,10 +389,10 @@ func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) // LessOrEqual asserts that the first element is less than or equal to the second // -// assert.LessOrEqual(t, 1, 2) -// assert.LessOrEqual(t, 2, 2) -// assert.LessOrEqual(t, "a", "b") -// assert.LessOrEqual(t, "b", "b") +// assert.LessOrEqual(t, 1, 2) +// assert.LessOrEqual(t, 2, 2) +// assert.LessOrEqual(t, "a", "b") +// assert.LessOrEqual(t, "b", "b") func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -402,8 +402,8 @@ func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...inter // Positive asserts that the specified element is positive // -// assert.Positive(t, 1) -// assert.Positive(t, 1.23) +// assert.Positive(t, 1) +// assert.Positive(t, 1.23) func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -414,8 +414,8 @@ func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { // Negative asserts that the specified element is negative // -// assert.Negative(t, -1) -// assert.Negative(t, -1.23) +// assert.Negative(t, -1) +// assert.Negative(t, -1.23) func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/assert/assertion_format.go b/vendor/github.com/stretchr/testify/assert/assertion_format.go index 7880b8f..84dbd6c 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_format.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_format.go @@ -22,9 +22,9 @@ func Conditionf(t TestingT, comp Comparison, msg string, args ...interface{}) bo // Containsf asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Containsf(t, "Hello World", "World", "error message %s", "formatted") -// assert.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") -// assert.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") +// assert.Containsf(t, "Hello World", "World", "error message %s", "formatted") +// assert.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") +// assert.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") func Containsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -56,7 +56,7 @@ func ElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string // Emptyf asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Emptyf(t, obj, "error message %s", "formatted") +// assert.Emptyf(t, obj, "error message %s", "formatted") func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -66,7 +66,7 @@ func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) boo // Equalf asserts that two objects are equal. // -// assert.Equalf(t, 123, 123, "error message %s", "formatted") +// assert.Equalf(t, 123, 123, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -81,8 +81,8 @@ func Equalf(t TestingT, expected interface{}, actual interface{}, msg string, ar // EqualErrorf asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// assert.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// assert.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") func EqualErrorf(t TestingT, theError error, errString string, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -90,10 +90,27 @@ func EqualErrorf(t TestingT, theError error, errString string, msg string, args return EqualError(t, theError, errString, append([]interface{}{msg}, args...)...) } +// EqualExportedValuesf asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// assert.EqualExportedValuesf(t, S{1, 2}, S{1, 3}, "error message %s", "formatted") => true +// assert.EqualExportedValuesf(t, S{1, 2}, S{2, 3}, "error message %s", "formatted") => false +func EqualExportedValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return EqualExportedValues(t, expected, actual, append([]interface{}{msg}, args...)...) +} + // EqualValuesf asserts that two objects are equal or convertable to the same types // and equal. // -// assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") +// assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -103,10 +120,10 @@ func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg stri // Errorf asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if assert.Errorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedErrorf, err) -// } +// actualObj, err := SomeFunction() +// if assert.Errorf(t, err, "error message %s", "formatted") { +// assert.Equal(t, expectedErrorf, err) +// } func Errorf(t TestingT, err error, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -126,8 +143,8 @@ func ErrorAsf(t TestingT, err error, target interface{}, msg string, args ...int // ErrorContainsf asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// assert.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// assert.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") func ErrorContainsf(t TestingT, theError error, contains string, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -147,7 +164,7 @@ func ErrorIsf(t TestingT, err error, target error, msg string, args ...interface // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// assert.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -155,9 +172,34 @@ func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick return Eventually(t, condition, waitFor, tick, append([]interface{}{msg}, args...)...) } +// EventuallyWithTf asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// assert.EventuallyWithTf(t, func(c *assert.CollectT, "error message %s", "formatted") { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +func EventuallyWithTf(t TestingT, condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return EventuallyWithT(t, condition, waitFor, tick, append([]interface{}{msg}, args...)...) +} + // Exactlyf asserts that two objects are equal in value and type. // -// assert.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") +// assert.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") func Exactlyf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -183,7 +225,7 @@ func FailNowf(t TestingT, failureMessage string, msg string, args ...interface{} // Falsef asserts that the specified value is false. // -// assert.Falsef(t, myBool, "error message %s", "formatted") +// assert.Falsef(t, myBool, "error message %s", "formatted") func Falsef(t TestingT, value bool, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -202,9 +244,9 @@ func FileExistsf(t TestingT, path string, msg string, args ...interface{}) bool // Greaterf asserts that the first element is greater than the second // -// assert.Greaterf(t, 2, 1, "error message %s", "formatted") -// assert.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") -// assert.Greaterf(t, "b", "a", "error message %s", "formatted") +// assert.Greaterf(t, 2, 1, "error message %s", "formatted") +// assert.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") +// assert.Greaterf(t, "b", "a", "error message %s", "formatted") func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -214,10 +256,10 @@ func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...in // GreaterOrEqualf asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") +// assert.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") +// assert.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") +// assert.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") +// assert.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -228,7 +270,7 @@ func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, arg // HTTPBodyContainsf asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// assert.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) bool { @@ -241,7 +283,7 @@ func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url // HTTPBodyNotContainsf asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// assert.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) bool { @@ -253,7 +295,7 @@ func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, u // HTTPErrorf asserts that a specified handler returns an error status code. // -// assert.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -265,7 +307,7 @@ func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, // HTTPRedirectf asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -277,7 +319,7 @@ func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url stri // HTTPStatusCodef asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") +// assert.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msg string, args ...interface{}) bool { @@ -289,7 +331,7 @@ func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url st // HTTPSuccessf asserts that a specified handler returns a success status code. // -// assert.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") +// assert.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -301,7 +343,7 @@ func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url strin // Implementsf asserts that an object is implemented by the specified interface. // -// assert.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// assert.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -311,7 +353,7 @@ func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, ms // InDeltaf asserts that the two numerals are within delta of each other. // -// assert.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") +// assert.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") func InDeltaf(t TestingT, expected interface{}, actual interface{}, delta float64, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -353,9 +395,9 @@ func InEpsilonSlicef(t TestingT, expected interface{}, actual interface{}, epsil // IsDecreasingf asserts that the collection is decreasing // -// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") +// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -365,9 +407,9 @@ func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface // IsIncreasingf asserts that the collection is increasing // -// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") +// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -377,9 +419,9 @@ func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface // IsNonDecreasingf asserts that the collection is not decreasing // -// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") +// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -389,9 +431,9 @@ func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interf // IsNonIncreasingf asserts that the collection is not increasing // -// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") +// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsNonIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -409,7 +451,7 @@ func IsTypef(t TestingT, expectedType interface{}, object interface{}, msg strin // JSONEqf asserts that two JSON strings are equivalent. // -// assert.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") +// assert.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") func JSONEqf(t TestingT, expected string, actual string, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -420,7 +462,7 @@ func JSONEqf(t TestingT, expected string, actual string, msg string, args ...int // Lenf asserts that the specified object has specific length. // Lenf also fails if the object has a type that len() not accept. // -// assert.Lenf(t, mySlice, 3, "error message %s", "formatted") +// assert.Lenf(t, mySlice, 3, "error message %s", "formatted") func Lenf(t TestingT, object interface{}, length int, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -430,9 +472,9 @@ func Lenf(t TestingT, object interface{}, length int, msg string, args ...interf // Lessf asserts that the first element is less than the second // -// assert.Lessf(t, 1, 2, "error message %s", "formatted") -// assert.Lessf(t, float64(1), float64(2), "error message %s", "formatted") -// assert.Lessf(t, "a", "b", "error message %s", "formatted") +// assert.Lessf(t, 1, 2, "error message %s", "formatted") +// assert.Lessf(t, float64(1), float64(2), "error message %s", "formatted") +// assert.Lessf(t, "a", "b", "error message %s", "formatted") func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -442,10 +484,10 @@ func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...inter // LessOrEqualf asserts that the first element is less than or equal to the second // -// assert.LessOrEqualf(t, 1, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, "a", "b", "error message %s", "formatted") -// assert.LessOrEqualf(t, "b", "b", "error message %s", "formatted") +// assert.LessOrEqualf(t, 1, 2, "error message %s", "formatted") +// assert.LessOrEqualf(t, 2, 2, "error message %s", "formatted") +// assert.LessOrEqualf(t, "a", "b", "error message %s", "formatted") +// assert.LessOrEqualf(t, "b", "b", "error message %s", "formatted") func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -455,8 +497,8 @@ func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args . // Negativef asserts that the specified element is negative // -// assert.Negativef(t, -1, "error message %s", "formatted") -// assert.Negativef(t, -1.23, "error message %s", "formatted") +// assert.Negativef(t, -1, "error message %s", "formatted") +// assert.Negativef(t, -1.23, "error message %s", "formatted") func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -467,7 +509,7 @@ func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) bool // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// assert.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -477,7 +519,7 @@ func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time. // Nilf asserts that the specified object is nil. // -// assert.Nilf(t, err, "error message %s", "formatted") +// assert.Nilf(t, err, "error message %s", "formatted") func Nilf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -496,10 +538,10 @@ func NoDirExistsf(t TestingT, path string, msg string, args ...interface{}) bool // NoErrorf asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if assert.NoErrorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if assert.NoErrorf(t, err, "error message %s", "formatted") { +// assert.Equal(t, expectedObj, actualObj) +// } func NoErrorf(t TestingT, err error, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -519,9 +561,9 @@ func NoFileExistsf(t TestingT, path string, msg string, args ...interface{}) boo // NotContainsf asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") +// assert.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") +// assert.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") +// assert.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -532,9 +574,9 @@ func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, a // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmptyf(t, obj, "error message %s", "formatted") { -// assert.Equal(t, "two", obj[1]) -// } +// if assert.NotEmptyf(t, obj, "error message %s", "formatted") { +// assert.Equal(t, "two", obj[1]) +// } func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -544,7 +586,7 @@ func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) // NotEqualf asserts that the specified values are NOT equal. // -// assert.NotEqualf(t, obj1, obj2, "error message %s", "formatted") +// assert.NotEqualf(t, obj1, obj2, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -557,7 +599,7 @@ func NotEqualf(t TestingT, expected interface{}, actual interface{}, msg string, // NotEqualValuesf asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") +// assert.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -576,7 +618,7 @@ func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interf // NotNilf asserts that the specified object is not nil. // -// assert.NotNilf(t, err, "error message %s", "formatted") +// assert.NotNilf(t, err, "error message %s", "formatted") func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -586,7 +628,7 @@ func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) bo // NotPanicsf asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") +// assert.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") func NotPanicsf(t TestingT, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -596,8 +638,8 @@ func NotPanicsf(t TestingT, f PanicTestFunc, msg string, args ...interface{}) bo // NotRegexpf asserts that a specified regexp does not match a string. // -// assert.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") -// assert.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") +// assert.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") +// assert.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -607,7 +649,7 @@ func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args .. // NotSamef asserts that two pointers do not reference the same object. // -// assert.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") +// assert.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -621,7 +663,7 @@ func NotSamef(t TestingT, expected interface{}, actual interface{}, msg string, // NotSubsetf asserts that the specified list(array, slice...) contains not all // elements given in the specified subset(array, slice...). // -// assert.NotSubsetf(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") +// assert.NotSubsetf(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") func NotSubsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -639,7 +681,7 @@ func NotZerof(t TestingT, i interface{}, msg string, args ...interface{}) bool { // Panicsf asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") +// assert.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") func Panicsf(t TestingT, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -651,7 +693,7 @@ func Panicsf(t TestingT, f PanicTestFunc, msg string, args ...interface{}) bool // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// assert.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithErrorf(t TestingT, errString string, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -662,7 +704,7 @@ func PanicsWithErrorf(t TestingT, errString string, f PanicTestFunc, msg string, // PanicsWithValuef asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// assert.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithValuef(t TestingT, expected interface{}, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -672,8 +714,8 @@ func PanicsWithValuef(t TestingT, expected interface{}, f PanicTestFunc, msg str // Positivef asserts that the specified element is positive // -// assert.Positivef(t, 1, "error message %s", "formatted") -// assert.Positivef(t, 1.23, "error message %s", "formatted") +// assert.Positivef(t, 1, "error message %s", "formatted") +// assert.Positivef(t, 1.23, "error message %s", "formatted") func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -683,8 +725,8 @@ func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) bool // Regexpf asserts that a specified regexp matches a string. // -// assert.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") -// assert.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") +// assert.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") +// assert.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -694,7 +736,7 @@ func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...in // Samef asserts that two pointers reference the same object. // -// assert.Samef(t, ptr1, ptr2, "error message %s", "formatted") +// assert.Samef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -708,7 +750,7 @@ func Samef(t TestingT, expected interface{}, actual interface{}, msg string, arg // Subsetf asserts that the specified list(array, slice...) contains all // elements given in the specified subset(array, slice...). // -// assert.Subsetf(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") +// assert.Subsetf(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -718,7 +760,7 @@ func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args // Truef asserts that the specified value is true. // -// assert.Truef(t, myBool, "error message %s", "formatted") +// assert.Truef(t, myBool, "error message %s", "formatted") func Truef(t TestingT, value bool, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -728,7 +770,7 @@ func Truef(t TestingT, value bool, msg string, args ...interface{}) bool { // WithinDurationf asserts that the two times are within duration delta of each other. // -// assert.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") +// assert.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta time.Duration, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -738,7 +780,7 @@ func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta tim // WithinRangef asserts that a time is within a time range (inclusive). // -// assert.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") +// assert.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") func WithinRangef(t TestingT, actual time.Time, start time.Time, end time.Time, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/assert/assertion_forward.go b/vendor/github.com/stretchr/testify/assert/assertion_forward.go index 339515b..b1d94ae 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_forward.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_forward.go @@ -30,9 +30,9 @@ func (a *Assertions) Conditionf(comp Comparison, msg string, args ...interface{} // Contains asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// a.Contains("Hello World", "World") -// a.Contains(["Hello", "World"], "World") -// a.Contains({"Hello": "World"}, "Hello") +// a.Contains("Hello World", "World") +// a.Contains(["Hello", "World"], "World") +// a.Contains({"Hello": "World"}, "Hello") func (a *Assertions) Contains(s interface{}, contains interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -43,9 +43,9 @@ func (a *Assertions) Contains(s interface{}, contains interface{}, msgAndArgs .. // Containsf asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// a.Containsf("Hello World", "World", "error message %s", "formatted") -// a.Containsf(["Hello", "World"], "World", "error message %s", "formatted") -// a.Containsf({"Hello": "World"}, "Hello", "error message %s", "formatted") +// a.Containsf("Hello World", "World", "error message %s", "formatted") +// a.Containsf(["Hello", "World"], "World", "error message %s", "formatted") +// a.Containsf({"Hello": "World"}, "Hello", "error message %s", "formatted") func (a *Assertions) Containsf(s interface{}, contains interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -98,7 +98,7 @@ func (a *Assertions) ElementsMatchf(listA interface{}, listB interface{}, msg st // Empty asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// a.Empty(obj) +// a.Empty(obj) func (a *Assertions) Empty(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -109,7 +109,7 @@ func (a *Assertions) Empty(object interface{}, msgAndArgs ...interface{}) bool { // Emptyf asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// a.Emptyf(obj, "error message %s", "formatted") +// a.Emptyf(obj, "error message %s", "formatted") func (a *Assertions) Emptyf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -119,7 +119,7 @@ func (a *Assertions) Emptyf(object interface{}, msg string, args ...interface{}) // Equal asserts that two objects are equal. // -// a.Equal(123, 123) +// a.Equal(123, 123) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -134,8 +134,8 @@ func (a *Assertions) Equal(expected interface{}, actual interface{}, msgAndArgs // EqualError asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// a.EqualError(err, expectedErrorString) +// actualObj, err := SomeFunction() +// a.EqualError(err, expectedErrorString) func (a *Assertions) EqualError(theError error, errString string, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -146,8 +146,8 @@ func (a *Assertions) EqualError(theError error, errString string, msgAndArgs ... // EqualErrorf asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// a.EqualErrorf(err, expectedErrorString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// a.EqualErrorf(err, expectedErrorString, "error message %s", "formatted") func (a *Assertions) EqualErrorf(theError error, errString string, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -155,10 +155,44 @@ func (a *Assertions) EqualErrorf(theError error, errString string, msg string, a return EqualErrorf(a.t, theError, errString, msg, args...) } +// EqualExportedValues asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// a.EqualExportedValues(S{1, 2}, S{1, 3}) => true +// a.EqualExportedValues(S{1, 2}, S{2, 3}) => false +func (a *Assertions) EqualExportedValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return EqualExportedValues(a.t, expected, actual, msgAndArgs...) +} + +// EqualExportedValuesf asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// a.EqualExportedValuesf(S{1, 2}, S{1, 3}, "error message %s", "formatted") => true +// a.EqualExportedValuesf(S{1, 2}, S{2, 3}, "error message %s", "formatted") => false +func (a *Assertions) EqualExportedValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return EqualExportedValuesf(a.t, expected, actual, msg, args...) +} + // EqualValues asserts that two objects are equal or convertable to the same types // and equal. // -// a.EqualValues(uint32(123), int32(123)) +// a.EqualValues(uint32(123), int32(123)) func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -169,7 +203,7 @@ func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAn // EqualValuesf asserts that two objects are equal or convertable to the same types // and equal. // -// a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") +// a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -179,7 +213,7 @@ func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg // Equalf asserts that two objects are equal. // -// a.Equalf(123, 123, "error message %s", "formatted") +// a.Equalf(123, 123, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -193,10 +227,10 @@ func (a *Assertions) Equalf(expected interface{}, actual interface{}, msg string // Error asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if a.Error(err) { -// assert.Equal(t, expectedError, err) -// } +// actualObj, err := SomeFunction() +// if a.Error(err) { +// assert.Equal(t, expectedError, err) +// } func (a *Assertions) Error(err error, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -225,8 +259,8 @@ func (a *Assertions) ErrorAsf(err error, target interface{}, msg string, args .. // ErrorContains asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// a.ErrorContains(err, expectedErrorSubString) +// actualObj, err := SomeFunction() +// a.ErrorContains(err, expectedErrorSubString) func (a *Assertions) ErrorContains(theError error, contains string, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -237,8 +271,8 @@ func (a *Assertions) ErrorContains(theError error, contains string, msgAndArgs . // ErrorContainsf asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// a.ErrorContainsf(err, expectedErrorSubString, "error message %s", "formatted") +// actualObj, err := SomeFunction() +// a.ErrorContainsf(err, expectedErrorSubString, "error message %s", "formatted") func (a *Assertions) ErrorContainsf(theError error, contains string, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -266,10 +300,10 @@ func (a *Assertions) ErrorIsf(err error, target error, msg string, args ...inter // Errorf asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if a.Errorf(err, "error message %s", "formatted") { -// assert.Equal(t, expectedErrorf, err) -// } +// actualObj, err := SomeFunction() +// if a.Errorf(err, "error message %s", "formatted") { +// assert.Equal(t, expectedErrorf, err) +// } func (a *Assertions) Errorf(err error, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -280,7 +314,7 @@ func (a *Assertions) Errorf(err error, msg string, args ...interface{}) bool { // Eventually asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// a.Eventually(func() bool { return true; }, time.Second, 10*time.Millisecond) +// a.Eventually(func() bool { return true; }, time.Second, 10*time.Millisecond) func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -288,10 +322,60 @@ func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, ti return Eventually(a.t, condition, waitFor, tick, msgAndArgs...) } +// EventuallyWithT asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// a.EventuallyWithT(func(c *assert.CollectT) { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +func (a *Assertions) EventuallyWithT(condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return EventuallyWithT(a.t, condition, waitFor, tick, msgAndArgs...) +} + +// EventuallyWithTf asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// a.EventuallyWithTf(func(c *assert.CollectT, "error message %s", "formatted") { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +func (a *Assertions) EventuallyWithTf(condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return EventuallyWithTf(a.t, condition, waitFor, tick, msg, args...) +} + // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// a.Eventuallyf(func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// a.Eventuallyf(func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func (a *Assertions) Eventuallyf(condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -301,7 +385,7 @@ func (a *Assertions) Eventuallyf(condition func() bool, waitFor time.Duration, t // Exactly asserts that two objects are equal in value and type. // -// a.Exactly(int32(123), int64(123)) +// a.Exactly(int32(123), int64(123)) func (a *Assertions) Exactly(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -311,7 +395,7 @@ func (a *Assertions) Exactly(expected interface{}, actual interface{}, msgAndArg // Exactlyf asserts that two objects are equal in value and type. // -// a.Exactlyf(int32(123), int64(123), "error message %s", "formatted") +// a.Exactlyf(int32(123), int64(123), "error message %s", "formatted") func (a *Assertions) Exactlyf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -353,7 +437,7 @@ func (a *Assertions) Failf(failureMessage string, msg string, args ...interface{ // False asserts that the specified value is false. // -// a.False(myBool) +// a.False(myBool) func (a *Assertions) False(value bool, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -363,7 +447,7 @@ func (a *Assertions) False(value bool, msgAndArgs ...interface{}) bool { // Falsef asserts that the specified value is false. // -// a.Falsef(myBool, "error message %s", "formatted") +// a.Falsef(myBool, "error message %s", "formatted") func (a *Assertions) Falsef(value bool, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -391,9 +475,9 @@ func (a *Assertions) FileExistsf(path string, msg string, args ...interface{}) b // Greater asserts that the first element is greater than the second // -// a.Greater(2, 1) -// a.Greater(float64(2), float64(1)) -// a.Greater("b", "a") +// a.Greater(2, 1) +// a.Greater(float64(2), float64(1)) +// a.Greater("b", "a") func (a *Assertions) Greater(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -403,10 +487,10 @@ func (a *Assertions) Greater(e1 interface{}, e2 interface{}, msgAndArgs ...inter // GreaterOrEqual asserts that the first element is greater than or equal to the second // -// a.GreaterOrEqual(2, 1) -// a.GreaterOrEqual(2, 2) -// a.GreaterOrEqual("b", "a") -// a.GreaterOrEqual("b", "b") +// a.GreaterOrEqual(2, 1) +// a.GreaterOrEqual(2, 2) +// a.GreaterOrEqual("b", "a") +// a.GreaterOrEqual("b", "b") func (a *Assertions) GreaterOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -416,10 +500,10 @@ func (a *Assertions) GreaterOrEqual(e1 interface{}, e2 interface{}, msgAndArgs . // GreaterOrEqualf asserts that the first element is greater than or equal to the second // -// a.GreaterOrEqualf(2, 1, "error message %s", "formatted") -// a.GreaterOrEqualf(2, 2, "error message %s", "formatted") -// a.GreaterOrEqualf("b", "a", "error message %s", "formatted") -// a.GreaterOrEqualf("b", "b", "error message %s", "formatted") +// a.GreaterOrEqualf(2, 1, "error message %s", "formatted") +// a.GreaterOrEqualf(2, 2, "error message %s", "formatted") +// a.GreaterOrEqualf("b", "a", "error message %s", "formatted") +// a.GreaterOrEqualf("b", "b", "error message %s", "formatted") func (a *Assertions) GreaterOrEqualf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -429,9 +513,9 @@ func (a *Assertions) GreaterOrEqualf(e1 interface{}, e2 interface{}, msg string, // Greaterf asserts that the first element is greater than the second // -// a.Greaterf(2, 1, "error message %s", "formatted") -// a.Greaterf(float64(2), float64(1), "error message %s", "formatted") -// a.Greaterf("b", "a", "error message %s", "formatted") +// a.Greaterf(2, 1, "error message %s", "formatted") +// a.Greaterf(float64(2), float64(1), "error message %s", "formatted") +// a.Greaterf("b", "a", "error message %s", "formatted") func (a *Assertions) Greaterf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -442,7 +526,7 @@ func (a *Assertions) Greaterf(e1 interface{}, e2 interface{}, msg string, args . // HTTPBodyContains asserts that a specified handler returns a // body that contains a string. // -// a.HTTPBodyContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// a.HTTPBodyContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyContains(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) bool { @@ -455,7 +539,7 @@ func (a *Assertions) HTTPBodyContains(handler http.HandlerFunc, method string, u // HTTPBodyContainsf asserts that a specified handler returns a // body that contains a string. // -// a.HTTPBodyContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// a.HTTPBodyContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyContainsf(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) bool { @@ -468,7 +552,7 @@ func (a *Assertions) HTTPBodyContainsf(handler http.HandlerFunc, method string, // HTTPBodyNotContains asserts that a specified handler returns a // body that does not contain a string. // -// a.HTTPBodyNotContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// a.HTTPBodyNotContains(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyNotContains(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) bool { @@ -481,7 +565,7 @@ func (a *Assertions) HTTPBodyNotContains(handler http.HandlerFunc, method string // HTTPBodyNotContainsf asserts that a specified handler returns a // body that does not contain a string. // -// a.HTTPBodyNotContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// a.HTTPBodyNotContainsf(myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPBodyNotContainsf(handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) bool { @@ -493,7 +577,7 @@ func (a *Assertions) HTTPBodyNotContainsf(handler http.HandlerFunc, method strin // HTTPError asserts that a specified handler returns an error status code. // -// a.HTTPError(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPError(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPError(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -505,7 +589,7 @@ func (a *Assertions) HTTPError(handler http.HandlerFunc, method string, url stri // HTTPErrorf asserts that a specified handler returns an error status code. // -// a.HTTPErrorf(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPErrorf(myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPErrorf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -517,7 +601,7 @@ func (a *Assertions) HTTPErrorf(handler http.HandlerFunc, method string, url str // HTTPRedirect asserts that a specified handler returns a redirect status code. // -// a.HTTPRedirect(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPRedirect(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPRedirect(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -529,7 +613,7 @@ func (a *Assertions) HTTPRedirect(handler http.HandlerFunc, method string, url s // HTTPRedirectf asserts that a specified handler returns a redirect status code. // -// a.HTTPRedirectf(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// a.HTTPRedirectf(myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPRedirectf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -541,7 +625,7 @@ func (a *Assertions) HTTPRedirectf(handler http.HandlerFunc, method string, url // HTTPStatusCode asserts that a specified handler returns a specified status code. // -// a.HTTPStatusCode(myHandler, "GET", "/notImplemented", nil, 501) +// a.HTTPStatusCode(myHandler, "GET", "/notImplemented", nil, 501) // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPStatusCode(handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msgAndArgs ...interface{}) bool { @@ -553,7 +637,7 @@ func (a *Assertions) HTTPStatusCode(handler http.HandlerFunc, method string, url // HTTPStatusCodef asserts that a specified handler returns a specified status code. // -// a.HTTPStatusCodef(myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") +// a.HTTPStatusCodef(myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPStatusCodef(handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msg string, args ...interface{}) bool { @@ -565,7 +649,7 @@ func (a *Assertions) HTTPStatusCodef(handler http.HandlerFunc, method string, ur // HTTPSuccess asserts that a specified handler returns a success status code. // -// a.HTTPSuccess(myHandler, "POST", "http://www.google.com", nil) +// a.HTTPSuccess(myHandler, "POST", "http://www.google.com", nil) // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPSuccess(handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -577,7 +661,7 @@ func (a *Assertions) HTTPSuccess(handler http.HandlerFunc, method string, url st // HTTPSuccessf asserts that a specified handler returns a success status code. // -// a.HTTPSuccessf(myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") +// a.HTTPSuccessf(myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func (a *Assertions) HTTPSuccessf(handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) bool { @@ -589,7 +673,7 @@ func (a *Assertions) HTTPSuccessf(handler http.HandlerFunc, method string, url s // Implements asserts that an object is implemented by the specified interface. // -// a.Implements((*MyInterface)(nil), new(MyObject)) +// a.Implements((*MyInterface)(nil), new(MyObject)) func (a *Assertions) Implements(interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -599,7 +683,7 @@ func (a *Assertions) Implements(interfaceObject interface{}, object interface{}, // Implementsf asserts that an object is implemented by the specified interface. // -// a.Implementsf((*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// a.Implementsf((*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func (a *Assertions) Implementsf(interfaceObject interface{}, object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -609,7 +693,7 @@ func (a *Assertions) Implementsf(interfaceObject interface{}, object interface{} // InDelta asserts that the two numerals are within delta of each other. // -// a.InDelta(math.Pi, 22/7.0, 0.01) +// a.InDelta(math.Pi, 22/7.0, 0.01) func (a *Assertions) InDelta(expected interface{}, actual interface{}, delta float64, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -651,7 +735,7 @@ func (a *Assertions) InDeltaSlicef(expected interface{}, actual interface{}, del // InDeltaf asserts that the two numerals are within delta of each other. // -// a.InDeltaf(math.Pi, 22/7.0, 0.01, "error message %s", "formatted") +// a.InDeltaf(math.Pi, 22/7.0, 0.01, "error message %s", "formatted") func (a *Assertions) InDeltaf(expected interface{}, actual interface{}, delta float64, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -693,9 +777,9 @@ func (a *Assertions) InEpsilonf(expected interface{}, actual interface{}, epsilo // IsDecreasing asserts that the collection is decreasing // -// a.IsDecreasing([]int{2, 1, 0}) -// a.IsDecreasing([]float{2, 1}) -// a.IsDecreasing([]string{"b", "a"}) +// a.IsDecreasing([]int{2, 1, 0}) +// a.IsDecreasing([]float{2, 1}) +// a.IsDecreasing([]string{"b", "a"}) func (a *Assertions) IsDecreasing(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -705,9 +789,9 @@ func (a *Assertions) IsDecreasing(object interface{}, msgAndArgs ...interface{}) // IsDecreasingf asserts that the collection is decreasing // -// a.IsDecreasingf([]int{2, 1, 0}, "error message %s", "formatted") -// a.IsDecreasingf([]float{2, 1}, "error message %s", "formatted") -// a.IsDecreasingf([]string{"b", "a"}, "error message %s", "formatted") +// a.IsDecreasingf([]int{2, 1, 0}, "error message %s", "formatted") +// a.IsDecreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsDecreasingf([]string{"b", "a"}, "error message %s", "formatted") func (a *Assertions) IsDecreasingf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -717,9 +801,9 @@ func (a *Assertions) IsDecreasingf(object interface{}, msg string, args ...inter // IsIncreasing asserts that the collection is increasing // -// a.IsIncreasing([]int{1, 2, 3}) -// a.IsIncreasing([]float{1, 2}) -// a.IsIncreasing([]string{"a", "b"}) +// a.IsIncreasing([]int{1, 2, 3}) +// a.IsIncreasing([]float{1, 2}) +// a.IsIncreasing([]string{"a", "b"}) func (a *Assertions) IsIncreasing(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -729,9 +813,9 @@ func (a *Assertions) IsIncreasing(object interface{}, msgAndArgs ...interface{}) // IsIncreasingf asserts that the collection is increasing // -// a.IsIncreasingf([]int{1, 2, 3}, "error message %s", "formatted") -// a.IsIncreasingf([]float{1, 2}, "error message %s", "formatted") -// a.IsIncreasingf([]string{"a", "b"}, "error message %s", "formatted") +// a.IsIncreasingf([]int{1, 2, 3}, "error message %s", "formatted") +// a.IsIncreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsIncreasingf([]string{"a", "b"}, "error message %s", "formatted") func (a *Assertions) IsIncreasingf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -741,9 +825,9 @@ func (a *Assertions) IsIncreasingf(object interface{}, msg string, args ...inter // IsNonDecreasing asserts that the collection is not decreasing // -// a.IsNonDecreasing([]int{1, 1, 2}) -// a.IsNonDecreasing([]float{1, 2}) -// a.IsNonDecreasing([]string{"a", "b"}) +// a.IsNonDecreasing([]int{1, 1, 2}) +// a.IsNonDecreasing([]float{1, 2}) +// a.IsNonDecreasing([]string{"a", "b"}) func (a *Assertions) IsNonDecreasing(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -753,9 +837,9 @@ func (a *Assertions) IsNonDecreasing(object interface{}, msgAndArgs ...interface // IsNonDecreasingf asserts that the collection is not decreasing // -// a.IsNonDecreasingf([]int{1, 1, 2}, "error message %s", "formatted") -// a.IsNonDecreasingf([]float{1, 2}, "error message %s", "formatted") -// a.IsNonDecreasingf([]string{"a", "b"}, "error message %s", "formatted") +// a.IsNonDecreasingf([]int{1, 1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]float{1, 2}, "error message %s", "formatted") +// a.IsNonDecreasingf([]string{"a", "b"}, "error message %s", "formatted") func (a *Assertions) IsNonDecreasingf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -765,9 +849,9 @@ func (a *Assertions) IsNonDecreasingf(object interface{}, msg string, args ...in // IsNonIncreasing asserts that the collection is not increasing // -// a.IsNonIncreasing([]int{2, 1, 1}) -// a.IsNonIncreasing([]float{2, 1}) -// a.IsNonIncreasing([]string{"b", "a"}) +// a.IsNonIncreasing([]int{2, 1, 1}) +// a.IsNonIncreasing([]float{2, 1}) +// a.IsNonIncreasing([]string{"b", "a"}) func (a *Assertions) IsNonIncreasing(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -777,9 +861,9 @@ func (a *Assertions) IsNonIncreasing(object interface{}, msgAndArgs ...interface // IsNonIncreasingf asserts that the collection is not increasing // -// a.IsNonIncreasingf([]int{2, 1, 1}, "error message %s", "formatted") -// a.IsNonIncreasingf([]float{2, 1}, "error message %s", "formatted") -// a.IsNonIncreasingf([]string{"b", "a"}, "error message %s", "formatted") +// a.IsNonIncreasingf([]int{2, 1, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]float{2, 1}, "error message %s", "formatted") +// a.IsNonIncreasingf([]string{"b", "a"}, "error message %s", "formatted") func (a *Assertions) IsNonIncreasingf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -805,7 +889,7 @@ func (a *Assertions) IsTypef(expectedType interface{}, object interface{}, msg s // JSONEq asserts that two JSON strings are equivalent. // -// a.JSONEq(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) +// a.JSONEq(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) func (a *Assertions) JSONEq(expected string, actual string, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -815,7 +899,7 @@ func (a *Assertions) JSONEq(expected string, actual string, msgAndArgs ...interf // JSONEqf asserts that two JSON strings are equivalent. // -// a.JSONEqf(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") +// a.JSONEqf(`{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") func (a *Assertions) JSONEqf(expected string, actual string, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -826,7 +910,7 @@ func (a *Assertions) JSONEqf(expected string, actual string, msg string, args .. // Len asserts that the specified object has specific length. // Len also fails if the object has a type that len() not accept. // -// a.Len(mySlice, 3) +// a.Len(mySlice, 3) func (a *Assertions) Len(object interface{}, length int, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -837,7 +921,7 @@ func (a *Assertions) Len(object interface{}, length int, msgAndArgs ...interface // Lenf asserts that the specified object has specific length. // Lenf also fails if the object has a type that len() not accept. // -// a.Lenf(mySlice, 3, "error message %s", "formatted") +// a.Lenf(mySlice, 3, "error message %s", "formatted") func (a *Assertions) Lenf(object interface{}, length int, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -847,9 +931,9 @@ func (a *Assertions) Lenf(object interface{}, length int, msg string, args ...in // Less asserts that the first element is less than the second // -// a.Less(1, 2) -// a.Less(float64(1), float64(2)) -// a.Less("a", "b") +// a.Less(1, 2) +// a.Less(float64(1), float64(2)) +// a.Less("a", "b") func (a *Assertions) Less(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -859,10 +943,10 @@ func (a *Assertions) Less(e1 interface{}, e2 interface{}, msgAndArgs ...interfac // LessOrEqual asserts that the first element is less than or equal to the second // -// a.LessOrEqual(1, 2) -// a.LessOrEqual(2, 2) -// a.LessOrEqual("a", "b") -// a.LessOrEqual("b", "b") +// a.LessOrEqual(1, 2) +// a.LessOrEqual(2, 2) +// a.LessOrEqual("a", "b") +// a.LessOrEqual("b", "b") func (a *Assertions) LessOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -872,10 +956,10 @@ func (a *Assertions) LessOrEqual(e1 interface{}, e2 interface{}, msgAndArgs ...i // LessOrEqualf asserts that the first element is less than or equal to the second // -// a.LessOrEqualf(1, 2, "error message %s", "formatted") -// a.LessOrEqualf(2, 2, "error message %s", "formatted") -// a.LessOrEqualf("a", "b", "error message %s", "formatted") -// a.LessOrEqualf("b", "b", "error message %s", "formatted") +// a.LessOrEqualf(1, 2, "error message %s", "formatted") +// a.LessOrEqualf(2, 2, "error message %s", "formatted") +// a.LessOrEqualf("a", "b", "error message %s", "formatted") +// a.LessOrEqualf("b", "b", "error message %s", "formatted") func (a *Assertions) LessOrEqualf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -885,9 +969,9 @@ func (a *Assertions) LessOrEqualf(e1 interface{}, e2 interface{}, msg string, ar // Lessf asserts that the first element is less than the second // -// a.Lessf(1, 2, "error message %s", "formatted") -// a.Lessf(float64(1), float64(2), "error message %s", "formatted") -// a.Lessf("a", "b", "error message %s", "formatted") +// a.Lessf(1, 2, "error message %s", "formatted") +// a.Lessf(float64(1), float64(2), "error message %s", "formatted") +// a.Lessf("a", "b", "error message %s", "formatted") func (a *Assertions) Lessf(e1 interface{}, e2 interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -897,8 +981,8 @@ func (a *Assertions) Lessf(e1 interface{}, e2 interface{}, msg string, args ...i // Negative asserts that the specified element is negative // -// a.Negative(-1) -// a.Negative(-1.23) +// a.Negative(-1) +// a.Negative(-1.23) func (a *Assertions) Negative(e interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -908,8 +992,8 @@ func (a *Assertions) Negative(e interface{}, msgAndArgs ...interface{}) bool { // Negativef asserts that the specified element is negative // -// a.Negativef(-1, "error message %s", "formatted") -// a.Negativef(-1.23, "error message %s", "formatted") +// a.Negativef(-1, "error message %s", "formatted") +// a.Negativef(-1.23, "error message %s", "formatted") func (a *Assertions) Negativef(e interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -920,7 +1004,7 @@ func (a *Assertions) Negativef(e interface{}, msg string, args ...interface{}) b // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// a.Never(func() bool { return false; }, time.Second, 10*time.Millisecond) +// a.Never(func() bool { return false; }, time.Second, 10*time.Millisecond) func (a *Assertions) Never(condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -931,7 +1015,7 @@ func (a *Assertions) Never(condition func() bool, waitFor time.Duration, tick ti // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// a.Neverf(func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// a.Neverf(func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func (a *Assertions) Neverf(condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -941,7 +1025,7 @@ func (a *Assertions) Neverf(condition func() bool, waitFor time.Duration, tick t // Nil asserts that the specified object is nil. // -// a.Nil(err) +// a.Nil(err) func (a *Assertions) Nil(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -951,7 +1035,7 @@ func (a *Assertions) Nil(object interface{}, msgAndArgs ...interface{}) bool { // Nilf asserts that the specified object is nil. // -// a.Nilf(err, "error message %s", "formatted") +// a.Nilf(err, "error message %s", "formatted") func (a *Assertions) Nilf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -979,10 +1063,10 @@ func (a *Assertions) NoDirExistsf(path string, msg string, args ...interface{}) // NoError asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if a.NoError(err) { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if a.NoError(err) { +// assert.Equal(t, expectedObj, actualObj) +// } func (a *Assertions) NoError(err error, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -992,10 +1076,10 @@ func (a *Assertions) NoError(err error, msgAndArgs ...interface{}) bool { // NoErrorf asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if a.NoErrorf(err, "error message %s", "formatted") { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if a.NoErrorf(err, "error message %s", "formatted") { +// assert.Equal(t, expectedObj, actualObj) +// } func (a *Assertions) NoErrorf(err error, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1024,9 +1108,9 @@ func (a *Assertions) NoFileExistsf(path string, msg string, args ...interface{}) // NotContains asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// a.NotContains("Hello World", "Earth") -// a.NotContains(["Hello", "World"], "Earth") -// a.NotContains({"Hello": "World"}, "Earth") +// a.NotContains("Hello World", "Earth") +// a.NotContains(["Hello", "World"], "Earth") +// a.NotContains({"Hello": "World"}, "Earth") func (a *Assertions) NotContains(s interface{}, contains interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1037,9 +1121,9 @@ func (a *Assertions) NotContains(s interface{}, contains interface{}, msgAndArgs // NotContainsf asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// a.NotContainsf("Hello World", "Earth", "error message %s", "formatted") -// a.NotContainsf(["Hello", "World"], "Earth", "error message %s", "formatted") -// a.NotContainsf({"Hello": "World"}, "Earth", "error message %s", "formatted") +// a.NotContainsf("Hello World", "Earth", "error message %s", "formatted") +// a.NotContainsf(["Hello", "World"], "Earth", "error message %s", "formatted") +// a.NotContainsf({"Hello": "World"}, "Earth", "error message %s", "formatted") func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1050,9 +1134,9 @@ func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg strin // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if a.NotEmpty(obj) { -// assert.Equal(t, "two", obj[1]) -// } +// if a.NotEmpty(obj) { +// assert.Equal(t, "two", obj[1]) +// } func (a *Assertions) NotEmpty(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1063,9 +1147,9 @@ func (a *Assertions) NotEmpty(object interface{}, msgAndArgs ...interface{}) boo // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if a.NotEmptyf(obj, "error message %s", "formatted") { -// assert.Equal(t, "two", obj[1]) -// } +// if a.NotEmptyf(obj, "error message %s", "formatted") { +// assert.Equal(t, "two", obj[1]) +// } func (a *Assertions) NotEmptyf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1075,7 +1159,7 @@ func (a *Assertions) NotEmptyf(object interface{}, msg string, args ...interface // NotEqual asserts that the specified values are NOT equal. // -// a.NotEqual(obj1, obj2) +// a.NotEqual(obj1, obj2) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1088,7 +1172,7 @@ func (a *Assertions) NotEqual(expected interface{}, actual interface{}, msgAndAr // NotEqualValues asserts that two objects are not equal even when converted to the same type // -// a.NotEqualValues(obj1, obj2) +// a.NotEqualValues(obj1, obj2) func (a *Assertions) NotEqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1098,7 +1182,7 @@ func (a *Assertions) NotEqualValues(expected interface{}, actual interface{}, ms // NotEqualValuesf asserts that two objects are not equal even when converted to the same type // -// a.NotEqualValuesf(obj1, obj2, "error message %s", "formatted") +// a.NotEqualValuesf(obj1, obj2, "error message %s", "formatted") func (a *Assertions) NotEqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1108,7 +1192,7 @@ func (a *Assertions) NotEqualValuesf(expected interface{}, actual interface{}, m // NotEqualf asserts that the specified values are NOT equal. // -// a.NotEqualf(obj1, obj2, "error message %s", "formatted") +// a.NotEqualf(obj1, obj2, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1139,7 +1223,7 @@ func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...in // NotNil asserts that the specified object is not nil. // -// a.NotNil(err) +// a.NotNil(err) func (a *Assertions) NotNil(object interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1149,7 +1233,7 @@ func (a *Assertions) NotNil(object interface{}, msgAndArgs ...interface{}) bool // NotNilf asserts that the specified object is not nil. // -// a.NotNilf(err, "error message %s", "formatted") +// a.NotNilf(err, "error message %s", "formatted") func (a *Assertions) NotNilf(object interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1159,7 +1243,7 @@ func (a *Assertions) NotNilf(object interface{}, msg string, args ...interface{} // NotPanics asserts that the code inside the specified PanicTestFunc does NOT panic. // -// a.NotPanics(func(){ RemainCalm() }) +// a.NotPanics(func(){ RemainCalm() }) func (a *Assertions) NotPanics(f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1169,7 +1253,7 @@ func (a *Assertions) NotPanics(f PanicTestFunc, msgAndArgs ...interface{}) bool // NotPanicsf asserts that the code inside the specified PanicTestFunc does NOT panic. // -// a.NotPanicsf(func(){ RemainCalm() }, "error message %s", "formatted") +// a.NotPanicsf(func(){ RemainCalm() }, "error message %s", "formatted") func (a *Assertions) NotPanicsf(f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1179,8 +1263,8 @@ func (a *Assertions) NotPanicsf(f PanicTestFunc, msg string, args ...interface{} // NotRegexp asserts that a specified regexp does not match a string. // -// a.NotRegexp(regexp.MustCompile("starts"), "it's starting") -// a.NotRegexp("^start", "it's not starting") +// a.NotRegexp(regexp.MustCompile("starts"), "it's starting") +// a.NotRegexp("^start", "it's not starting") func (a *Assertions) NotRegexp(rx interface{}, str interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1190,8 +1274,8 @@ func (a *Assertions) NotRegexp(rx interface{}, str interface{}, msgAndArgs ...in // NotRegexpf asserts that a specified regexp does not match a string. // -// a.NotRegexpf(regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") -// a.NotRegexpf("^start", "it's not starting", "error message %s", "formatted") +// a.NotRegexpf(regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") +// a.NotRegexpf("^start", "it's not starting", "error message %s", "formatted") func (a *Assertions) NotRegexpf(rx interface{}, str interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1201,7 +1285,7 @@ func (a *Assertions) NotRegexpf(rx interface{}, str interface{}, msg string, arg // NotSame asserts that two pointers do not reference the same object. // -// a.NotSame(ptr1, ptr2) +// a.NotSame(ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1214,7 +1298,7 @@ func (a *Assertions) NotSame(expected interface{}, actual interface{}, msgAndArg // NotSamef asserts that two pointers do not reference the same object. // -// a.NotSamef(ptr1, ptr2, "error message %s", "formatted") +// a.NotSamef(ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1228,7 +1312,7 @@ func (a *Assertions) NotSamef(expected interface{}, actual interface{}, msg stri // NotSubset asserts that the specified list(array, slice...) contains not all // elements given in the specified subset(array, slice...). // -// a.NotSubset([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") +// a.NotSubset([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") func (a *Assertions) NotSubset(list interface{}, subset interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1239,7 +1323,7 @@ func (a *Assertions) NotSubset(list interface{}, subset interface{}, msgAndArgs // NotSubsetf asserts that the specified list(array, slice...) contains not all // elements given in the specified subset(array, slice...). // -// a.NotSubsetf([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") +// a.NotSubsetf([1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]", "error message %s", "formatted") func (a *Assertions) NotSubsetf(list interface{}, subset interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1265,7 +1349,7 @@ func (a *Assertions) NotZerof(i interface{}, msg string, args ...interface{}) bo // Panics asserts that the code inside the specified PanicTestFunc panics. // -// a.Panics(func(){ GoCrazy() }) +// a.Panics(func(){ GoCrazy() }) func (a *Assertions) Panics(f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1277,7 +1361,7 @@ func (a *Assertions) Panics(f PanicTestFunc, msgAndArgs ...interface{}) bool { // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// a.PanicsWithError("crazy error", func(){ GoCrazy() }) +// a.PanicsWithError("crazy error", func(){ GoCrazy() }) func (a *Assertions) PanicsWithError(errString string, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1289,7 +1373,7 @@ func (a *Assertions) PanicsWithError(errString string, f PanicTestFunc, msgAndAr // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// a.PanicsWithErrorf("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// a.PanicsWithErrorf("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) PanicsWithErrorf(errString string, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1300,7 +1384,7 @@ func (a *Assertions) PanicsWithErrorf(errString string, f PanicTestFunc, msg str // PanicsWithValue asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// a.PanicsWithValue("crazy error", func(){ GoCrazy() }) +// a.PanicsWithValue("crazy error", func(){ GoCrazy() }) func (a *Assertions) PanicsWithValue(expected interface{}, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1311,7 +1395,7 @@ func (a *Assertions) PanicsWithValue(expected interface{}, f PanicTestFunc, msgA // PanicsWithValuef asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// a.PanicsWithValuef("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// a.PanicsWithValuef("crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) PanicsWithValuef(expected interface{}, f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1321,7 +1405,7 @@ func (a *Assertions) PanicsWithValuef(expected interface{}, f PanicTestFunc, msg // Panicsf asserts that the code inside the specified PanicTestFunc panics. // -// a.Panicsf(func(){ GoCrazy() }, "error message %s", "formatted") +// a.Panicsf(func(){ GoCrazy() }, "error message %s", "formatted") func (a *Assertions) Panicsf(f PanicTestFunc, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1331,8 +1415,8 @@ func (a *Assertions) Panicsf(f PanicTestFunc, msg string, args ...interface{}) b // Positive asserts that the specified element is positive // -// a.Positive(1) -// a.Positive(1.23) +// a.Positive(1) +// a.Positive(1.23) func (a *Assertions) Positive(e interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1342,8 +1426,8 @@ func (a *Assertions) Positive(e interface{}, msgAndArgs ...interface{}) bool { // Positivef asserts that the specified element is positive // -// a.Positivef(1, "error message %s", "formatted") -// a.Positivef(1.23, "error message %s", "formatted") +// a.Positivef(1, "error message %s", "formatted") +// a.Positivef(1.23, "error message %s", "formatted") func (a *Assertions) Positivef(e interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1353,8 +1437,8 @@ func (a *Assertions) Positivef(e interface{}, msg string, args ...interface{}) b // Regexp asserts that a specified regexp matches a string. // -// a.Regexp(regexp.MustCompile("start"), "it's starting") -// a.Regexp("start...$", "it's not starting") +// a.Regexp(regexp.MustCompile("start"), "it's starting") +// a.Regexp("start...$", "it's not starting") func (a *Assertions) Regexp(rx interface{}, str interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1364,8 +1448,8 @@ func (a *Assertions) Regexp(rx interface{}, str interface{}, msgAndArgs ...inter // Regexpf asserts that a specified regexp matches a string. // -// a.Regexpf(regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") -// a.Regexpf("start...$", "it's not starting", "error message %s", "formatted") +// a.Regexpf(regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") +// a.Regexpf("start...$", "it's not starting", "error message %s", "formatted") func (a *Assertions) Regexpf(rx interface{}, str interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1375,7 +1459,7 @@ func (a *Assertions) Regexpf(rx interface{}, str interface{}, msg string, args . // Same asserts that two pointers reference the same object. // -// a.Same(ptr1, ptr2) +// a.Same(ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1388,7 +1472,7 @@ func (a *Assertions) Same(expected interface{}, actual interface{}, msgAndArgs . // Samef asserts that two pointers reference the same object. // -// a.Samef(ptr1, ptr2, "error message %s", "formatted") +// a.Samef(ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1402,7 +1486,7 @@ func (a *Assertions) Samef(expected interface{}, actual interface{}, msg string, // Subset asserts that the specified list(array, slice...) contains all // elements given in the specified subset(array, slice...). // -// a.Subset([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") +// a.Subset([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") func (a *Assertions) Subset(list interface{}, subset interface{}, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1413,7 +1497,7 @@ func (a *Assertions) Subset(list interface{}, subset interface{}, msgAndArgs ... // Subsetf asserts that the specified list(array, slice...) contains all // elements given in the specified subset(array, slice...). // -// a.Subsetf([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") +// a.Subsetf([1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]", "error message %s", "formatted") func (a *Assertions) Subsetf(list interface{}, subset interface{}, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1423,7 +1507,7 @@ func (a *Assertions) Subsetf(list interface{}, subset interface{}, msg string, a // True asserts that the specified value is true. // -// a.True(myBool) +// a.True(myBool) func (a *Assertions) True(value bool, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1433,7 +1517,7 @@ func (a *Assertions) True(value bool, msgAndArgs ...interface{}) bool { // Truef asserts that the specified value is true. // -// a.Truef(myBool, "error message %s", "formatted") +// a.Truef(myBool, "error message %s", "formatted") func (a *Assertions) Truef(value bool, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1443,7 +1527,7 @@ func (a *Assertions) Truef(value bool, msg string, args ...interface{}) bool { // WithinDuration asserts that the two times are within duration delta of each other. // -// a.WithinDuration(time.Now(), time.Now(), 10*time.Second) +// a.WithinDuration(time.Now(), time.Now(), 10*time.Second) func (a *Assertions) WithinDuration(expected time.Time, actual time.Time, delta time.Duration, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1453,7 +1537,7 @@ func (a *Assertions) WithinDuration(expected time.Time, actual time.Time, delta // WithinDurationf asserts that the two times are within duration delta of each other. // -// a.WithinDurationf(time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") +// a.WithinDurationf(time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") func (a *Assertions) WithinDurationf(expected time.Time, actual time.Time, delta time.Duration, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1463,7 +1547,7 @@ func (a *Assertions) WithinDurationf(expected time.Time, actual time.Time, delta // WithinRange asserts that a time is within a time range (inclusive). // -// a.WithinRange(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) +// a.WithinRange(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) func (a *Assertions) WithinRange(actual time.Time, start time.Time, end time.Time, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1473,7 +1557,7 @@ func (a *Assertions) WithinRange(actual time.Time, start time.Time, end time.Tim // WithinRangef asserts that a time is within a time range (inclusive). // -// a.WithinRangef(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") +// a.WithinRangef(time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") func (a *Assertions) WithinRangef(actual time.Time, start time.Time, end time.Time, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/assert/assertion_order.go b/vendor/github.com/stretchr/testify/assert/assertion_order.go index 7594487..00df62a 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_order.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_order.go @@ -46,36 +46,36 @@ func isOrdered(t TestingT, object interface{}, allowedComparesResults []CompareT // IsIncreasing asserts that the collection is increasing // -// assert.IsIncreasing(t, []int{1, 2, 3}) -// assert.IsIncreasing(t, []float{1, 2}) -// assert.IsIncreasing(t, []string{"a", "b"}) +// assert.IsIncreasing(t, []int{1, 2, 3}) +// assert.IsIncreasing(t, []float{1, 2}) +// assert.IsIncreasing(t, []string{"a", "b"}) func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { return isOrdered(t, object, []CompareType{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) } // IsNonIncreasing asserts that the collection is not increasing // -// assert.IsNonIncreasing(t, []int{2, 1, 1}) -// assert.IsNonIncreasing(t, []float{2, 1}) -// assert.IsNonIncreasing(t, []string{"b", "a"}) +// assert.IsNonIncreasing(t, []int{2, 1, 1}) +// assert.IsNonIncreasing(t, []float{2, 1}) +// assert.IsNonIncreasing(t, []string{"b", "a"}) func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { return isOrdered(t, object, []CompareType{compareEqual, compareGreater}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) } // IsDecreasing asserts that the collection is decreasing // -// assert.IsDecreasing(t, []int{2, 1, 0}) -// assert.IsDecreasing(t, []float{2, 1}) -// assert.IsDecreasing(t, []string{"b", "a"}) +// assert.IsDecreasing(t, []int{2, 1, 0}) +// assert.IsDecreasing(t, []float{2, 1}) +// assert.IsDecreasing(t, []string{"b", "a"}) func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { return isOrdered(t, object, []CompareType{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) } // IsNonDecreasing asserts that the collection is not decreasing // -// assert.IsNonDecreasing(t, []int{1, 1, 2}) -// assert.IsNonDecreasing(t, []float{1, 2}) -// assert.IsNonDecreasing(t, []string{"a", "b"}) +// assert.IsNonDecreasing(t, []int{1, 1, 2}) +// assert.IsNonDecreasing(t, []float{1, 2}) +// assert.IsNonDecreasing(t, []string{"a", "b"}) func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { return isOrdered(t, object, []CompareType{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) } diff --git a/vendor/github.com/stretchr/testify/assert/assertions.go b/vendor/github.com/stretchr/testify/assert/assertions.go index fa1245b..a55d1bb 100644 --- a/vendor/github.com/stretchr/testify/assert/assertions.go +++ b/vendor/github.com/stretchr/testify/assert/assertions.go @@ -8,7 +8,6 @@ import ( "fmt" "math" "os" - "path/filepath" "reflect" "regexp" "runtime" @@ -76,6 +75,77 @@ func ObjectsAreEqual(expected, actual interface{}) bool { return bytes.Equal(exp, act) } +// copyExportedFields iterates downward through nested data structures and creates a copy +// that only contains the exported struct fields. +func copyExportedFields(expected interface{}) interface{} { + if isNil(expected) { + return expected + } + + expectedType := reflect.TypeOf(expected) + expectedKind := expectedType.Kind() + expectedValue := reflect.ValueOf(expected) + + switch expectedKind { + case reflect.Struct: + result := reflect.New(expectedType).Elem() + for i := 0; i < expectedType.NumField(); i++ { + field := expectedType.Field(i) + isExported := field.IsExported() + if isExported { + fieldValue := expectedValue.Field(i) + if isNil(fieldValue) || isNil(fieldValue.Interface()) { + continue + } + newValue := copyExportedFields(fieldValue.Interface()) + result.Field(i).Set(reflect.ValueOf(newValue)) + } + } + return result.Interface() + + case reflect.Ptr: + result := reflect.New(expectedType.Elem()) + unexportedRemoved := copyExportedFields(expectedValue.Elem().Interface()) + result.Elem().Set(reflect.ValueOf(unexportedRemoved)) + return result.Interface() + + case reflect.Array, reflect.Slice: + result := reflect.MakeSlice(expectedType, expectedValue.Len(), expectedValue.Len()) + for i := 0; i < expectedValue.Len(); i++ { + index := expectedValue.Index(i) + if isNil(index) { + continue + } + unexportedRemoved := copyExportedFields(index.Interface()) + result.Index(i).Set(reflect.ValueOf(unexportedRemoved)) + } + return result.Interface() + + case reflect.Map: + result := reflect.MakeMap(expectedType) + for _, k := range expectedValue.MapKeys() { + index := expectedValue.MapIndex(k) + unexportedRemoved := copyExportedFields(index.Interface()) + result.SetMapIndex(k, reflect.ValueOf(unexportedRemoved)) + } + return result.Interface() + + default: + return expected + } +} + +// ObjectsExportedFieldsAreEqual determines if the exported (public) fields of two objects are +// considered equal. This comparison of only exported fields is applied recursively to nested data +// structures. +// +// This function does no assertion of any kind. +func ObjectsExportedFieldsAreEqual(expected, actual interface{}) bool { + expectedCleaned := copyExportedFields(expected) + actualCleaned := copyExportedFields(actual) + return ObjectsAreEqualValues(expectedCleaned, actualCleaned) +} + // ObjectsAreEqualValues gets whether two objects are equal, or if their // values are equal. func ObjectsAreEqualValues(expected, actual interface{}) bool { @@ -141,12 +211,11 @@ func CallerInfo() []string { } parts := strings.Split(file, "/") - file = parts[len(parts)-1] if len(parts) > 1 { + filename := parts[len(parts)-1] dir := parts[len(parts)-2] - if (dir != "assert" && dir != "mock" && dir != "require") || file == "mock_test.go" { - path, _ := filepath.Abs(file) - callers = append(callers, fmt.Sprintf("%s:%d", path, line)) + if (dir != "assert" && dir != "mock" && dir != "require") || filename == "mock_test.go" { + callers = append(callers, fmt.Sprintf("%s:%d", file, line)) } } @@ -273,7 +342,7 @@ type labeledContent struct { // labeledOutput returns a string consisting of the provided labeledContent. Each labeled output is appended in the following manner: // -// \t{{label}}:{{align_spaces}}\t{{content}}\n +// \t{{label}}:{{align_spaces}}\t{{content}}\n // // The initial carriage return is required to undo/erase any padding added by testing.T.Errorf. The "\t{{label}}:" is for the label. // If a label is shorter than the longest label provided, padding spaces are added to make all the labels match in length. Once this @@ -296,7 +365,7 @@ func labeledOutput(content ...labeledContent) string { // Implements asserts that an object is implemented by the specified interface. // -// assert.Implements(t, (*MyInterface)(nil), new(MyObject)) +// assert.Implements(t, (*MyInterface)(nil), new(MyObject)) func Implements(t TestingT, interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -328,7 +397,7 @@ func IsType(t TestingT, expectedType interface{}, object interface{}, msgAndArgs // Equal asserts that two objects are equal. // -// assert.Equal(t, 123, 123) +// assert.Equal(t, 123, 123) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -369,7 +438,7 @@ func validateEqualArgs(expected, actual interface{}) error { // Same asserts that two pointers reference the same object. // -// assert.Same(t, ptr1, ptr2) +// assert.Same(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -389,7 +458,7 @@ func Same(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) b // NotSame asserts that two pointers do not reference the same object. // -// assert.NotSame(t, ptr1, ptr2) +// assert.NotSame(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -457,7 +526,7 @@ func truncatingFormat(data interface{}) string { // EqualValues asserts that two objects are equal or convertable to the same types // and equal. // -// assert.EqualValues(t, uint32(123), int32(123)) +// assert.EqualValues(t, uint32(123), int32(123)) func EqualValues(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -475,9 +544,53 @@ func EqualValues(t TestingT, expected, actual interface{}, msgAndArgs ...interfa } +// EqualExportedValues asserts that the types of two objects are equal and their public +// fields are also equal. This is useful for comparing structs that have private fields +// that could potentially differ. +// +// type S struct { +// Exported int +// notExported int +// } +// assert.EqualExportedValues(t, S{1, 2}, S{1, 3}) => true +// assert.EqualExportedValues(t, S{1, 2}, S{2, 3}) => false +func EqualExportedValues(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + + aType := reflect.TypeOf(expected) + bType := reflect.TypeOf(actual) + + if aType != bType { + return Fail(t, fmt.Sprintf("Types expected to match exactly\n\t%v != %v", aType, bType), msgAndArgs...) + } + + if aType.Kind() != reflect.Struct { + return Fail(t, fmt.Sprintf("Types expected to both be struct \n\t%v != %v", aType.Kind(), reflect.Struct), msgAndArgs...) + } + + if bType.Kind() != reflect.Struct { + return Fail(t, fmt.Sprintf("Types expected to both be struct \n\t%v != %v", bType.Kind(), reflect.Struct), msgAndArgs...) + } + + expected = copyExportedFields(expected) + actual = copyExportedFields(actual) + + if !ObjectsAreEqualValues(expected, actual) { + diff := diff(expected, actual) + expected, actual = formatUnequalValues(expected, actual) + return Fail(t, fmt.Sprintf("Not equal (comparing only exported fields): \n"+ + "expected: %s\n"+ + "actual : %s%s", expected, actual, diff), msgAndArgs...) + } + + return true +} + // Exactly asserts that two objects are equal in value and type. // -// assert.Exactly(t, int32(123), int64(123)) +// assert.Exactly(t, int32(123), int64(123)) func Exactly(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -496,7 +609,7 @@ func Exactly(t TestingT, expected, actual interface{}, msgAndArgs ...interface{} // NotNil asserts that the specified object is not nil. // -// assert.NotNil(t, err) +// assert.NotNil(t, err) func NotNil(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { if !isNil(object) { return true @@ -530,7 +643,7 @@ func isNil(object interface{}) bool { []reflect.Kind{ reflect.Chan, reflect.Func, reflect.Interface, reflect.Map, - reflect.Ptr, reflect.Slice}, + reflect.Ptr, reflect.Slice, reflect.UnsafePointer}, kind) if isNilableKind && value.IsNil() { @@ -542,7 +655,7 @@ func isNil(object interface{}) bool { // Nil asserts that the specified object is nil. // -// assert.Nil(t, err) +// assert.Nil(t, err) func Nil(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { if isNil(object) { return true @@ -585,7 +698,7 @@ func isEmpty(object interface{}) bool { // Empty asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Empty(t, obj) +// assert.Empty(t, obj) func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { pass := isEmpty(object) if !pass { @@ -602,9 +715,9 @@ func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmpty(t, obj) { -// assert.Equal(t, "two", obj[1]) -// } +// if assert.NotEmpty(t, obj) { +// assert.Equal(t, "two", obj[1]) +// } func NotEmpty(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { pass := !isEmpty(object) if !pass { @@ -633,7 +746,7 @@ func getLen(x interface{}) (ok bool, length int) { // Len asserts that the specified object has specific length. // Len also fails if the object has a type that len() not accept. // -// assert.Len(t, mySlice, 3) +// assert.Len(t, mySlice, 3) func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -651,7 +764,7 @@ func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) // True asserts that the specified value is true. // -// assert.True(t, myBool) +// assert.True(t, myBool) func True(t TestingT, value bool, msgAndArgs ...interface{}) bool { if !value { if h, ok := t.(tHelper); ok { @@ -666,7 +779,7 @@ func True(t TestingT, value bool, msgAndArgs ...interface{}) bool { // False asserts that the specified value is false. // -// assert.False(t, myBool) +// assert.False(t, myBool) func False(t TestingT, value bool, msgAndArgs ...interface{}) bool { if value { if h, ok := t.(tHelper); ok { @@ -681,7 +794,7 @@ func False(t TestingT, value bool, msgAndArgs ...interface{}) bool { // NotEqual asserts that the specified values are NOT equal. // -// assert.NotEqual(t, obj1, obj2) +// assert.NotEqual(t, obj1, obj2) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -704,7 +817,7 @@ func NotEqual(t TestingT, expected, actual interface{}, msgAndArgs ...interface{ // NotEqualValues asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValues(t, obj1, obj2) +// assert.NotEqualValues(t, obj1, obj2) func NotEqualValues(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -763,9 +876,9 @@ func containsElement(list interface{}, element interface{}) (ok, found bool) { // Contains asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Contains(t, "Hello World", "World") -// assert.Contains(t, ["Hello", "World"], "World") -// assert.Contains(t, {"Hello": "World"}, "Hello") +// assert.Contains(t, "Hello World", "World") +// assert.Contains(t, ["Hello", "World"], "World") +// assert.Contains(t, {"Hello": "World"}, "Hello") func Contains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -786,9 +899,9 @@ func Contains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) bo // NotContains asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContains(t, "Hello World", "Earth") -// assert.NotContains(t, ["Hello", "World"], "Earth") -// assert.NotContains(t, {"Hello": "World"}, "Earth") +// assert.NotContains(t, "Hello World", "Earth") +// assert.NotContains(t, ["Hello", "World"], "Earth") +// assert.NotContains(t, {"Hello": "World"}, "Earth") func NotContains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -796,10 +909,10 @@ func NotContains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) ok, found := containsElement(s, contains) if !ok { - return Fail(t, fmt.Sprintf("\"%s\" could not be applied builtin len()", s), msgAndArgs...) + return Fail(t, fmt.Sprintf("%#v could not be applied builtin len()", s), msgAndArgs...) } if found { - return Fail(t, fmt.Sprintf("\"%s\" should not contain \"%s\"", s, contains), msgAndArgs...) + return Fail(t, fmt.Sprintf("%#v should not contain %#v", s, contains), msgAndArgs...) } return true @@ -809,7 +922,7 @@ func NotContains(t TestingT, s, contains interface{}, msgAndArgs ...interface{}) // Subset asserts that the specified list(array, slice...) contains all // elements given in the specified subset(array, slice...). // -// assert.Subset(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") +// assert.Subset(t, [1, 2, 3], [1, 2], "But [1, 2, 3] does contain [1, 2]") func Subset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) (ok bool) { if h, ok := t.(tHelper); ok { h.Helper() @@ -818,49 +931,44 @@ func Subset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) (ok return true // we consider nil to be equal to the nil set } - defer func() { - if e := recover(); e != nil { - ok = false - } - }() - listKind := reflect.TypeOf(list).Kind() - subsetKind := reflect.TypeOf(subset).Kind() - if listKind != reflect.Array && listKind != reflect.Slice && listKind != reflect.Map { return Fail(t, fmt.Sprintf("%q has an unsupported type %s", list, listKind), msgAndArgs...) } + subsetKind := reflect.TypeOf(subset).Kind() if subsetKind != reflect.Array && subsetKind != reflect.Slice && listKind != reflect.Map { return Fail(t, fmt.Sprintf("%q has an unsupported type %s", subset, subsetKind), msgAndArgs...) } - subsetValue := reflect.ValueOf(subset) if subsetKind == reflect.Map && listKind == reflect.Map { - listValue := reflect.ValueOf(list) - subsetKeys := subsetValue.MapKeys() + subsetMap := reflect.ValueOf(subset) + actualMap := reflect.ValueOf(list) - for i := 0; i < len(subsetKeys); i++ { - subsetKey := subsetKeys[i] - subsetElement := subsetValue.MapIndex(subsetKey).Interface() - listElement := listValue.MapIndex(subsetKey).Interface() + for _, k := range subsetMap.MapKeys() { + ev := subsetMap.MapIndex(k) + av := actualMap.MapIndex(k) - if !ObjectsAreEqual(subsetElement, listElement) { - return Fail(t, fmt.Sprintf("\"%s\" does not contain \"%s\"", list, subsetElement), msgAndArgs...) + if !av.IsValid() { + return Fail(t, fmt.Sprintf("%#v does not contain %#v", list, subset), msgAndArgs...) + } + if !ObjectsAreEqual(ev.Interface(), av.Interface()) { + return Fail(t, fmt.Sprintf("%#v does not contain %#v", list, subset), msgAndArgs...) } } return true } - for i := 0; i < subsetValue.Len(); i++ { - element := subsetValue.Index(i).Interface() + subsetList := reflect.ValueOf(subset) + for i := 0; i < subsetList.Len(); i++ { + element := subsetList.Index(i).Interface() ok, found := containsElement(list, element) if !ok { - return Fail(t, fmt.Sprintf("\"%s\" could not be applied builtin len()", list), msgAndArgs...) + return Fail(t, fmt.Sprintf("%#v could not be applied builtin len()", list), msgAndArgs...) } if !found { - return Fail(t, fmt.Sprintf("\"%s\" does not contain \"%s\"", list, element), msgAndArgs...) + return Fail(t, fmt.Sprintf("%#v does not contain %#v", list, element), msgAndArgs...) } } @@ -870,7 +978,7 @@ func Subset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) (ok // NotSubset asserts that the specified list(array, slice...) contains not all // elements given in the specified subset(array, slice...). // -// assert.NotSubset(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") +// assert.NotSubset(t, [1, 3, 4], [1, 2], "But [1, 3, 4] does not contain [1, 2]") func NotSubset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) (ok bool) { if h, ok := t.(tHelper); ok { h.Helper() @@ -879,34 +987,28 @@ func NotSubset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) return Fail(t, "nil is the empty set which is a subset of every set", msgAndArgs...) } - defer func() { - if e := recover(); e != nil { - ok = false - } - }() - listKind := reflect.TypeOf(list).Kind() - subsetKind := reflect.TypeOf(subset).Kind() - if listKind != reflect.Array && listKind != reflect.Slice && listKind != reflect.Map { return Fail(t, fmt.Sprintf("%q has an unsupported type %s", list, listKind), msgAndArgs...) } + subsetKind := reflect.TypeOf(subset).Kind() if subsetKind != reflect.Array && subsetKind != reflect.Slice && listKind != reflect.Map { return Fail(t, fmt.Sprintf("%q has an unsupported type %s", subset, subsetKind), msgAndArgs...) } - subsetValue := reflect.ValueOf(subset) if subsetKind == reflect.Map && listKind == reflect.Map { - listValue := reflect.ValueOf(list) - subsetKeys := subsetValue.MapKeys() + subsetMap := reflect.ValueOf(subset) + actualMap := reflect.ValueOf(list) - for i := 0; i < len(subsetKeys); i++ { - subsetKey := subsetKeys[i] - subsetElement := subsetValue.MapIndex(subsetKey).Interface() - listElement := listValue.MapIndex(subsetKey).Interface() + for _, k := range subsetMap.MapKeys() { + ev := subsetMap.MapIndex(k) + av := actualMap.MapIndex(k) - if !ObjectsAreEqual(subsetElement, listElement) { + if !av.IsValid() { + return true + } + if !ObjectsAreEqual(ev.Interface(), av.Interface()) { return true } } @@ -914,8 +1016,9 @@ func NotSubset(t TestingT, list, subset interface{}, msgAndArgs ...interface{}) return Fail(t, fmt.Sprintf("%q is a subset of %q", subset, list), msgAndArgs...) } - for i := 0; i < subsetValue.Len(); i++ { - element := subsetValue.Index(i).Interface() + subsetList := reflect.ValueOf(subset) + for i := 0; i < subsetList.Len(); i++ { + element := subsetList.Index(i).Interface() ok, found := containsElement(list, element) if !ok { return Fail(t, fmt.Sprintf("\"%s\" could not be applied builtin len()", list), msgAndArgs...) @@ -1060,7 +1163,7 @@ func didPanic(f PanicTestFunc) (didPanic bool, message interface{}, stack string // Panics asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panics(t, func(){ GoCrazy() }) +// assert.Panics(t, func(){ GoCrazy() }) func Panics(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1076,7 +1179,7 @@ func Panics(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool { // PanicsWithValue asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) +// assert.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) func PanicsWithValue(t TestingT, expected interface{}, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1097,7 +1200,7 @@ func PanicsWithValue(t TestingT, expected interface{}, f PanicTestFunc, msgAndAr // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) +// assert.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) func PanicsWithError(t TestingT, errString string, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1117,7 +1220,7 @@ func PanicsWithError(t TestingT, errString string, f PanicTestFunc, msgAndArgs . // NotPanics asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanics(t, func(){ RemainCalm() }) +// assert.NotPanics(t, func(){ RemainCalm() }) func NotPanics(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1132,7 +1235,7 @@ func NotPanics(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool { // WithinDuration asserts that the two times are within duration delta of each other. // -// assert.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) +// assert.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) func WithinDuration(t TestingT, expected, actual time.Time, delta time.Duration, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1148,7 +1251,7 @@ func WithinDuration(t TestingT, expected, actual time.Time, delta time.Duration, // WithinRange asserts that a time is within a time range (inclusive). // -// assert.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) +// assert.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) func WithinRange(t TestingT, actual, start, end time.Time, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1207,7 +1310,7 @@ func toFloat(x interface{}) (float64, bool) { // InDelta asserts that the two numerals are within delta of each other. // -// assert.InDelta(t, math.Pi, 22/7.0, 0.01) +// assert.InDelta(t, math.Pi, 22/7.0, 0.01) func InDelta(t TestingT, expected, actual interface{}, delta float64, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1380,10 +1483,10 @@ func InEpsilonSlice(t TestingT, expected, actual interface{}, epsilon float64, m // NoError asserts that a function returned no error (i.e. `nil`). // -// actualObj, err := SomeFunction() -// if assert.NoError(t, err) { -// assert.Equal(t, expectedObj, actualObj) -// } +// actualObj, err := SomeFunction() +// if assert.NoError(t, err) { +// assert.Equal(t, expectedObj, actualObj) +// } func NoError(t TestingT, err error, msgAndArgs ...interface{}) bool { if err != nil { if h, ok := t.(tHelper); ok { @@ -1397,10 +1500,10 @@ func NoError(t TestingT, err error, msgAndArgs ...interface{}) bool { // Error asserts that a function returned an error (i.e. not `nil`). // -// actualObj, err := SomeFunction() -// if assert.Error(t, err) { -// assert.Equal(t, expectedError, err) -// } +// actualObj, err := SomeFunction() +// if assert.Error(t, err) { +// assert.Equal(t, expectedError, err) +// } func Error(t TestingT, err error, msgAndArgs ...interface{}) bool { if err == nil { if h, ok := t.(tHelper); ok { @@ -1415,8 +1518,8 @@ func Error(t TestingT, err error, msgAndArgs ...interface{}) bool { // EqualError asserts that a function returned an error (i.e. not `nil`) // and that it is equal to the provided error. // -// actualObj, err := SomeFunction() -// assert.EqualError(t, err, expectedErrorString) +// actualObj, err := SomeFunction() +// assert.EqualError(t, err, expectedErrorString) func EqualError(t TestingT, theError error, errString string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1438,8 +1541,8 @@ func EqualError(t TestingT, theError error, errString string, msgAndArgs ...inte // ErrorContains asserts that a function returned an error (i.e. not `nil`) // and that the error contains the specified substring. // -// actualObj, err := SomeFunction() -// assert.ErrorContains(t, err, expectedErrorSubString) +// actualObj, err := SomeFunction() +// assert.ErrorContains(t, err, expectedErrorSubString) func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1472,8 +1575,8 @@ func matchRegexp(rx interface{}, str interface{}) bool { // Regexp asserts that a specified regexp matches a string. // -// assert.Regexp(t, regexp.MustCompile("start"), "it's starting") -// assert.Regexp(t, "start...$", "it's not starting") +// assert.Regexp(t, regexp.MustCompile("start"), "it's starting") +// assert.Regexp(t, "start...$", "it's not starting") func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1490,8 +1593,8 @@ func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface // NotRegexp asserts that a specified regexp does not match a string. // -// assert.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") -// assert.NotRegexp(t, "^start", "it's not starting") +// assert.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") +// assert.NotRegexp(t, "^start", "it's not starting") func NotRegexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1603,7 +1706,7 @@ func NoDirExists(t TestingT, path string, msgAndArgs ...interface{}) bool { // JSONEq asserts that two JSON strings are equivalent. // -// assert.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) +// assert.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) func JSONEq(t TestingT, expected string, actual string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1726,7 +1829,7 @@ type tHelper interface { // Eventually asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) +// assert.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -1756,10 +1859,93 @@ func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick t } } +// CollectT implements the TestingT interface and collects all errors. +type CollectT struct { + errors []error +} + +// Errorf collects the error. +func (c *CollectT) Errorf(format string, args ...interface{}) { + c.errors = append(c.errors, fmt.Errorf(format, args...)) +} + +// FailNow panics. +func (c *CollectT) FailNow() { + panic("Assertion failed") +} + +// Reset clears the collected errors. +func (c *CollectT) Reset() { + c.errors = nil +} + +// Copy copies the collected errors to the supplied t. +func (c *CollectT) Copy(t TestingT) { + if tt, ok := t.(tHelper); ok { + tt.Helper() + } + for _, err := range c.errors { + t.Errorf("%v", err) + } +} + +// EventuallyWithT asserts that given condition will be met in waitFor time, +// periodically checking target function each tick. In contrast to Eventually, +// it supplies a CollectT to the condition function, so that the condition +// function can use the CollectT to call other assertions. +// The condition is considered "met" if no errors are raised in a tick. +// The supplied CollectT collects all errors from one tick (if there are any). +// If the condition is not met before waitFor, the collected errors of +// the last tick are copied to t. +// +// externalValue := false +// go func() { +// time.Sleep(8*time.Second) +// externalValue = true +// }() +// assert.EventuallyWithT(t, func(c *assert.CollectT) { +// // add assertions as needed; any assertion failure will fail the current tick +// assert.True(c, externalValue, "expected 'externalValue' to be true") +// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +func EventuallyWithT(t TestingT, condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + + collect := new(CollectT) + ch := make(chan bool, 1) + + timer := time.NewTimer(waitFor) + defer timer.Stop() + + ticker := time.NewTicker(tick) + defer ticker.Stop() + + for tick := ticker.C; ; { + select { + case <-timer.C: + collect.Copy(t) + return Fail(t, "Condition never satisfied", msgAndArgs...) + case <-tick: + tick = nil + collect.Reset() + go func() { + condition(collect) + ch <- len(collect.errors) == 0 + }() + case v := <-ch: + if v { + return true + } + tick = ticker.C + } + } +} + // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) +// assert.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) func Never(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/assert/doc.go b/vendor/github.com/stretchr/testify/assert/doc.go index c9dccc4..4953981 100644 --- a/vendor/github.com/stretchr/testify/assert/doc.go +++ b/vendor/github.com/stretchr/testify/assert/doc.go @@ -1,39 +1,40 @@ // Package assert provides a set of comprehensive testing tools for use with the normal Go testing system. // -// Example Usage +// # Example Usage // // The following is a complete example using assert in a standard test function: -// import ( -// "testing" -// "github.com/stretchr/testify/assert" -// ) // -// func TestSomething(t *testing.T) { +// import ( +// "testing" +// "github.com/stretchr/testify/assert" +// ) // -// var a string = "Hello" -// var b string = "Hello" +// func TestSomething(t *testing.T) { // -// assert.Equal(t, a, b, "The two words should be the same.") +// var a string = "Hello" +// var b string = "Hello" // -// } +// assert.Equal(t, a, b, "The two words should be the same.") +// +// } // // if you assert many times, use the format below: // -// import ( -// "testing" -// "github.com/stretchr/testify/assert" -// ) +// import ( +// "testing" +// "github.com/stretchr/testify/assert" +// ) // -// func TestSomething(t *testing.T) { -// assert := assert.New(t) +// func TestSomething(t *testing.T) { +// assert := assert.New(t) // -// var a string = "Hello" -// var b string = "Hello" +// var a string = "Hello" +// var b string = "Hello" // -// assert.Equal(a, b, "The two words should be the same.") -// } +// assert.Equal(a, b, "The two words should be the same.") +// } // -// Assertions +// # Assertions // // Assertions allow you to easily write test code, and are global funcs in the `assert` package. // All assertion functions take, as the first argument, the `*testing.T` object provided by the diff --git a/vendor/github.com/stretchr/testify/assert/http_assertions.go b/vendor/github.com/stretchr/testify/assert/http_assertions.go index 4ed341d..d8038c2 100644 --- a/vendor/github.com/stretchr/testify/assert/http_assertions.go +++ b/vendor/github.com/stretchr/testify/assert/http_assertions.go @@ -23,7 +23,7 @@ func httpCode(handler http.HandlerFunc, method, url string, values url.Values) ( // HTTPSuccess asserts that a specified handler returns a success status code. // -// assert.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) +// assert.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccess(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -45,7 +45,7 @@ func HTTPSuccess(t TestingT, handler http.HandlerFunc, method, url string, value // HTTPRedirect asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirect(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -67,7 +67,7 @@ func HTTPRedirect(t TestingT, handler http.HandlerFunc, method, url string, valu // HTTPError asserts that a specified handler returns an error status code. // -// assert.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// assert.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPError(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, msgAndArgs ...interface{}) bool { @@ -89,7 +89,7 @@ func HTTPError(t TestingT, handler http.HandlerFunc, method, url string, values // HTTPStatusCode asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) +// assert.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, statuscode int, msgAndArgs ...interface{}) bool { @@ -124,7 +124,7 @@ func HTTPBody(handler http.HandlerFunc, method, url string, values url.Values) s // HTTPBodyContains asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// assert.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) bool { @@ -144,7 +144,7 @@ func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method, url string, // HTTPBodyNotContains asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// assert.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContains(t TestingT, handler http.HandlerFunc, method, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) bool { diff --git a/vendor/golang.org/x/crypto/AUTHORS b/vendor/golang.org/x/crypto/AUTHORS deleted file mode 100644 index 2b00ddb..0000000 --- a/vendor/golang.org/x/crypto/AUTHORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code refers to The Go Authors for copyright purposes. -# The master list of authors is in the main Go distribution, -# visible at https://tip.golang.org/AUTHORS. diff --git a/vendor/golang.org/x/crypto/CONTRIBUTORS b/vendor/golang.org/x/crypto/CONTRIBUTORS deleted file mode 100644 index 1fbd3e9..0000000 --- a/vendor/golang.org/x/crypto/CONTRIBUTORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code was written by the Go contributors. -# The master list of contributors is in the main Go distribution, -# visible at https://tip.golang.org/CONTRIBUTORS. diff --git a/vendor/golang.org/x/sync/AUTHORS b/vendor/golang.org/x/sync/AUTHORS deleted file mode 100644 index 15167cd..0000000 --- a/vendor/golang.org/x/sync/AUTHORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code refers to The Go Authors for copyright purposes. -# The master list of authors is in the main Go distribution, -# visible at http://tip.golang.org/AUTHORS. diff --git a/vendor/golang.org/x/sync/CONTRIBUTORS b/vendor/golang.org/x/sync/CONTRIBUTORS deleted file mode 100644 index 1c4577e..0000000 --- a/vendor/golang.org/x/sync/CONTRIBUTORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code was written by the Go contributors. -# The master list of contributors is in the main Go distribution, -# visible at http://tip.golang.org/CONTRIBUTORS. diff --git a/vendor/golang.org/x/sync/errgroup/errgroup.go b/vendor/golang.org/x/sync/errgroup/errgroup.go index 4c0850a..b18efb7 100644 --- a/vendor/golang.org/x/sync/errgroup/errgroup.go +++ b/vendor/golang.org/x/sync/errgroup/errgroup.go @@ -20,7 +20,7 @@ type token struct{} // A zero Group is valid, has no limit on the number of active goroutines, // and does not cancel on error. type Group struct { - cancel func() + cancel func(error) wg sync.WaitGroup @@ -43,7 +43,7 @@ func (g *Group) done() { // returns a non-nil error or the first time Wait returns, whichever occurs // first. func WithContext(ctx context.Context) (*Group, context.Context) { - ctx, cancel := context.WithCancel(ctx) + ctx, cancel := withCancelCause(ctx) return &Group{cancel: cancel}, ctx } @@ -52,7 +52,7 @@ func WithContext(ctx context.Context) (*Group, context.Context) { func (g *Group) Wait() error { g.wg.Wait() if g.cancel != nil { - g.cancel() + g.cancel(g.err) } return g.err } @@ -61,8 +61,8 @@ func (g *Group) Wait() error { // It blocks until the new goroutine can be added without the number of // active goroutines in the group exceeding the configured limit. // -// The first call to return a non-nil error cancels the group; its error will be -// returned by Wait. +// The first call to return a non-nil error cancels the group's context, if the +// group was created by calling WithContext. The error will be returned by Wait. func (g *Group) Go(f func() error) { if g.sem != nil { g.sem <- token{} @@ -76,7 +76,7 @@ func (g *Group) Go(f func() error) { g.errOnce.Do(func() { g.err = err if g.cancel != nil { - g.cancel() + g.cancel(g.err) } }) } @@ -105,7 +105,7 @@ func (g *Group) TryGo(f func() error) bool { g.errOnce.Do(func() { g.err = err if g.cancel != nil { - g.cancel() + g.cancel(g.err) } }) } diff --git a/vendor/golang.org/x/sync/errgroup/go120.go b/vendor/golang.org/x/sync/errgroup/go120.go new file mode 100644 index 0000000..7d419d3 --- /dev/null +++ b/vendor/golang.org/x/sync/errgroup/go120.go @@ -0,0 +1,14 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.20 +// +build go1.20 + +package errgroup + +import "context" + +func withCancelCause(parent context.Context) (context.Context, func(error)) { + return context.WithCancelCause(parent) +} diff --git a/vendor/golang.org/x/sync/errgroup/pre_go120.go b/vendor/golang.org/x/sync/errgroup/pre_go120.go new file mode 100644 index 0000000..1795c18 --- /dev/null +++ b/vendor/golang.org/x/sync/errgroup/pre_go120.go @@ -0,0 +1,15 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !go1.20 +// +build !go1.20 + +package errgroup + +import "context" + +func withCancelCause(parent context.Context) (context.Context, func(error)) { + ctx, cancel := context.WithCancel(parent) + return ctx, func(error) { cancel() } +} diff --git a/vendor/golang.org/x/sync/singleflight/singleflight.go b/vendor/golang.org/x/sync/singleflight/singleflight.go index 690eb85..8473fb7 100644 --- a/vendor/golang.org/x/sync/singleflight/singleflight.go +++ b/vendor/golang.org/x/sync/singleflight/singleflight.go @@ -52,10 +52,6 @@ type call struct { val interface{} err error - // forgotten indicates whether Forget was called with this call's key - // while the call was still in flight. - forgotten bool - // These fields are read and written with the singleflight // mutex held before the WaitGroup is done, and are read but // not written after the WaitGroup is done. @@ -148,10 +144,10 @@ func (g *Group) doCall(c *call, key string, fn func() (interface{}, error)) { c.err = errGoexit } - c.wg.Done() g.mu.Lock() defer g.mu.Unlock() - if !c.forgotten { + c.wg.Done() + if g.m[key] == c { delete(g.m, key) } @@ -204,9 +200,6 @@ func (g *Group) doCall(c *call, key string, fn func() (interface{}, error)) { // an earlier call to complete. func (g *Group) Forget(key string) { g.mu.Lock() - if c, ok := g.m[key]; ok { - c.forgotten = true - } delete(g.m, key) g.mu.Unlock() } diff --git a/vendor/golang.org/x/text/AUTHORS b/vendor/golang.org/x/text/AUTHORS deleted file mode 100644 index 15167cd..0000000 --- a/vendor/golang.org/x/text/AUTHORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code refers to The Go Authors for copyright purposes. -# The master list of authors is in the main Go distribution, -# visible at http://tip.golang.org/AUTHORS. diff --git a/vendor/golang.org/x/text/CONTRIBUTORS b/vendor/golang.org/x/text/CONTRIBUTORS deleted file mode 100644 index 1c4577e..0000000 --- a/vendor/golang.org/x/text/CONTRIBUTORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code was written by the Go contributors. -# The master list of contributors is in the main Go distribution, -# visible at http://tip.golang.org/CONTRIBUTORS. diff --git a/vendor/golang.org/x/text/cases/tables13.0.0.go b/vendor/golang.org/x/text/cases/tables13.0.0.go index cd87477..68d2981 100644 --- a/vendor/golang.org/x/text/cases/tables13.0.0.go +++ b/vendor/golang.org/x/text/cases/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package cases diff --git a/vendor/golang.org/x/text/cases/tables15.0.0.go b/vendor/golang.org/x/text/cases/tables15.0.0.go new file mode 100644 index 0000000..e431b99 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables15.0.0.go @@ -0,0 +1,2528 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "15.0.0" + +var xorData string = "" + // Size: 213 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + + "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + + "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x03'" + + "\x00\x03)\x00\x03+\x00\x03/\x00\x03\x19\x00\x03\x1b\x00\x03\x1f\x00\x01" + + "\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2450 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + + "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + + "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + + "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + + "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + + "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + + "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + + "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + + "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + + "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + + "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + + "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + + "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + + "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + + "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + + "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + + "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + + "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + + "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + + "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + + "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + + "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + + "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + + "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + + "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + + "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + + "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + + "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + + "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + + "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + + "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + + "խ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 13398 bytes (13.08 KiB). Checksum: 544af6e6b1b70931. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 22: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 22 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 24 blocks, 1536 entries, 3072 bytes +// The third block is the zero block. +var caseValues = [1536]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, + 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, 0x28a: 0x0010, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x0010, 0x2c1: 0x0010, 0x2c2: 0x0010, 0x2c3: 0x0010, 0x2c4: 0x0010, 0x2c5: 0x0010, + 0x2c6: 0x0010, 0x2c7: 0x0010, 0x2c8: 0x0010, 0x2c9: 0x0014, 0x2ca: 0x0024, 0x2cb: 0x0024, + 0x2cc: 0x0024, 0x2cd: 0x0024, 0x2ce: 0x0024, 0x2cf: 0x0034, 0x2d0: 0x0034, 0x2d1: 0x0034, + 0x2d2: 0x0034, 0x2d3: 0x0034, 0x2d4: 0x0024, 0x2d5: 0x0024, 0x2d6: 0x0024, 0x2d7: 0x0024, + 0x2d8: 0x0024, 0x2d9: 0x0024, 0x2da: 0x0024, 0x2db: 0x0024, 0x2dc: 0x0024, 0x2dd: 0x0024, + 0x2de: 0x0024, 0x2df: 0x0024, 0x2e0: 0x0024, 0x2e1: 0x0024, 0x2e2: 0x0014, 0x2e3: 0x0034, + 0x2e4: 0x0024, 0x2e5: 0x0024, 0x2e6: 0x0034, 0x2e7: 0x0024, 0x2e8: 0x0024, 0x2e9: 0x0034, + 0x2ea: 0x0024, 0x2eb: 0x0024, 0x2ec: 0x0024, 0x2ed: 0x0034, 0x2ee: 0x0034, 0x2ef: 0x0034, + 0x2f0: 0x0034, 0x2f1: 0x0034, 0x2f2: 0x0034, 0x2f3: 0x0024, 0x2f4: 0x0024, 0x2f5: 0x0024, + 0x2f6: 0x0034, 0x2f7: 0x0024, 0x2f8: 0x0024, 0x2f9: 0x0034, 0x2fa: 0x0034, 0x2fb: 0x0024, + 0x2fc: 0x0024, 0x2fd: 0x0024, 0x2fe: 0x0024, 0x2ff: 0x0024, + // Block 0xc, offset 0x300 + 0x300: 0x7053, 0x301: 0x7053, 0x302: 0x7053, 0x303: 0x7053, 0x304: 0x7053, 0x305: 0x7053, + 0x307: 0x7053, + 0x30d: 0x7053, 0x310: 0x1aea, 0x311: 0x1b6a, + 0x312: 0x1bea, 0x313: 0x1c6a, 0x314: 0x1cea, 0x315: 0x1d6a, 0x316: 0x1dea, 0x317: 0x1e6a, + 0x318: 0x1eea, 0x319: 0x1f6a, 0x31a: 0x1fea, 0x31b: 0x206a, 0x31c: 0x20ea, 0x31d: 0x216a, + 0x31e: 0x21ea, 0x31f: 0x226a, 0x320: 0x22ea, 0x321: 0x236a, 0x322: 0x23ea, 0x323: 0x246a, + 0x324: 0x24ea, 0x325: 0x256a, 0x326: 0x25ea, 0x327: 0x266a, 0x328: 0x26ea, 0x329: 0x276a, + 0x32a: 0x27ea, 0x32b: 0x286a, 0x32c: 0x28ea, 0x32d: 0x296a, 0x32e: 0x29ea, 0x32f: 0x2a6a, + 0x330: 0x2aea, 0x331: 0x2b6a, 0x332: 0x2bea, 0x333: 0x2c6a, 0x334: 0x2cea, 0x335: 0x2d6a, + 0x336: 0x2dea, 0x337: 0x2e6a, 0x338: 0x2eea, 0x339: 0x2f6a, 0x33a: 0x2fea, + 0x33c: 0x0015, 0x33d: 0x306a, 0x33e: 0x30ea, 0x33f: 0x316a, + // Block 0xd, offset 0x340 + 0x340: 0x0812, 0x341: 0x0812, 0x342: 0x0812, 0x343: 0x0812, 0x344: 0x0812, 0x345: 0x0812, + 0x348: 0x0813, 0x349: 0x0813, 0x34a: 0x0813, 0x34b: 0x0813, + 0x34c: 0x0813, 0x34d: 0x0813, 0x350: 0x3b1a, 0x351: 0x0812, + 0x352: 0x3bfa, 0x353: 0x0812, 0x354: 0x3d3a, 0x355: 0x0812, 0x356: 0x3e7a, 0x357: 0x0812, + 0x359: 0x0813, 0x35b: 0x0813, 0x35d: 0x0813, + 0x35f: 0x0813, 0x360: 0x0812, 0x361: 0x0812, 0x362: 0x0812, 0x363: 0x0812, + 0x364: 0x0812, 0x365: 0x0812, 0x366: 0x0812, 0x367: 0x0812, 0x368: 0x0813, 0x369: 0x0813, + 0x36a: 0x0813, 0x36b: 0x0813, 0x36c: 0x0813, 0x36d: 0x0813, 0x36e: 0x0813, 0x36f: 0x0813, + 0x370: 0x9252, 0x371: 0x9252, 0x372: 0x9552, 0x373: 0x9552, 0x374: 0x9852, 0x375: 0x9852, + 0x376: 0x9b52, 0x377: 0x9b52, 0x378: 0x9e52, 0x379: 0x9e52, 0x37a: 0xa152, 0x37b: 0xa152, + 0x37c: 0x4d52, 0x37d: 0x4d52, + // Block 0xe, offset 0x380 + 0x380: 0x3fba, 0x381: 0x40aa, 0x382: 0x419a, 0x383: 0x428a, 0x384: 0x437a, 0x385: 0x446a, + 0x386: 0x455a, 0x387: 0x464a, 0x388: 0x4739, 0x389: 0x4829, 0x38a: 0x4919, 0x38b: 0x4a09, + 0x38c: 0x4af9, 0x38d: 0x4be9, 0x38e: 0x4cd9, 0x38f: 0x4dc9, 0x390: 0x4eba, 0x391: 0x4faa, + 0x392: 0x509a, 0x393: 0x518a, 0x394: 0x527a, 0x395: 0x536a, 0x396: 0x545a, 0x397: 0x554a, + 0x398: 0x5639, 0x399: 0x5729, 0x39a: 0x5819, 0x39b: 0x5909, 0x39c: 0x59f9, 0x39d: 0x5ae9, + 0x39e: 0x5bd9, 0x39f: 0x5cc9, 0x3a0: 0x5dba, 0x3a1: 0x5eaa, 0x3a2: 0x5f9a, 0x3a3: 0x608a, + 0x3a4: 0x617a, 0x3a5: 0x626a, 0x3a6: 0x635a, 0x3a7: 0x644a, 0x3a8: 0x6539, 0x3a9: 0x6629, + 0x3aa: 0x6719, 0x3ab: 0x6809, 0x3ac: 0x68f9, 0x3ad: 0x69e9, 0x3ae: 0x6ad9, 0x3af: 0x6bc9, + 0x3b0: 0x0812, 0x3b1: 0x0812, 0x3b2: 0x6cba, 0x3b3: 0x6dca, 0x3b4: 0x6e9a, + 0x3b6: 0x6f7a, 0x3b7: 0x705a, 0x3b8: 0x0813, 0x3b9: 0x0813, 0x3ba: 0x9253, 0x3bb: 0x9253, + 0x3bc: 0x7199, 0x3bd: 0x0004, 0x3be: 0x726a, 0x3bf: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x0004, 0x3c1: 0x0004, 0x3c2: 0x72ea, 0x3c3: 0x73fa, 0x3c4: 0x74ca, + 0x3c6: 0x75aa, 0x3c7: 0x768a, 0x3c8: 0x9553, 0x3c9: 0x9553, 0x3ca: 0x9853, 0x3cb: 0x9853, + 0x3cc: 0x77c9, 0x3cd: 0x0004, 0x3ce: 0x0004, 0x3cf: 0x0004, 0x3d0: 0x0812, 0x3d1: 0x0812, + 0x3d2: 0x789a, 0x3d3: 0x79da, 0x3d6: 0x7b1a, 0x3d7: 0x7bfa, + 0x3d8: 0x0813, 0x3d9: 0x0813, 0x3da: 0x9b53, 0x3db: 0x9b53, 0x3dd: 0x0004, + 0x3de: 0x0004, 0x3df: 0x0004, 0x3e0: 0x0812, 0x3e1: 0x0812, 0x3e2: 0x7d3a, 0x3e3: 0x7e7a, + 0x3e4: 0x7fba, 0x3e5: 0x0912, 0x3e6: 0x809a, 0x3e7: 0x817a, 0x3e8: 0x0813, 0x3e9: 0x0813, + 0x3ea: 0xa153, 0x3eb: 0xa153, 0x3ec: 0x0913, 0x3ed: 0x0004, 0x3ee: 0x0004, 0x3ef: 0x0004, + 0x3f2: 0x82ba, 0x3f3: 0x83ca, 0x3f4: 0x849a, + 0x3f6: 0x857a, 0x3f7: 0x865a, 0x3f8: 0x9e53, 0x3f9: 0x9e53, 0x3fa: 0x4d53, 0x3fb: 0x4d53, + 0x3fc: 0x8799, 0x3fd: 0x0004, 0x3fe: 0x0004, + // Block 0x10, offset 0x400 + 0x402: 0x0013, + 0x407: 0x0013, 0x40a: 0x0012, 0x40b: 0x0013, + 0x40c: 0x0013, 0x40d: 0x0013, 0x40e: 0x0012, 0x40f: 0x0012, 0x410: 0x0013, 0x411: 0x0013, + 0x412: 0x0013, 0x413: 0x0012, 0x415: 0x0013, + 0x419: 0x0013, 0x41a: 0x0013, 0x41b: 0x0013, 0x41c: 0x0013, 0x41d: 0x0013, + 0x424: 0x0013, 0x426: 0x886b, 0x428: 0x0013, + 0x42a: 0x88cb, 0x42b: 0x890b, 0x42c: 0x0013, 0x42d: 0x0013, 0x42f: 0x0012, + 0x430: 0x0013, 0x431: 0x0013, 0x432: 0xa453, 0x433: 0x0013, 0x434: 0x0012, 0x435: 0x0010, + 0x436: 0x0010, 0x437: 0x0010, 0x438: 0x0010, 0x439: 0x0012, + 0x43c: 0x0012, 0x43d: 0x0012, 0x43e: 0x0013, 0x43f: 0x0013, + // Block 0x11, offset 0x440 + 0x440: 0x1a13, 0x441: 0x1a13, 0x442: 0x1e13, 0x443: 0x1e13, 0x444: 0x1a13, 0x445: 0x1a13, + 0x446: 0x2613, 0x447: 0x2613, 0x448: 0x2a13, 0x449: 0x2a13, 0x44a: 0x2e13, 0x44b: 0x2e13, + 0x44c: 0x2a13, 0x44d: 0x2a13, 0x44e: 0x2613, 0x44f: 0x2613, 0x450: 0xa752, 0x451: 0xa752, + 0x452: 0xaa52, 0x453: 0xaa52, 0x454: 0xad52, 0x455: 0xad52, 0x456: 0xaa52, 0x457: 0xaa52, + 0x458: 0xa752, 0x459: 0xa752, 0x45a: 0x1a12, 0x45b: 0x1a12, 0x45c: 0x1e12, 0x45d: 0x1e12, + 0x45e: 0x1a12, 0x45f: 0x1a12, 0x460: 0x2612, 0x461: 0x2612, 0x462: 0x2a12, 0x463: 0x2a12, + 0x464: 0x2e12, 0x465: 0x2e12, 0x466: 0x2a12, 0x467: 0x2a12, 0x468: 0x2612, 0x469: 0x2612, + // Block 0x12, offset 0x480 + 0x480: 0x6552, 0x481: 0x6552, 0x482: 0x6552, 0x483: 0x6552, 0x484: 0x6552, 0x485: 0x6552, + 0x486: 0x6552, 0x487: 0x6552, 0x488: 0x6552, 0x489: 0x6552, 0x48a: 0x6552, 0x48b: 0x6552, + 0x48c: 0x6552, 0x48d: 0x6552, 0x48e: 0x6552, 0x48f: 0x6552, 0x490: 0xb052, 0x491: 0xb052, + 0x492: 0xb052, 0x493: 0xb052, 0x494: 0xb052, 0x495: 0xb052, 0x496: 0xb052, 0x497: 0xb052, + 0x498: 0xb052, 0x499: 0xb052, 0x49a: 0xb052, 0x49b: 0xb052, 0x49c: 0xb052, 0x49d: 0xb052, + 0x49e: 0xb052, 0x49f: 0xb052, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x896b, 0x4a3: 0x8b53, + 0x4a4: 0x89cb, 0x4a5: 0x8a2a, 0x4a6: 0x8a8a, 0x4a7: 0x0f13, 0x4a8: 0x0f12, 0x4a9: 0x0313, + 0x4aa: 0x0312, 0x4ab: 0x0713, 0x4ac: 0x0712, 0x4ad: 0x8aeb, 0x4ae: 0x8b4b, 0x4af: 0x8bab, + 0x4b0: 0x8c0b, 0x4b1: 0x0012, 0x4b2: 0x0113, 0x4b3: 0x0112, 0x4b4: 0x0012, 0x4b5: 0x0313, + 0x4b6: 0x0312, 0x4b7: 0x0012, 0x4b8: 0x0012, 0x4b9: 0x0012, 0x4ba: 0x0012, 0x4bb: 0x0012, + 0x4bc: 0x0015, 0x4bd: 0x0015, 0x4be: 0x8c6b, 0x4bf: 0x8ccb, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x0113, 0x4c1: 0x0112, 0x4c2: 0x0113, 0x4c3: 0x0112, 0x4c4: 0x0113, 0x4c5: 0x0112, + 0x4c6: 0x0113, 0x4c7: 0x0112, 0x4c8: 0x0014, 0x4c9: 0x0014, 0x4ca: 0x0014, 0x4cb: 0x0713, + 0x4cc: 0x0712, 0x4cd: 0x8d2b, 0x4ce: 0x0012, 0x4cf: 0x0010, 0x4d0: 0x0113, 0x4d1: 0x0112, + 0x4d2: 0x0113, 0x4d3: 0x0112, 0x4d4: 0x6552, 0x4d5: 0x0012, 0x4d6: 0x0113, 0x4d7: 0x0112, + 0x4d8: 0x0113, 0x4d9: 0x0112, 0x4da: 0x0113, 0x4db: 0x0112, 0x4dc: 0x0113, 0x4dd: 0x0112, + 0x4de: 0x0113, 0x4df: 0x0112, 0x4e0: 0x0113, 0x4e1: 0x0112, 0x4e2: 0x0113, 0x4e3: 0x0112, + 0x4e4: 0x0113, 0x4e5: 0x0112, 0x4e6: 0x0113, 0x4e7: 0x0112, 0x4e8: 0x0113, 0x4e9: 0x0112, + 0x4ea: 0x8d8b, 0x4eb: 0x8deb, 0x4ec: 0x8e4b, 0x4ed: 0x8eab, 0x4ee: 0x8f0b, 0x4ef: 0x0012, + 0x4f0: 0x8f6b, 0x4f1: 0x8fcb, 0x4f2: 0x902b, 0x4f3: 0xb353, 0x4f4: 0x0113, 0x4f5: 0x0112, + 0x4f6: 0x0113, 0x4f7: 0x0112, 0x4f8: 0x0113, 0x4f9: 0x0112, 0x4fa: 0x0113, 0x4fb: 0x0112, + 0x4fc: 0x0113, 0x4fd: 0x0112, 0x4fe: 0x0113, 0x4ff: 0x0112, + // Block 0x14, offset 0x500 + 0x500: 0x90ea, 0x501: 0x916a, 0x502: 0x91ea, 0x503: 0x926a, 0x504: 0x931a, 0x505: 0x93ca, + 0x506: 0x944a, + 0x513: 0x94ca, 0x514: 0x95aa, 0x515: 0x968a, 0x516: 0x976a, 0x517: 0x984a, + 0x51d: 0x0010, + 0x51e: 0x0034, 0x51f: 0x0010, 0x520: 0x0010, 0x521: 0x0010, 0x522: 0x0010, 0x523: 0x0010, + 0x524: 0x0010, 0x525: 0x0010, 0x526: 0x0010, 0x527: 0x0010, 0x528: 0x0010, + 0x52a: 0x0010, 0x52b: 0x0010, 0x52c: 0x0010, 0x52d: 0x0010, 0x52e: 0x0010, 0x52f: 0x0010, + 0x530: 0x0010, 0x531: 0x0010, 0x532: 0x0010, 0x533: 0x0010, 0x534: 0x0010, 0x535: 0x0010, + 0x536: 0x0010, 0x538: 0x0010, 0x539: 0x0010, 0x53a: 0x0010, 0x53b: 0x0010, + 0x53c: 0x0010, 0x53e: 0x0010, + // Block 0x15, offset 0x540 + 0x540: 0x2713, 0x541: 0x2913, 0x542: 0x2b13, 0x543: 0x2913, 0x544: 0x2f13, 0x545: 0x2913, + 0x546: 0x2b13, 0x547: 0x2913, 0x548: 0x2713, 0x549: 0x3913, 0x54a: 0x3b13, + 0x54c: 0x3f13, 0x54d: 0x3913, 0x54e: 0x3b13, 0x54f: 0x3913, 0x550: 0x2713, 0x551: 0x2913, + 0x552: 0x2b13, 0x554: 0x2f13, 0x555: 0x2913, 0x557: 0xbc52, + 0x558: 0xbf52, 0x559: 0xc252, 0x55a: 0xbf52, 0x55b: 0xc552, 0x55c: 0xbf52, 0x55d: 0xc252, + 0x55e: 0xbf52, 0x55f: 0xbc52, 0x560: 0xc852, 0x561: 0xcb52, 0x563: 0xce52, + 0x564: 0xc852, 0x565: 0xcb52, 0x566: 0xc852, 0x567: 0x2712, 0x568: 0x2912, 0x569: 0x2b12, + 0x56a: 0x2912, 0x56b: 0x2f12, 0x56c: 0x2912, 0x56d: 0x2b12, 0x56e: 0x2912, 0x56f: 0x2712, + 0x570: 0x3912, 0x571: 0x3b12, 0x573: 0x3f12, 0x574: 0x3912, 0x575: 0x3b12, + 0x576: 0x3912, 0x577: 0x2712, 0x578: 0x2912, 0x579: 0x2b12, 0x57b: 0x2f12, + 0x57c: 0x2912, + // Block 0x16, offset 0x580 + 0x580: 0x2213, 0x581: 0x2213, 0x582: 0x2613, 0x583: 0x2613, 0x584: 0x2213, 0x585: 0x2213, + 0x586: 0x2e13, 0x587: 0x2e13, 0x588: 0x2213, 0x589: 0x2213, 0x58a: 0x2613, 0x58b: 0x2613, + 0x58c: 0x2213, 0x58d: 0x2213, 0x58e: 0x3e13, 0x58f: 0x3e13, 0x590: 0x2213, 0x591: 0x2213, + 0x592: 0x2613, 0x593: 0x2613, 0x594: 0x2213, 0x595: 0x2213, 0x596: 0x2e13, 0x597: 0x2e13, + 0x598: 0x2213, 0x599: 0x2213, 0x59a: 0x2613, 0x59b: 0x2613, 0x59c: 0x2213, 0x59d: 0x2213, + 0x59e: 0xd153, 0x59f: 0xd153, 0x5a0: 0xd453, 0x5a1: 0xd453, 0x5a2: 0x2212, 0x5a3: 0x2212, + 0x5a4: 0x2612, 0x5a5: 0x2612, 0x5a6: 0x2212, 0x5a7: 0x2212, 0x5a8: 0x2e12, 0x5a9: 0x2e12, + 0x5aa: 0x2212, 0x5ab: 0x2212, 0x5ac: 0x2612, 0x5ad: 0x2612, 0x5ae: 0x2212, 0x5af: 0x2212, + 0x5b0: 0x3e12, 0x5b1: 0x3e12, 0x5b2: 0x2212, 0x5b3: 0x2212, 0x5b4: 0x2612, 0x5b5: 0x2612, + 0x5b6: 0x2212, 0x5b7: 0x2212, 0x5b8: 0x2e12, 0x5b9: 0x2e12, 0x5ba: 0x2212, 0x5bb: 0x2212, + 0x5bc: 0x2612, 0x5bd: 0x2612, 0x5be: 0x2212, 0x5bf: 0x2212, + // Block 0x17, offset 0x5c0 + 0x5c2: 0x0010, + 0x5c7: 0x0010, 0x5c9: 0x0010, 0x5cb: 0x0010, + 0x5cd: 0x0010, 0x5ce: 0x0010, 0x5cf: 0x0010, 0x5d1: 0x0010, + 0x5d2: 0x0010, 0x5d4: 0x0010, 0x5d7: 0x0010, + 0x5d9: 0x0010, 0x5db: 0x0010, 0x5dd: 0x0010, + 0x5df: 0x0010, 0x5e1: 0x0010, 0x5e2: 0x0010, + 0x5e4: 0x0010, 0x5e7: 0x0010, 0x5e8: 0x0010, 0x5e9: 0x0010, + 0x5ea: 0x0010, 0x5ec: 0x0010, 0x5ed: 0x0010, 0x5ee: 0x0010, 0x5ef: 0x0010, + 0x5f0: 0x0010, 0x5f1: 0x0010, 0x5f2: 0x0010, 0x5f4: 0x0010, 0x5f5: 0x0010, + 0x5f6: 0x0010, 0x5f7: 0x0010, 0x5f9: 0x0010, 0x5fa: 0x0010, 0x5fb: 0x0010, + 0x5fc: 0x0010, 0x5fe: 0x0010, +} + +// caseIndex: 27 blocks, 1728 entries, 3456 bytes +// Block 0 is the zero block. +var caseIndex = [1728]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x16, 0xc3: 0x17, 0xc4: 0x18, 0xc5: 0x19, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x1a, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x1b, 0xcc: 0x1c, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1d, 0xd1: 0x1e, 0xd2: 0x1f, 0xd3: 0x20, 0xd4: 0x21, 0xd5: 0x22, 0xd6: 0x08, 0xd7: 0x23, + 0xd8: 0x24, 0xd9: 0x25, 0xda: 0x26, 0xdb: 0x27, 0xdc: 0x28, 0xdd: 0x29, 0xde: 0x2a, 0xdf: 0x2b, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x16, 0xf3: 0x18, + // Block 0x4, offset 0x100 + 0x120: 0x2c, 0x121: 0x2d, 0x122: 0x2e, 0x123: 0x09, 0x124: 0x2f, 0x125: 0x30, 0x126: 0x31, 0x127: 0x32, + 0x128: 0x33, 0x129: 0x34, 0x12a: 0x35, 0x12b: 0x36, 0x12c: 0x37, 0x12d: 0x38, 0x12e: 0x39, 0x12f: 0x3a, + 0x130: 0x3b, 0x131: 0x3c, 0x132: 0x3d, 0x133: 0x3e, 0x134: 0x3f, 0x135: 0x40, 0x136: 0x41, 0x137: 0x42, + 0x138: 0x43, 0x139: 0x44, 0x13a: 0x45, 0x13b: 0x46, 0x13c: 0x47, 0x13d: 0x48, 0x13e: 0x49, 0x13f: 0x4a, + // Block 0x5, offset 0x140 + 0x140: 0x4b, 0x141: 0x4c, 0x142: 0x4d, 0x143: 0x0a, 0x144: 0x26, 0x145: 0x26, 0x146: 0x26, 0x147: 0x26, + 0x148: 0x26, 0x149: 0x4e, 0x14a: 0x4f, 0x14b: 0x50, 0x14c: 0x51, 0x14d: 0x52, 0x14e: 0x53, 0x14f: 0x54, + 0x150: 0x55, 0x151: 0x26, 0x152: 0x26, 0x153: 0x26, 0x154: 0x26, 0x155: 0x26, 0x156: 0x26, 0x157: 0x26, + 0x158: 0x26, 0x159: 0x56, 0x15a: 0x57, 0x15b: 0x58, 0x15c: 0x59, 0x15d: 0x5a, 0x15e: 0x5b, 0x15f: 0x5c, + 0x160: 0x5d, 0x161: 0x5e, 0x162: 0x5f, 0x163: 0x60, 0x164: 0x61, 0x165: 0x62, 0x167: 0x63, + 0x168: 0x64, 0x169: 0x65, 0x16a: 0x66, 0x16b: 0x67, 0x16c: 0x68, 0x16d: 0x69, 0x16e: 0x6a, 0x16f: 0x6b, + 0x170: 0x6c, 0x171: 0x6d, 0x172: 0x6e, 0x173: 0x6f, 0x174: 0x70, 0x175: 0x71, 0x176: 0x72, 0x177: 0x73, + 0x178: 0x74, 0x179: 0x74, 0x17a: 0x75, 0x17b: 0x74, 0x17c: 0x76, 0x17d: 0x0b, 0x17e: 0x0c, 0x17f: 0x0d, + // Block 0x6, offset 0x180 + 0x180: 0x77, 0x181: 0x78, 0x182: 0x79, 0x183: 0x7a, 0x184: 0x0e, 0x185: 0x7b, 0x186: 0x7c, + 0x192: 0x7d, 0x193: 0x0f, + 0x1b0: 0x7e, 0x1b1: 0x10, 0x1b2: 0x74, 0x1b3: 0x7f, 0x1b4: 0x80, 0x1b5: 0x81, 0x1b6: 0x82, 0x1b7: 0x83, + 0x1b8: 0x84, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x85, 0x1c2: 0x86, 0x1c3: 0x87, 0x1c4: 0x88, 0x1c5: 0x26, 0x1c6: 0x89, + // Block 0x8, offset 0x200 + 0x200: 0x8a, 0x201: 0x26, 0x202: 0x26, 0x203: 0x26, 0x204: 0x26, 0x205: 0x26, 0x206: 0x26, 0x207: 0x26, + 0x208: 0x26, 0x209: 0x26, 0x20a: 0x26, 0x20b: 0x26, 0x20c: 0x26, 0x20d: 0x26, 0x20e: 0x26, 0x20f: 0x26, + 0x210: 0x26, 0x211: 0x26, 0x212: 0x8b, 0x213: 0x8c, 0x214: 0x26, 0x215: 0x26, 0x216: 0x26, 0x217: 0x26, + 0x218: 0x8d, 0x219: 0x8e, 0x21a: 0x8f, 0x21b: 0x90, 0x21c: 0x91, 0x21d: 0x92, 0x21e: 0x11, 0x21f: 0x93, + 0x220: 0x94, 0x221: 0x95, 0x222: 0x26, 0x223: 0x96, 0x224: 0x97, 0x225: 0x98, 0x226: 0x99, 0x227: 0x9a, + 0x228: 0x9b, 0x229: 0x9c, 0x22a: 0x9d, 0x22b: 0x9e, 0x22c: 0x9f, 0x22d: 0xa0, 0x22e: 0xa1, 0x22f: 0xa2, + 0x230: 0x26, 0x231: 0x26, 0x232: 0x26, 0x233: 0x26, 0x234: 0x26, 0x235: 0x26, 0x236: 0x26, 0x237: 0x26, + 0x238: 0x26, 0x239: 0x26, 0x23a: 0x26, 0x23b: 0x26, 0x23c: 0x26, 0x23d: 0x26, 0x23e: 0x26, 0x23f: 0x26, + // Block 0x9, offset 0x240 + 0x240: 0x26, 0x241: 0x26, 0x242: 0x26, 0x243: 0x26, 0x244: 0x26, 0x245: 0x26, 0x246: 0x26, 0x247: 0x26, + 0x248: 0x26, 0x249: 0x26, 0x24a: 0x26, 0x24b: 0x26, 0x24c: 0x26, 0x24d: 0x26, 0x24e: 0x26, 0x24f: 0x26, + 0x250: 0x26, 0x251: 0x26, 0x252: 0x26, 0x253: 0x26, 0x254: 0x26, 0x255: 0x26, 0x256: 0x26, 0x257: 0x26, + 0x258: 0x26, 0x259: 0x26, 0x25a: 0x26, 0x25b: 0x26, 0x25c: 0x26, 0x25d: 0x26, 0x25e: 0x26, 0x25f: 0x26, + 0x260: 0x26, 0x261: 0x26, 0x262: 0x26, 0x263: 0x26, 0x264: 0x26, 0x265: 0x26, 0x266: 0x26, 0x267: 0x26, + 0x268: 0x26, 0x269: 0x26, 0x26a: 0x26, 0x26b: 0x26, 0x26c: 0x26, 0x26d: 0x26, 0x26e: 0x26, 0x26f: 0x26, + 0x270: 0x26, 0x271: 0x26, 0x272: 0x26, 0x273: 0x26, 0x274: 0x26, 0x275: 0x26, 0x276: 0x26, 0x277: 0x26, + 0x278: 0x26, 0x279: 0x26, 0x27a: 0x26, 0x27b: 0x26, 0x27c: 0x26, 0x27d: 0x26, 0x27e: 0x26, 0x27f: 0x26, + // Block 0xa, offset 0x280 + 0x280: 0x26, 0x281: 0x26, 0x282: 0x26, 0x283: 0x26, 0x284: 0x26, 0x285: 0x26, 0x286: 0x26, 0x287: 0x26, + 0x288: 0x26, 0x289: 0x26, 0x28a: 0x26, 0x28b: 0x26, 0x28c: 0x26, 0x28d: 0x26, 0x28e: 0x26, 0x28f: 0x26, + 0x290: 0x26, 0x291: 0x26, 0x292: 0x26, 0x293: 0x26, 0x294: 0x26, 0x295: 0x26, 0x296: 0x26, 0x297: 0x26, + 0x298: 0x26, 0x299: 0x26, 0x29a: 0x26, 0x29b: 0x26, 0x29c: 0x26, 0x29d: 0x26, 0x29e: 0xa3, 0x29f: 0xa4, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x12, 0x2ed: 0xa5, 0x2ee: 0xa6, 0x2ef: 0xa7, + 0x2f0: 0x26, 0x2f1: 0x26, 0x2f2: 0x26, 0x2f3: 0x26, 0x2f4: 0xa8, 0x2f5: 0xa9, 0x2f6: 0xaa, 0x2f7: 0xab, + 0x2f8: 0xac, 0x2f9: 0xad, 0x2fa: 0x26, 0x2fb: 0xae, 0x2fc: 0xaf, 0x2fd: 0xb0, 0x2fe: 0xb1, 0x2ff: 0xb2, + // Block 0xc, offset 0x300 + 0x300: 0xb3, 0x301: 0xb4, 0x302: 0x26, 0x303: 0xb5, 0x305: 0xb6, 0x307: 0xb7, + 0x30a: 0xb8, 0x30b: 0xb9, 0x30c: 0xba, 0x30d: 0xbb, 0x30e: 0xbc, 0x30f: 0xbd, + 0x310: 0xbe, 0x311: 0xbf, 0x312: 0xc0, 0x313: 0xc1, 0x314: 0xc2, 0x315: 0xc3, 0x316: 0x13, + 0x318: 0x26, 0x319: 0x26, 0x31a: 0x26, 0x31b: 0x26, 0x31c: 0xc4, 0x31d: 0xc5, 0x31e: 0xc6, + 0x320: 0xc7, 0x321: 0xc8, 0x322: 0xc9, 0x323: 0xca, 0x324: 0xcb, 0x326: 0xcc, + 0x328: 0xcd, 0x329: 0xce, 0x32a: 0xcf, 0x32b: 0xd0, 0x32c: 0x60, 0x32d: 0xd1, 0x32e: 0xd2, + 0x330: 0x26, 0x331: 0xd3, 0x332: 0xd4, 0x333: 0xd5, 0x334: 0xd6, + 0x33a: 0xd7, 0x33b: 0xd8, 0x33c: 0xd9, 0x33d: 0xda, 0x33e: 0xdb, 0x33f: 0xdc, + // Block 0xd, offset 0x340 + 0x340: 0xdd, 0x341: 0xde, 0x342: 0xdf, 0x343: 0xe0, 0x344: 0xe1, 0x345: 0xe2, 0x346: 0xe3, 0x347: 0xe4, + 0x348: 0xe5, 0x349: 0xe6, 0x34a: 0xe7, 0x34b: 0xe8, 0x34c: 0xe9, 0x34d: 0xea, + 0x350: 0xeb, 0x351: 0xec, 0x352: 0xed, 0x353: 0xee, 0x356: 0xef, 0x357: 0xf0, + 0x358: 0xf1, 0x359: 0xf2, 0x35a: 0xf3, 0x35b: 0xf4, 0x35c: 0xf5, + 0x360: 0xf6, 0x362: 0xf7, 0x363: 0xf8, 0x364: 0xf9, 0x365: 0xfa, 0x366: 0xfb, 0x367: 0xfc, + 0x368: 0xfd, 0x369: 0xfe, 0x36a: 0xff, 0x36b: 0x100, + 0x370: 0x101, 0x371: 0x102, 0x372: 0x103, 0x374: 0x104, 0x375: 0x105, 0x376: 0x106, + 0x37b: 0x107, 0x37c: 0x108, 0x37d: 0x109, 0x37e: 0x10a, + // Block 0xe, offset 0x380 + 0x380: 0x26, 0x381: 0x26, 0x382: 0x26, 0x383: 0x26, 0x384: 0x26, 0x385: 0x26, 0x386: 0x26, 0x387: 0x26, + 0x388: 0x26, 0x389: 0x26, 0x38a: 0x26, 0x38b: 0x26, 0x38c: 0x26, 0x38d: 0x26, 0x38e: 0x10b, + 0x390: 0x26, 0x391: 0x10c, 0x392: 0x26, 0x393: 0x26, 0x394: 0x26, 0x395: 0x10d, + 0x3be: 0xa9, 0x3bf: 0x10e, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x26, 0x3c1: 0x26, 0x3c2: 0x26, 0x3c3: 0x26, 0x3c4: 0x26, 0x3c5: 0x26, 0x3c6: 0x26, 0x3c7: 0x26, + 0x3c8: 0x26, 0x3c9: 0x26, 0x3ca: 0x26, 0x3cb: 0x26, 0x3cc: 0x26, 0x3cd: 0x26, 0x3ce: 0x26, 0x3cf: 0x26, + 0x3d0: 0x10f, 0x3d1: 0x110, + // Block 0x10, offset 0x400 + 0x410: 0x26, 0x411: 0x26, 0x412: 0x26, 0x413: 0x26, 0x414: 0x26, 0x415: 0x26, 0x416: 0x26, 0x417: 0x26, + 0x418: 0x26, 0x419: 0x111, + // Block 0x11, offset 0x440 + 0x460: 0x26, 0x461: 0x26, 0x462: 0x26, 0x463: 0x26, 0x464: 0x26, 0x465: 0x26, 0x466: 0x26, 0x467: 0x26, + 0x468: 0x100, 0x469: 0x112, 0x46a: 0x113, 0x46b: 0x114, 0x46c: 0x115, 0x46d: 0x116, 0x46e: 0x117, + 0x479: 0x118, 0x47c: 0x26, 0x47d: 0x119, 0x47e: 0x11a, 0x47f: 0x11b, + // Block 0x12, offset 0x480 + 0x4bf: 0x11c, + // Block 0x13, offset 0x4c0 + 0x4f0: 0x26, 0x4f1: 0x11d, 0x4f2: 0x11e, + // Block 0x14, offset 0x500 + 0x53c: 0x11f, 0x53d: 0x120, + // Block 0x15, offset 0x540 + 0x545: 0x121, 0x546: 0x122, + 0x549: 0x123, + 0x550: 0x124, 0x551: 0x125, 0x552: 0x126, 0x553: 0x127, 0x554: 0x128, 0x555: 0x129, 0x556: 0x12a, 0x557: 0x12b, + 0x558: 0x12c, 0x559: 0x12d, 0x55a: 0x12e, 0x55b: 0x12f, 0x55c: 0x130, 0x55d: 0x131, 0x55e: 0x132, 0x55f: 0x133, + 0x568: 0x134, 0x569: 0x135, 0x56a: 0x136, + 0x57c: 0x137, + // Block 0x16, offset 0x580 + 0x580: 0x138, 0x581: 0x139, 0x582: 0x13a, 0x584: 0x13b, 0x585: 0x13c, + 0x58a: 0x13d, 0x58b: 0x13e, + 0x593: 0x13f, + 0x59f: 0x140, + 0x5a0: 0x26, 0x5a1: 0x26, 0x5a2: 0x26, 0x5a3: 0x141, 0x5a4: 0x14, 0x5a5: 0x142, + 0x5b8: 0x143, 0x5b9: 0x15, 0x5ba: 0x144, + // Block 0x17, offset 0x5c0 + 0x5c4: 0x145, 0x5c5: 0x146, 0x5c6: 0x147, + 0x5cf: 0x148, + 0x5ef: 0x149, + // Block 0x18, offset 0x600 + 0x610: 0x0a, 0x611: 0x0b, 0x612: 0x0c, 0x613: 0x0d, 0x614: 0x0e, 0x616: 0x0f, + 0x61a: 0x10, 0x61b: 0x11, 0x61c: 0x12, 0x61d: 0x13, 0x61e: 0x14, 0x61f: 0x15, + // Block 0x19, offset 0x640 + 0x640: 0x14a, 0x641: 0x14b, 0x644: 0x14b, 0x645: 0x14b, 0x646: 0x14b, 0x647: 0x14c, + // Block 0x1a, offset 0x680 + 0x6a0: 0x17, +} + +// sparseOffsets: 312 entries, 624 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x34, 0x37, 0x3b, 0x3e, 0x42, 0x4c, 0x4e, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xaf, 0xb7, 0xbd, 0xcb, 0xd6, 0xe3, 0xee, 0xfa, 0x104, 0x110, 0x11b, 0x127, 0x133, 0x13b, 0x145, 0x150, 0x15b, 0x167, 0x16d, 0x178, 0x17e, 0x186, 0x189, 0x18e, 0x192, 0x196, 0x19d, 0x1a6, 0x1ae, 0x1af, 0x1b8, 0x1bf, 0x1c7, 0x1cd, 0x1d2, 0x1d6, 0x1d9, 0x1db, 0x1de, 0x1e3, 0x1e4, 0x1e6, 0x1e8, 0x1ea, 0x1f1, 0x1f6, 0x1fa, 0x203, 0x206, 0x209, 0x20f, 0x210, 0x21b, 0x21c, 0x21d, 0x222, 0x22f, 0x238, 0x23e, 0x246, 0x24f, 0x258, 0x261, 0x266, 0x269, 0x274, 0x282, 0x284, 0x28b, 0x28f, 0x29b, 0x29c, 0x2a7, 0x2af, 0x2b7, 0x2bd, 0x2be, 0x2cc, 0x2d1, 0x2d4, 0x2d9, 0x2dd, 0x2e3, 0x2e8, 0x2eb, 0x2f0, 0x2f5, 0x2f6, 0x2fc, 0x2fe, 0x2ff, 0x301, 0x303, 0x306, 0x307, 0x309, 0x30c, 0x312, 0x316, 0x318, 0x31d, 0x324, 0x334, 0x33e, 0x33f, 0x348, 0x34c, 0x351, 0x359, 0x35f, 0x365, 0x36f, 0x374, 0x37d, 0x383, 0x38c, 0x390, 0x398, 0x39a, 0x39c, 0x39f, 0x3a1, 0x3a3, 0x3a4, 0x3a5, 0x3a7, 0x3a9, 0x3af, 0x3b4, 0x3b6, 0x3bd, 0x3c0, 0x3c2, 0x3c8, 0x3cd, 0x3cf, 0x3d0, 0x3d1, 0x3d2, 0x3d4, 0x3d6, 0x3d8, 0x3db, 0x3dd, 0x3e0, 0x3e8, 0x3eb, 0x3ef, 0x3f7, 0x3f9, 0x409, 0x40a, 0x40c, 0x411, 0x417, 0x419, 0x41a, 0x41c, 0x41e, 0x420, 0x42d, 0x42e, 0x42f, 0x433, 0x435, 0x436, 0x437, 0x438, 0x439, 0x43c, 0x43f, 0x440, 0x443, 0x44a, 0x450, 0x452, 0x456, 0x45e, 0x464, 0x468, 0x46f, 0x473, 0x477, 0x480, 0x48a, 0x48c, 0x492, 0x498, 0x4a2, 0x4ac, 0x4ae, 0x4b7, 0x4bd, 0x4c3, 0x4c9, 0x4cc, 0x4d2, 0x4d5, 0x4de, 0x4df, 0x4e6, 0x4ea, 0x4eb, 0x4ee, 0x4f8, 0x4fb, 0x4fd, 0x504, 0x50c, 0x512, 0x519, 0x51a, 0x520, 0x523, 0x52b, 0x532, 0x53c, 0x544, 0x547, 0x54c, 0x550, 0x551, 0x552, 0x553, 0x554, 0x555, 0x557, 0x55a, 0x55b, 0x55e, 0x55f, 0x562, 0x564, 0x568, 0x569, 0x56b, 0x56e, 0x570, 0x573, 0x576, 0x578, 0x57d, 0x57f, 0x580, 0x585, 0x589, 0x58a, 0x58d, 0x591, 0x59c, 0x5a0, 0x5a8, 0x5ad, 0x5b1, 0x5b4, 0x5b8, 0x5bb, 0x5be, 0x5c3, 0x5c7, 0x5cb, 0x5cf, 0x5d3, 0x5d5, 0x5d7, 0x5da, 0x5de, 0x5e4, 0x5e5, 0x5e6, 0x5e9, 0x5eb, 0x5ed, 0x5f0, 0x5f5, 0x5f9, 0x5fb, 0x601, 0x60a, 0x60f, 0x610, 0x613, 0x614, 0x615, 0x616, 0x618, 0x619, 0x61a} + +// sparseValues: 1562 entries, 6248 bytes +var sparseValues = [1562]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xbf}, + // Block 0x6, offset 0x34 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x37 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3b + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3e + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x42 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4c + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4e + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0054, lo: 0x9f, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x18, offset 0xaf + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0004, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0024, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0024, lo: 0x9c, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x19, offset 0xb7 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1a, offset 0xbd + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1b, offset 0xcb + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1c, offset 0xd6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1d, offset 0xe3 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1e, offset 0xee + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x1f, offset 0xfa + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x20, offset 0x104 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x21, offset 0x110 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x22, offset 0x11b + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x23, offset 0x127 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x24, offset 0x133 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x26, offset 0x145 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x27, offset 0x150 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x28, offset 0x15b + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9d, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb3}, + // Block 0x29, offset 0x167 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2a, offset 0x16d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2b, offset 0x178 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2c, offset 0x17e + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2d, offset 0x186 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2e, offset 0x189 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x2f, offset 0x18e + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x30, offset 0x192 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x31, offset 0x196 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x32, offset 0x19d + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x33, offset 0x1a6 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x34, offset 0x1ae + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x35, offset 0x1af + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x36, offset 0x1b8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x37, offset 0x1bf + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x38, offset 0x1c7 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3a, offset 0x1d2 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3b, offset 0x1d6 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1d9 + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3d, offset 0x1db + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3e, offset 0x1de + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x3f, offset 0x1e3 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x40, offset 0x1e4 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x41, offset 0x1e6 + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x42, offset 0x1e8 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x43, offset 0x1ea + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0030, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x9f, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0030, lo: 0xb4, hi: 0xb4}, + // Block 0x44, offset 0x1f1 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x45, offset 0x1f6 + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x46, offset 0x1fa + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x47, offset 0x203 + {value: 0x0014, lo: 0x8b, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x48, offset 0x206 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x49, offset 0x209 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4a, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4b, offset 0x210 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4c, offset 0x21b + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4d, offset 0x21c + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4e, offset 0x21d + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x4f, offset 0x222 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x50, offset 0x22f + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x238 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0024, lo: 0x81, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8e}, + // Block 0x52, offset 0x23e + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x53, offset 0x246 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x54, offset 0x24f + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x55, offset 0x258 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x56, offset 0x261 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x57, offset 0x266 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x58, offset 0x269 + {value: 0x31ea, lo: 0x80, hi: 0x80}, + {value: 0x326a, lo: 0x81, hi: 0x81}, + {value: 0x32ea, lo: 0x82, hi: 0x82}, + {value: 0x336a, lo: 0x83, hi: 0x83}, + {value: 0x33ea, lo: 0x84, hi: 0x84}, + {value: 0x346a, lo: 0x85, hi: 0x85}, + {value: 0x34ea, lo: 0x86, hi: 0x86}, + {value: 0x356a, lo: 0x87, hi: 0x87}, + {value: 0x35ea, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x59, offset 0x274 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xba}, + // Block 0x5a, offset 0x282 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5b, offset 0x284 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5c, offset 0x28b + {value: 0x0012, lo: 0x80, hi: 0x8d}, + {value: 0x8f52, lo: 0x8e, hi: 0x8e}, + {value: 0x0012, lo: 0x8f, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5d, offset 0x28f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5e, offset 0x29b + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x29c + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x369a, lo: 0x96, hi: 0x96}, + {value: 0x374a, lo: 0x97, hi: 0x97}, + {value: 0x37fa, lo: 0x98, hi: 0x98}, + {value: 0x38aa, lo: 0x99, hi: 0x99}, + {value: 0x395a, lo: 0x9a, hi: 0x9a}, + {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3abb, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x60, offset 0x2a7 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x61, offset 0x2af + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x62, offset 0x2b7 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2bd + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x64, offset 0x2be + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x65, offset 0x2cc + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa452, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x2d1 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x67, offset 0x2d4 + {value: 0xa753, lo: 0xb6, hi: 0xb7}, + {value: 0xaa53, lo: 0xb8, hi: 0xb9}, + {value: 0xad53, lo: 0xba, hi: 0xbb}, + {value: 0xaa53, lo: 0xbc, hi: 0xbd}, + {value: 0xa753, lo: 0xbe, hi: 0xbf}, + // Block 0x68, offset 0x2d9 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xb053, lo: 0xa0, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x69, offset 0x2dd + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6a, offset 0x2e3 + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e8 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6c, offset 0x2eb + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6d, offset 0x2f0 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6e, offset 0x2f5 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x6f, offset 0x2f6 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x70, offset 0x2fc + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x71, offset 0x2fe + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x72, offset 0x2ff + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x73, offset 0x301 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x74, offset 0x303 + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x75, offset 0x306 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x76, offset 0x307 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x77, offset 0x309 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x78, offset 0x30c + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x79, offset 0x312 + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7a, offset 0x316 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7b, offset 0x318 + {value: 0x0004, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7c, offset 0x31d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7d, offset 0x324 + {value: 0x0117, lo: 0x80, hi: 0x83}, + {value: 0x6553, lo: 0x84, hi: 0x84}, + {value: 0x908b, lo: 0x85, hi: 0x85}, + {value: 0x8f53, lo: 0x86, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0117, lo: 0x90, hi: 0x91}, + {value: 0x0012, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x95, hi: 0x95}, + {value: 0x0117, lo: 0x96, hi: 0x99}, + {value: 0x0015, lo: 0xb2, hi: 0xb4}, + {value: 0x0316, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7e, offset 0x334 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + // Block 0x7f, offset 0x33e + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x80, offset 0x33f + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x81, offset 0x348 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x82, offset 0x34c + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x83, offset 0x351 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x84, offset 0x359 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x85, offset 0x35f + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x86, offset 0x365 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x87, offset 0x36f + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x374 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x89, offset 0x37d + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8a, offset 0x383 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xb352, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa8}, + {value: 0x0015, lo: 0xa9, hi: 0xa9}, + {value: 0x0004, lo: 0xaa, hi: 0xab}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x38c + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x390 + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8d, offset 0x398 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x39a + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x8f, offset 0x39c + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x90, offset 0x39f + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x91, offset 0x3a1 + {value: 0x0004, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x92, offset 0x3a3 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x93, offset 0x3a4 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x94, offset 0x3a5 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x95, offset 0x3a7 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x96, offset 0x3a9 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x97, offset 0x3af + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x98, offset 0x3b4 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x3b6 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3bd + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9b, offset 0x3c0 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9c, offset 0x3c2 + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9d, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x3cd + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0x9f, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa0, offset 0x3d0 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa1, offset 0x3d1 + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa2, offset 0x3d2 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa3, offset 0x3d4 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa4, offset 0x3d6 + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa5, offset 0x3d8 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa6, offset 0x3db + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa7, offset 0x3dd + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa8, offset 0x3e0 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb653, lo: 0x98, hi: 0x9f}, + {value: 0xb953, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xa9, offset 0x3e8 + {value: 0xb652, lo: 0x80, hi: 0x87}, + {value: 0xb952, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xaa, offset 0x3eb + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb953, lo: 0xb0, hi: 0xb7}, + {value: 0xb653, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3ef + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb952, lo: 0x98, hi: 0x9f}, + {value: 0xb652, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xac, offset 0x3f7 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xad, offset 0x3f9 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0xbc53, lo: 0xb0, hi: 0xb0}, + {value: 0xbf53, lo: 0xb1, hi: 0xb1}, + {value: 0xc253, lo: 0xb2, hi: 0xb2}, + {value: 0xbf53, lo: 0xb3, hi: 0xb3}, + {value: 0xc553, lo: 0xb4, hi: 0xb4}, + {value: 0xbf53, lo: 0xb5, hi: 0xb5}, + {value: 0xc253, lo: 0xb6, hi: 0xb6}, + {value: 0xbf53, lo: 0xb7, hi: 0xb7}, + {value: 0xbc53, lo: 0xb8, hi: 0xb8}, + {value: 0xc853, lo: 0xb9, hi: 0xb9}, + {value: 0xcb53, lo: 0xba, hi: 0xba}, + {value: 0xce53, lo: 0xbc, hi: 0xbc}, + {value: 0xc853, lo: 0xbd, hi: 0xbd}, + {value: 0xcb53, lo: 0xbe, hi: 0xbe}, + {value: 0xc853, lo: 0xbf, hi: 0xbf}, + // Block 0xae, offset 0x409 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xaf, offset 0x40a + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb0, offset 0x40c + {value: 0x0015, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0015, lo: 0x83, hi: 0x85}, + {value: 0x0015, lo: 0x87, hi: 0xb0}, + {value: 0x0015, lo: 0xb2, hi: 0xba}, + // Block 0xb1, offset 0x411 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb2, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb3, offset 0x419 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb4, offset 0x41a + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb5, offset 0x41c + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb6, offset 0x41e + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb7, offset 0x420 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb8, offset 0x42d + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb9, offset 0x42e + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xba, offset 0x42f + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbb, offset 0x433 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbc, offset 0x435 + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbd, offset 0x436 + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbe, offset 0x437 + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x438 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x439 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc1, offset 0x43c + {value: 0x0010, lo: 0x80, hi: 0xa9}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + // Block 0xc2, offset 0x43f + {value: 0x0034, lo: 0xbd, hi: 0xbf}, + // Block 0xc3, offset 0x440 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc4, offset 0x443 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc5, offset 0x44a + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc6, offset 0x450 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xc7, offset 0x452 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc8, offset 0x456 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc9, offset 0x45e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xca, offset 0x464 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcb, offset 0x468 + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xcc, offset 0x46f + {value: 0x0010, lo: 0x84, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xcd, offset 0x473 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xce, offset 0x477 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xcf, offset 0x480 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xd0, offset 0x48a + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + // Block 0xd1, offset 0x48c + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xd2, offset 0x492 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd3, offset 0x498 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xd4, offset 0x4a2 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xd5, offset 0x4ac + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd6, offset 0x4ae + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + // Block 0xd7, offset 0x4b7 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd8, offset 0x4bd + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd9, offset 0x4c3 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xda, offset 0x4c9 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xdb, offset 0x4cc + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xdc, offset 0x4d2 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xdd, offset 0x4d5 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + // Block 0xde, offset 0x4de + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xdf, offset 0x4df + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xe0, offset 0x4e6 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xe1, offset 0x4ea + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xe2, offset 0x4eb + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe3, offset 0x4ee + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8c, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + {value: 0x0030, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe4, offset 0x4f8 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xe5, offset 0x4fb + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe6, offset 0x4fd + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0014, lo: 0x94, hi: 0x97}, + {value: 0x0014, lo: 0x9a, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0x9f}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + // Block 0xe7, offset 0x504 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xe8, offset 0x50c + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xe9, offset 0x512 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xea, offset 0x519 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xeb, offset 0x51a + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xec, offset 0x520 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xed, offset 0x523 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xee, offset 0x52b + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xef, offset 0x532 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xf0, offset 0x53c + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xf1, offset 0x544 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xf2, offset 0x547 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xf3, offset 0x54c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0030, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xf4, offset 0x550 + {value: 0x0010, lo: 0xb0, hi: 0xb0}, + // Block 0xf5, offset 0x551 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xf6, offset 0x552 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xf7, offset 0x553 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xf8, offset 0x554 + {value: 0x0010, lo: 0x80, hi: 0xb0}, + // Block 0xf9, offset 0x555 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xbf}, + // Block 0xfa, offset 0x557 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x95}, + // Block 0xfb, offset 0x55a + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xfc, offset 0x55b + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xfd, offset 0x55e + {value: 0x0010, lo: 0x80, hi: 0xbe}, + // Block 0xfe, offset 0x55f + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xff, offset 0x562 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0x100, offset 0x564 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x101, offset 0x568 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0x102, offset 0x569 + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0x103, offset 0x56b + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x104, offset 0x56e + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0x105, offset 0x570 + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa3, hi: 0xa4}, + {value: 0x0030, lo: 0xb0, hi: 0xb1}, + // Block 0x106, offset 0x573 + {value: 0x0004, lo: 0xb0, hi: 0xb3}, + {value: 0x0004, lo: 0xb5, hi: 0xbb}, + {value: 0x0004, lo: 0xbd, hi: 0xbe}, + // Block 0x107, offset 0x576 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0x108, offset 0x578 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0x109, offset 0x57d + {value: 0x0014, lo: 0x80, hi: 0xad}, + {value: 0x0014, lo: 0xb0, hi: 0xbf}, + // Block 0x10a, offset 0x57f + {value: 0x0014, lo: 0x80, hi: 0x86}, + // Block 0x10b, offset 0x580 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0x10c, offset 0x585 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0x10d, offset 0x589 + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0x10e, offset 0x58a + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0x10f, offset 0x58d + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x110, offset 0x591 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0x111, offset 0x59c + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x112, offset 0x5a0 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0x113, offset 0x5a8 + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x114, offset 0x5ad + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x115, offset 0x5b1 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x116, offset 0x5b4 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x117, offset 0x5b8 + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x118, offset 0x5bb + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x119, offset 0x5be + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x11a, offset 0x5c3 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x11b, offset 0x5c7 + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x11c, offset 0x5cb + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x11d, offset 0x5cf + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x11e, offset 0x5d3 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x11f, offset 0x5d5 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x120, offset 0x5d7 + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x121, offset 0x5da + {value: 0x0012, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8a, hi: 0x8a}, + {value: 0x0012, lo: 0x8b, hi: 0x9e}, + {value: 0x0012, lo: 0xa5, hi: 0xaa}, + // Block 0x122, offset 0x5de + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + {value: 0x0015, lo: 0xb0, hi: 0xbf}, + // Block 0x123, offset 0x5e4 + {value: 0x0015, lo: 0x80, hi: 0xad}, + // Block 0x124, offset 0x5e5 + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + // Block 0x125, offset 0x5e6 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + // Block 0x126, offset 0x5e9 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + // Block 0x127, offset 0x5eb + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xae}, + // Block 0x128, offset 0x5ed + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0024, lo: 0xac, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x129, offset 0x5f0 + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x12a, offset 0x5f5 + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xab}, + {value: 0x0010, lo: 0xad, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xbe}, + // Block 0x12b, offset 0x5f9 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x12c, offset 0x5fb + {value: 0xd152, lo: 0x80, hi: 0x81}, + {value: 0xd452, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x12d, offset 0x601 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x12e, offset 0x60a + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x12f, offset 0x60f + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x130, offset 0x610 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x131, offset 0x613 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x132, offset 0x614 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x133, offset 0x615 + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x134, offset 0x616 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x135, offset 0x618 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x136, offset 0x619 + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 16093 bytes (15KiB); checksum: EE91C452 diff --git a/vendor/golang.org/x/text/cases/trieval.go b/vendor/golang.org/x/text/cases/trieval.go index 99e0396..4e4d13f 100644 --- a/vendor/golang.org/x/text/cases/trieval.go +++ b/vendor/golang.org/x/text/cases/trieval.go @@ -14,19 +14,19 @@ package cases // // The per-rune values have the following format: // -// if (exception) { -// 15..4 unsigned exception index -// } else { -// 15..8 XOR pattern or index to XOR pattern for case mapping -// Only 13..8 are used for XOR patterns. -// 7 inverseFold (fold to upper, not to lower) -// 6 index: interpret the XOR pattern as an index -// or isMid if case mode is cIgnorableUncased. -// 5..4 CCC: zero (normal or break), above or other -// } -// 3 exception: interpret this value as an exception index -// (TODO: is this bit necessary? Probably implied from case mode.) -// 2..0 case mode +// if (exception) { +// 15..4 unsigned exception index +// } else { +// 15..8 XOR pattern or index to XOR pattern for case mapping +// Only 13..8 are used for XOR patterns. +// 7 inverseFold (fold to upper, not to lower) +// 6 index: interpret the XOR pattern as an index +// or isMid if case mode is cIgnorableUncased. +// 5..4 CCC: zero (normal or break), above or other +// } +// 3 exception: interpret this value as an exception index +// (TODO: is this bit necessary? Probably implied from case mode.) +// 2..0 case mode // // For the non-exceptional cases, a rune must be either uncased, lowercase or // uppercase. If the rune is cased, the XOR pattern maps either a lowercase @@ -128,37 +128,40 @@ const ( // The entry is pointed to by the exception index in an entry. It has the // following format: // -// Header -// byte 0: -// 7..6 unused -// 5..4 CCC type (same bits as entry) -// 3 unused -// 2..0 length of fold +// Header: // -// byte 1: -// 7..6 unused -// 5..3 length of 1st mapping of case type -// 2..0 length of 2nd mapping of case type +// byte 0: +// 7..6 unused +// 5..4 CCC type (same bits as entry) +// 3 unused +// 2..0 length of fold // -// case 1st 2nd -// lower -> upper, title -// upper -> lower, title -// title -> lower, upper +// byte 1: +// 7..6 unused +// 5..3 length of 1st mapping of case type +// 2..0 length of 2nd mapping of case type +// +// case 1st 2nd +// lower -> upper, title +// upper -> lower, title +// title -> lower, upper // // Lengths with the value 0x7 indicate no value and implies no change. // A length of 0 indicates a mapping to zero-length string. // // Body bytes: -// case folding bytes -// lowercase mapping bytes -// uppercase mapping bytes -// titlecase mapping bytes -// closure mapping bytes (for NFKC_Casefold). (TODO) +// +// case folding bytes +// lowercase mapping bytes +// uppercase mapping bytes +// titlecase mapping bytes +// closure mapping bytes (for NFKC_Casefold). (TODO) // // Fallbacks: -// missing fold -> lower -// missing title -> upper -// all missing -> original rune +// +// missing fold -> lower +// missing title -> upper +// all missing -> original rune // // exceptions starts with a dummy byte to enforce that there is no zero index // value. diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go index 83816a7..8c1b666 100644 --- a/vendor/golang.org/x/text/internal/language/compact/language.go +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -118,7 +118,7 @@ func (t Tag) Parent() Tag { return Tag{language: lang, locale: lang} } -// returns token t and the rest of the string. +// nextToken returns token t and the rest of the string. func nextToken(s string) (t, tail string) { p := strings.Index(s[1:], "-") if p == -1 { diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index fe7ad9e..a09ed19 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e3000, 0x408e30ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4beeb000, 0x4beeb0b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: BE816D44 +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go index 6105bc7..09d41c7 100644 --- a/vendor/golang.org/x/text/internal/language/language.go +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -409,7 +409,7 @@ func (t Tag) SetTypeForKey(key, value string) (Tag, error) { return t, nil } -// findKeyAndType returns the start and end position for the type corresponding +// findTypeForKey returns the start and end position for the type corresponding // to key or the point at which to insert the key-value pair if the type // wasn't found. The hasExt return value reports whether an -u extension was present. // Note: the extensions are typically very small and are likely to contain diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go index 6294b81..231b4fb 100644 --- a/vendor/golang.org/x/text/internal/language/lookup.go +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -50,7 +50,7 @@ func (id Language) Canonicalize() (Language, AliasType) { return normLang(id) } -// mapLang returns the mapped langID of id according to mapping m. +// normLang returns the mapped langID of id according to mapping m. func normLang(id Language) (Language, AliasType) { k := sort.Search(len(AliasMap), func(i int) bool { return AliasMap[i].From >= uint16(id) @@ -328,7 +328,7 @@ func (r Region) IsPrivateUse() bool { return r.typ()&iso3166UserAssigned != 0 } -type Script uint8 +type Script uint16 // getScriptID returns the script id for string s. It assumes that s // is of the format [A-Z][a-z]{3}. diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go index 47ee0fe..aad1e0a 100644 --- a/vendor/golang.org/x/text/internal/language/parse.go +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -270,7 +270,7 @@ func parse(scan *scanner, s string) (t Tag, err error) { } else if n >= 4 { return Und, ErrSyntax } else { // the usual case - t, end = parseTag(scan) + t, end = parseTag(scan, true) if n := len(scan.token); n == 1 { t.pExt = uint16(end) end = parseExtensions(scan) @@ -296,7 +296,8 @@ func parse(scan *scanner, s string) (t Tag, err error) { // parseTag parses language, script, region and variants. // It returns a Tag and the end position in the input that was parsed. -func parseTag(scan *scanner) (t Tag, end int) { +// If doNorm is true, then - will be normalized to . +func parseTag(scan *scanner, doNorm bool) (t Tag, end int) { var e error // TODO: set an error if an unknown lang, script or region is encountered. t.LangID, e = getLangID(scan.token) @@ -307,14 +308,17 @@ func parseTag(scan *scanner) (t Tag, end int) { for len(scan.token) == 3 && isAlpha(scan.token[0]) { // From http://tools.ietf.org/html/bcp47, - tags are equivalent // to a tag of the form . - lang, e := getLangID(scan.token) - if lang != 0 { - t.LangID = lang - copy(scan.b[langStart:], lang.String()) - scan.b[langStart+3] = '-' - scan.start = langStart + 4 + if doNorm { + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + langStr := lang.String() + copy(scan.b[langStart:], langStr) + scan.b[langStart+len(langStr)] = '-' + scan.start = langStart + len(langStr) + 1 + } + scan.gobble(e) } - scan.gobble(e) end = scan.scan() } if len(scan.token) == 4 && isAlpha(scan.token[0]) { @@ -559,7 +563,7 @@ func parseExtension(scan *scanner) int { case 't': // https://www.ietf.org/rfc/rfc6497.txt scan.scan() if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { - _, end = parseTag(scan) + _, end = parseTag(scan, false) scan.toLower(start, end) } for len(scan.token) == 2 && !isAlpha(scan.token[1]) { diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index a19480c..14167e7 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8717 +const NumLanguages = 8798 -const NumScripts = 251 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -121,9 +121,10 @@ const langPrivateEnd = 0x3179 // lang holds an alphabetically sorted list of ISO-639 language identifiers. // All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. // For 2-byte language identifiers, the two successive bytes have the following meaning: -// - if the first letter of the 2- and 3-letter ISO codes are the same: -// the second and third letter of the 3-letter ISO code. -// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// // For 3-byte language identifiers the 4th byte is 0. const lang tag.Index = "" + // Size: 5324 bytes "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + @@ -262,10 +263,10 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, - 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, // Entry 40 - 7F 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, @@ -277,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -288,34 +289,34 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x73, 0x35, - 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, + 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, - 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c, 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, - 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, + 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, + 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -333,20 +334,20 @@ var langNoIndex = [2197]uint8{ // Entry 200 - 23F 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf, - 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x01, 0xe3, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, + 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x78, 0x02, 0x05, 0x84, 0x00, 0xf0, + 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0, 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x11, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, // Entry 280 - 2BF 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, @@ -358,19 +359,19 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, - 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, - 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, + 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0, 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, @@ -391,15 +392,15 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, - 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x00, 0x00, 0x10, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, + 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, // Entry 400 - 43F @@ -421,26 +422,26 @@ var langNoIndex = [2197]uint8{ 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, // Entry 480 - 4BF - 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, + 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, - 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF - 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, + 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7, 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -448,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -463,14 +464,14 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, @@ -479,9 +480,9 @@ var langNoIndex = [2197]uint8{ 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, - 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f, 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, - 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, + 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18, 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, // Entry 640 - 67F 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, @@ -490,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -512,8 +513,8 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, - 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, + 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, @@ -521,46 +522,46 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, - 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03, 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF - 0xdd, 0xbf, 0x72, 0x1d, 0xc7, 0x0c, 0xd5, 0x42, + 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42, 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, - 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x12, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -582,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 704 bytes, 176 elements -var AliasMap = [176]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -598,219 +599,239 @@ var AliasMap = [176]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8c3, To: 0xee3}, - 29: {From: 0x9ef, To: 0x331}, - 30: {From: 0xa36, To: 0x2c5}, - 31: {From: 0xa3d, To: 0xbf}, - 32: {From: 0xabe, To: 0x3322}, - 33: {From: 0xb38, To: 0x529}, - 34: {From: 0xb75, To: 0x265a}, - 35: {From: 0xb7e, To: 0xbc3}, - 36: {From: 0xb9b, To: 0x44e}, - 37: {From: 0xbbc, To: 0x4229}, - 38: {From: 0xbbf, To: 0x529}, - 39: {From: 0xbfe, To: 0x2da7}, - 40: {From: 0xc2e, To: 0x3181}, - 41: {From: 0xcb9, To: 0xf3}, - 42: {From: 0xd08, To: 0xfa}, - 43: {From: 0xdc8, To: 0x11a}, - 44: {From: 0xdd7, To: 0x32d}, - 45: {From: 0xdf8, To: 0xdfb}, - 46: {From: 0xdfe, To: 0x531}, - 47: {From: 0xe01, To: 0xdf3}, - 48: {From: 0xedf, To: 0x205a}, - 49: {From: 0xee9, To: 0x222e}, - 50: {From: 0xeee, To: 0x2e9a}, - 51: {From: 0xf39, To: 0x367}, - 52: {From: 0x10d0, To: 0x140}, - 53: {From: 0x1104, To: 0x2d0}, - 54: {From: 0x11a0, To: 0x1ec}, - 55: {From: 0x1279, To: 0x21}, - 56: {From: 0x1424, To: 0x15e}, - 57: {From: 0x1470, To: 0x14e}, - 58: {From: 0x151f, To: 0xd9b}, - 59: {From: 0x1523, To: 0x390}, - 60: {From: 0x1532, To: 0x19f}, - 61: {From: 0x1580, To: 0x210}, - 62: {From: 0x1583, To: 0x10d}, - 63: {From: 0x15a3, To: 0x3caf}, - 64: {From: 0x1630, To: 0x222e}, - 65: {From: 0x166a, To: 0x19b}, - 66: {From: 0x16c8, To: 0x136}, - 67: {From: 0x1700, To: 0x29f8}, - 68: {From: 0x1718, To: 0x194}, - 69: {From: 0x1727, To: 0xf3f}, - 70: {From: 0x177a, To: 0x178}, - 71: {From: 0x1809, To: 0x17b6}, - 72: {From: 0x1816, To: 0x18f3}, - 73: {From: 0x188a, To: 0x436}, - 74: {From: 0x1979, To: 0x1d01}, - 75: {From: 0x1a74, To: 0x2bb0}, - 76: {From: 0x1a8a, To: 0x1f8}, - 77: {From: 0x1b5a, To: 0x1fa}, - 78: {From: 0x1b86, To: 0x1515}, - 79: {From: 0x1d64, To: 0x2c9b}, - 80: {From: 0x2038, To: 0x37b1}, - 81: {From: 0x203d, To: 0x20dd}, - 82: {From: 0x205a, To: 0x30b}, - 83: {From: 0x20e3, To: 0x274}, - 84: {From: 0x20ee, To: 0x263}, - 85: {From: 0x20f2, To: 0x22d}, - 86: {From: 0x20f9, To: 0x256}, - 87: {From: 0x210f, To: 0x21eb}, - 88: {From: 0x2135, To: 0x27d}, - 89: {From: 0x2160, To: 0x913}, - 90: {From: 0x2199, To: 0x121}, - 91: {From: 0x21ce, To: 0x1561}, - 92: {From: 0x21e6, To: 0x504}, - 93: {From: 0x21f4, To: 0x49f}, - 94: {From: 0x21fb, To: 0x269}, - 95: {From: 0x222d, To: 0x121}, - 96: {From: 0x2237, To: 0x121}, - 97: {From: 0x2262, To: 0x92a}, - 98: {From: 0x2316, To: 0x3226}, - 99: {From: 0x236a, To: 0x2835}, - 100: {From: 0x2382, To: 0x3365}, - 101: {From: 0x2472, To: 0x2c7}, - 102: {From: 0x24e4, To: 0x2ff}, - 103: {From: 0x24f0, To: 0x2fa}, - 104: {From: 0x24fa, To: 0x31f}, - 105: {From: 0x2550, To: 0xb5b}, - 106: {From: 0x25a9, To: 0xe2}, - 107: {From: 0x263e, To: 0x2d0}, - 108: {From: 0x26c9, To: 0x26b4}, - 109: {From: 0x26f9, To: 0x3c8}, - 110: {From: 0x2727, To: 0x3caf}, - 111: {From: 0x2755, To: 0x6a4}, - 112: {From: 0x2765, To: 0x26b4}, - 113: {From: 0x2789, To: 0x4358}, - 114: {From: 0x27c9, To: 0x2001}, - 115: {From: 0x28ea, To: 0x27b1}, - 116: {From: 0x28ef, To: 0x2837}, - 117: {From: 0x2914, To: 0x351}, - 118: {From: 0x2986, To: 0x2da7}, - 119: {From: 0x29f0, To: 0x96b}, - 120: {From: 0x2b1a, To: 0x38d}, - 121: {From: 0x2bfc, To: 0x395}, - 122: {From: 0x2c3f, To: 0x3caf}, - 123: {From: 0x2cfc, To: 0x3be}, - 124: {From: 0x2d13, To: 0x597}, - 125: {From: 0x2d47, To: 0x148}, - 126: {From: 0x2d48, To: 0x148}, - 127: {From: 0x2dff, To: 0x2f1}, - 128: {From: 0x2e08, To: 0x19cc}, - 129: {From: 0x2e1a, To: 0x2d95}, - 130: {From: 0x2e21, To: 0x292}, - 131: {From: 0x2e54, To: 0x7d}, - 132: {From: 0x2e65, To: 0x2282}, - 133: {From: 0x2ea0, To: 0x2e9b}, - 134: {From: 0x2eef, To: 0x2ed7}, - 135: {From: 0x3193, To: 0x3c4}, - 136: {From: 0x3366, To: 0x338e}, - 137: {From: 0x342a, To: 0x3dc}, - 138: {From: 0x34ee, To: 0x18d0}, - 139: {From: 0x35c8, To: 0x2c9b}, - 140: {From: 0x35e6, To: 0x412}, - 141: {From: 0x3658, To: 0x246}, - 142: {From: 0x3676, To: 0x3f4}, - 143: {From: 0x36fd, To: 0x445}, - 144: {From: 0x37c0, To: 0x121}, - 145: {From: 0x3816, To: 0x38f2}, - 146: {From: 0x382a, To: 0x2b48}, - 147: {From: 0x382b, To: 0x2c9b}, - 148: {From: 0x382f, To: 0xa9}, - 149: {From: 0x3832, To: 0x3228}, - 150: {From: 0x386c, To: 0x39a6}, - 151: {From: 0x3892, To: 0x3fc0}, - 152: {From: 0x38a5, To: 0x39d7}, - 153: {From: 0x38b4, To: 0x1fa4}, - 154: {From: 0x38b5, To: 0x2e9a}, - 155: {From: 0x395c, To: 0x47e}, - 156: {From: 0x3b4e, To: 0xd91}, - 157: {From: 0x3b78, To: 0x137}, - 158: {From: 0x3c99, To: 0x4bc}, - 159: {From: 0x3fbd, To: 0x100}, - 160: {From: 0x4208, To: 0xa91}, - 161: {From: 0x42be, To: 0x573}, - 162: {From: 0x42f9, To: 0x3f60}, - 163: {From: 0x4378, To: 0x25a}, - 164: {From: 0x43b8, To: 0xe6c}, - 165: {From: 0x43cd, To: 0x10f}, - 166: {From: 0x44af, To: 0x3322}, - 167: {From: 0x44e3, To: 0x512}, - 168: {From: 0x45ca, To: 0x2409}, - 169: {From: 0x45dd, To: 0x26dc}, - 170: {From: 0x4610, To: 0x48ae}, - 171: {From: 0x46ae, To: 0x46a0}, - 172: {From: 0x473e, To: 0x4745}, - 173: {From: 0x4817, To: 0x3503}, - 174: {From: 0x4916, To: 0x31f}, - 175: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 176 bytes, 176 elements -var AliasTypes = [176]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, - 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, - 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, - 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, - 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, - 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 1, 0, 2, 1, 1, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, 1, 1, 1, - 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, - 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 143 - _Qaai = 151 - _Qabx = 192 - _Zinh = 245 - _Zyyy = 250 - _Zzzz = 251 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1012 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaa" + - "QaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaas" + - "QaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabk" + - "QablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRohgRoroRunrSamr" + - "SaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSoraSoyoSundSyloSyrcSyre" + - "SyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglgThaaThaiTibtTirhToto" + - "UgarVaiiVispWaraWchoWoleXpeoXsuxYeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz" + - "\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -819,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -828,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -841,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe5, 0x00, 0x00, 0x00, 0x00, 0xe7, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -898,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -908,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xcf, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xde, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe1, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xe6, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1002,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1011,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1029,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1043,73 +1064,73 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. // Each 2-letter codes is followed by two bytes with the following meaning: -// - [A-Z}{2}: the first letter of the 2-letter code plus these two -// letters form the 3-letter ISO code. -// - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1119,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1163,50 +1184,52 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits // of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in -// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// // for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. // The region code is stored in the 9 lsb of the indexed value. // Size: 18 bytes, 9 elements @@ -1220,165 +1243,172 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 1995 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x60, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x62, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, "arevela": 0xa, "arevmda": 0xb, - "asante": 0xc, - "auvern": 0xd, - "baku1926": 0xe, - "balanka": 0xf, - "barla": 0x10, - "basiceng": 0x11, - "bauddha": 0x12, - "biscayan": 0x13, - "biske": 0x5b, - "bohoric": 0x14, - "boont": 0x15, - "bornholm": 0x16, - "cisaup": 0x17, - "colb1945": 0x18, - "cornu": 0x19, - "creiss": 0x1a, - "dajnko": 0x1b, - "ekavsk": 0x1c, - "emodeng": 0x1d, - "fonipa": 0x63, - "fonkirsh": 0x64, - "fonnapa": 0x65, - "fonupa": 0x66, - "fonxsamp": 0x67, - "gascon": 0x1e, - "grclass": 0x1f, - "grital": 0x20, - "grmistr": 0x21, - "hepburn": 0x22, - "heploc": 0x61, - "hognorsk": 0x23, - "hsistemo": 0x24, - "ijekavsk": 0x25, - "itihasa": 0x26, - "ivanchov": 0x27, - "jauer": 0x28, - "jyutping": 0x29, - "kkcor": 0x2a, - "kociewie": 0x2b, - "kscor": 0x2c, - "laukika": 0x2d, - "lemosin": 0x2e, - "lengadoc": 0x2f, - "lipaw": 0x5c, - "luna1918": 0x30, - "metelko": 0x31, - "monoton": 0x32, - "ndyuka": 0x33, - "nedis": 0x34, - "newfound": 0x35, - "nicard": 0x36, - "njiva": 0x5d, - "nulik": 0x37, - "osojs": 0x5e, - "oxendict": 0x38, - "pahawh2": 0x39, - "pahawh3": 0x3a, - "pahawh4": 0x3b, - "pamaka": 0x3c, - "peano": 0x3d, - "petr1708": 0x3e, - "pinyin": 0x3f, - "polyton": 0x40, - "provenc": 0x41, - "puter": 0x42, - "rigik": 0x43, - "rozaj": 0x44, - "rumgr": 0x45, - "scotland": 0x46, - "scouse": 0x47, - "simple": 0x68, - "solba": 0x5f, - "sotav": 0x48, - "spanglis": 0x49, - "surmiran": 0x4a, - "sursilv": 0x4b, - "sutsilv": 0x4c, - "tarask": 0x4d, - "tongyong": 0x4e, - "tunumiit": 0x4f, - "uccor": 0x50, - "ucrcor": 0x51, - "ulster": 0x52, - "unifon": 0x53, - "vaidika": 0x54, - "valencia": 0x55, - "vallader": 0x56, - "vecdruka": 0x57, - "vivaraup": 0x58, - "wadegile": 0x59, - "xsistemo": 0x5a, + "arkaika": 0xc, + "asante": 0xd, + "auvern": 0xe, + "baku1926": 0xf, + "balanka": 0x10, + "barla": 0x11, + "basiceng": 0x12, + "bauddha": 0x13, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 98 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1390,156 +1420,156 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1012 bytes, 253 elements -var likelyScript = [253]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 132: {lang: 0x3b, region: 0x11c}, - 133: {lang: 0xfd, region: 0xc4}, - 134: {lang: 0x27d, region: 0x106}, - 135: {lang: 0x2c9, region: 0x53}, - 136: {lang: 0x39f, region: 0x9c}, - 137: {lang: 0x39f, region: 0x53}, - 139: {lang: 0x3ad, region: 0xb0}, - 141: {lang: 0x1c6, region: 0x53}, - 142: {lang: 0x4fd, region: 0x9c}, - 193: {lang: 0x3cb, region: 0x95}, - 196: {lang: 0x372, region: 0x10c}, - 197: {lang: 0x420, region: 0x97}, - 199: {lang: 0x4ff, region: 0x15e}, - 200: {lang: 0x3f0, region: 0x99}, - 201: {lang: 0x45, region: 0x135}, - 202: {lang: 0x139, region: 0x7b}, - 203: {lang: 0x3e9, region: 0x99}, - 205: {lang: 0x3e9, region: 0x99}, - 206: {lang: 0x3fa, region: 0x99}, - 207: {lang: 0x40c, region: 0xb3}, - 210: {lang: 0x433, region: 0x99}, - 211: {lang: 0xef, region: 0xc5}, - 212: {lang: 0x43e, region: 0x95}, - 213: {lang: 0x44d, region: 0x35}, - 214: {lang: 0x44e, region: 0x9b}, - 218: {lang: 0x45a, region: 0xe7}, - 219: {lang: 0x11a, region: 0x99}, - 220: {lang: 0x45e, region: 0x53}, - 221: {lang: 0x232, region: 0x53}, - 222: {lang: 0x450, region: 0x99}, - 223: {lang: 0x4a5, region: 0x53}, - 224: {lang: 0x9f, region: 0x13e}, - 225: {lang: 0x461, region: 0x99}, - 227: {lang: 0x528, region: 0xba}, - 228: {lang: 0x153, region: 0xe7}, - 229: {lang: 0x128, region: 0xcd}, - 230: {lang: 0x46b, region: 0x123}, - 231: {lang: 0xa9, region: 0x53}, - 232: {lang: 0x2ce, region: 0x99}, - 234: {lang: 0x4ad, region: 0x11c}, - 235: {lang: 0x4be, region: 0xb4}, - 237: {lang: 0x1ce, region: 0x99}, - 240: {lang: 0x3a9, region: 0x9c}, - 241: {lang: 0x22, region: 0x9b}, - 243: {lang: 0x1ea, region: 0x53}, - 244: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { region uint16 - script uint8 + script uint16 flags uint8 } @@ -1547,1430 +1577,1430 @@ type likelyScriptRegion struct { // scripts and regions given incomplete information. If more entries exist for a // given language, region and script are the index and size respectively // of the list in likelyLangList. -// Size: 5320 bytes, 1330 elements +// Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf1, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xc9, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xde, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe0, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xe7, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd3, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x85, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xe5, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xe7, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe1, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x8d, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xf3, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xe6, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xdd, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xe6, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xe6, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe1, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xe6, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc4, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf0, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8b, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xc8, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe3, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xcf, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xc5, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xe6, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd2, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xd6, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xde, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xdc, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe1, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xe6, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xe7, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xe6, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xdf, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xea, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xeb, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe1, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x8e, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xc7, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe3, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. -// Size: 388 bytes, 97 elements +// Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x84, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xca, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x88, flags: 0x0}, - 48: {region: 0x53, script: 0x89, flags: 0x2}, - 49: {region: 0xba, script: 0xe3, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xce, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { lang uint16 - script uint8 + script uint16 flags uint8 } @@ -2979,349 +3009,349 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 1432 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xcf, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xe5, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. -// Size: 372 bytes, 93 elements +// Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xe7, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xe6, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xe6, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xe6, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xe6, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } type likelyTag struct { lang uint16 region uint16 - script uint8 + script uint16 } // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3342,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3356,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3446,19 +3476,19 @@ var regionInclusionNext = [73]uint8{ type parentRel struct { lang uint16 - script uint8 - maxScript uint8 + script uint16 + maxScript uint16 toRegion uint16 fromRegion []uint16 } // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 26398 bytes (25KiB); checksum: 1C859EA7 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go index 8afecd5..212b77c 100644 --- a/vendor/golang.org/x/text/language/doc.go +++ b/vendor/golang.org/x/text/language/doc.go @@ -10,18 +10,17 @@ // and provides the user with the best experience // (see https://blog.golang.org/matchlang). // -// -// Matching preferred against supported languages +// # Matching preferred against supported languages // // A Matcher for an application that supports English, Australian English, // Danish, and standard Mandarin can be created as follows: // -// var matcher = language.NewMatcher([]language.Tag{ -// language.English, // The first language is used as fallback. -// language.MustParse("en-AU"), -// language.Danish, -// language.Chinese, -// }) +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) // // This list of supported languages is typically implied by the languages for // which there exists translations of the user interface. @@ -30,14 +29,14 @@ // language tags. // The MatchString finds best matches for such strings: // -// handler(w http.ResponseWriter, r *http.Request) { -// lang, _ := r.Cookie("lang") -// accept := r.Header.Get("Accept-Language") -// tag, _ := language.MatchStrings(matcher, lang.String(), accept) +// handler(w http.ResponseWriter, r *http.Request) { +// lang, _ := r.Cookie("lang") +// accept := r.Header.Get("Accept-Language") +// tag, _ := language.MatchStrings(matcher, lang.String(), accept) // -// // tag should now be used for the initialization of any -// // locale-specific service. -// } +// // tag should now be used for the initialization of any +// // locale-specific service. +// } // // The Matcher's Match method can be used to match Tags directly. // @@ -48,8 +47,7 @@ // For instance, it will know that a reader of Bokmål Danish can read Norwegian // and will know that Cantonese ("yue") is a good match for "zh-HK". // -// -// Using match results +// # Using match results // // To guarantee a consistent user experience to the user it is important to // use the same language tag for the selection of any locale-specific services. @@ -58,9 +56,9 @@ // More subtly confusing is using the wrong sorting order or casing // algorithm for a certain language. // -// All the packages in x/text that provide locale-specific services -// (e.g. collate, cases) should be initialized with the tag that was -// obtained at the start of an interaction with the user. +// All the packages in x/text that provide locale-specific services +// (e.g. collate, cases) should be initialized with the tag that was +// obtained at the start of an interaction with the user. // // Note that Tag that is returned by Match and MatchString may differ from any // of the supported languages, as it may contain carried over settings from @@ -70,8 +68,7 @@ // Match and MatchString both return the index of the matched supported tag // to simplify associating such data with the matched tag. // -// -// Canonicalization +// # Canonicalization // // If one uses the Matcher to compare languages one does not need to // worry about canonicalization. @@ -92,10 +89,9 @@ // equivalence relations. The CanonType type can be used to alter the // canonicalization form. // -// References +// # References // // BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 -// package language // import "golang.org/x/text/language" // TODO: explanation on how to match languages for your own locale-specific diff --git a/vendor/golang.org/x/text/language/go1_1.go b/vendor/golang.org/x/text/language/go1_1.go deleted file mode 100644 index c743558..0000000 --- a/vendor/golang.org/x/text/language/go1_1.go +++ /dev/null @@ -1,39 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !go1.2 -// +build !go1.2 - -package language - -import "sort" - -func sortStable(s sort.Interface) { - ss := stableSort{ - s: s, - pos: make([]int, s.Len()), - } - for i := range ss.pos { - ss.pos[i] = i - } - sort.Sort(&ss) -} - -type stableSort struct { - s sort.Interface - pos []int -} - -func (s *stableSort) Len() int { - return len(s.pos) -} - -func (s *stableSort) Less(i, j int) bool { - return s.s.Less(i, j) || !s.s.Less(j, i) && s.pos[i] < s.pos[j] -} - -func (s *stableSort) Swap(i, j int) { - s.s.Swap(i, j) - s.pos[i], s.pos[j] = s.pos[j], s.pos[i] -} diff --git a/vendor/golang.org/x/text/language/go1_2.go b/vendor/golang.org/x/text/language/go1_2.go deleted file mode 100644 index 77aaaa2..0000000 --- a/vendor/golang.org/x/text/language/go1_2.go +++ /dev/null @@ -1,12 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build go1.2 -// +build go1.2 - -package language - -import "sort" - -var sortStable = sort.Stable diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go index 289b3a3..4d9c661 100644 --- a/vendor/golang.org/x/text/language/language.go +++ b/vendor/golang.org/x/text/language/language.go @@ -344,7 +344,7 @@ func (t Tag) Parent() Tag { return Tag(compact.Tag(t).Parent()) } -// returns token t and the rest of the string. +// nextToken returns token t and the rest of the string. func nextToken(s string) (t, tail string) { p := strings.Index(s[1:], "-") if p == -1 { diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index f734921..1153baf 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or + // If deprecated codes match and there is no fiddling with the script // or region, we consider it an exact match. conf := Exact if language.AliasTypes[i] != language.Macro { @@ -545,7 +545,7 @@ type bestMatch struct { // match as the preferred match. // // If pin is true and have and tag are a strong match, it will henceforth only -// consider matches for this language. This corresponds to the nothing that most +// consider matches for this language. This corresponds to the idea that most // users have a strong preference for the first defined language. A user can // still prefer a second language over a dialect of the preferred language by // explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go index 59b0410..4d57222 100644 --- a/vendor/golang.org/x/text/language/parse.go +++ b/vendor/golang.org/x/text/language/parse.go @@ -6,6 +6,7 @@ package language import ( "errors" + "sort" "strconv" "strings" @@ -147,6 +148,7 @@ func update(b *language.Builder, part ...interface{}) (err error) { } var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") +var errTagListTooLarge = errors.New("tag list exceeds max length") // ParseAcceptLanguage parses the contents of an Accept-Language header as // defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and @@ -164,6 +166,10 @@ func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { } }() + if strings.Count(s, "-") > 1000 { + return nil, nil, errTagListTooLarge + } + var entry string for s != "" { if entry, s = split(s, ','); entry == "" { @@ -201,7 +207,7 @@ func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { tag = append(tag, t) q = append(q, float32(w)) } - sortStable(&tagSort{tag, q}) + sort.Stable(&tagSort{tag, q}) return tag, q, nil } diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 96b57f6..a6573dc 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 143 - _Qaai = 151 - _Qabx = 192 - _Zinh = 245 - _Zyyy = 250 - _Zzzz = 251 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xcf, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xde, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe1, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go index 526c703..487335d 100644 --- a/vendor/golang.org/x/text/unicode/norm/forminfo.go +++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go @@ -13,7 +13,7 @@ import "encoding/binary" // a rune to a uint16. The values take two forms. For v >= 0x8000: // bits // 15: 1 (inverse of NFD_QC bit of qcInfo) -// 13..7: qcInfo (see below). isYesD is always true (no decompostion). +// 13..7: qcInfo (see below). isYesD is always true (no decomposition). // 6..0: ccc (compressed CCC value). // For v < 0x8000, the respective rune has a decomposition and v is an index // into a byte array of UTF-8 decomposition sequences and additional info and @@ -110,10 +110,11 @@ func (p Properties) BoundaryAfter() bool { } // We pack quick check data in 4 bits: -// 5: Combines forward (0 == false, 1 == true) -// 4..3: NFC_QC Yes(00), No (10), or Maybe (11) -// 2: NFD_QC Yes (0) or No (1). No also means there is a decomposition. -// 1..0: Number of trailing non-starters. +// +// 5: Combines forward (0 == false, 1 == true) +// 4..3: NFC_QC Yes(00), No (10), or Maybe (11) +// 2: NFD_QC Yes (0) or No (1). No also means there is a decomposition. +// 1..0: Number of trailing non-starters. // // When all 4 bits are zero, the character is inert, meaning it is never // influenced by normalization. diff --git a/vendor/golang.org/x/text/unicode/norm/normalize.go b/vendor/golang.org/x/text/unicode/norm/normalize.go index 95efcf2..4747ad0 100644 --- a/vendor/golang.org/x/text/unicode/norm/normalize.go +++ b/vendor/golang.org/x/text/unicode/norm/normalize.go @@ -18,16 +18,17 @@ import ( // A Form denotes a canonical representation of Unicode code points. // The Unicode-defined normalization and equivalence forms are: // -// NFC Unicode Normalization Form C -// NFD Unicode Normalization Form D -// NFKC Unicode Normalization Form KC -// NFKD Unicode Normalization Form KD +// NFC Unicode Normalization Form C +// NFD Unicode Normalization Form D +// NFKC Unicode Normalization Form KC +// NFKD Unicode Normalization Form KD // // For a Form f, this documentation uses the notation f(x) to mean // the bytes or string x converted to the given form. // A position n in x is called a boundary if conversion to the form can // proceed independently on both sides: -// f(x) == append(f(x[0:n]), f(x[n:])...) +// +// f(x) == append(f(x[0:n]), f(x[n:])...) // // References: https://unicode.org/reports/tr15/ and // https://unicode.org/notes/tn5/. diff --git a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go index 96a130d..f65785e 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go @@ -1,7 +1,7 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -//go:build go1.16 -// +build go1.16 +//go:build go1.16 && !go1.21 +// +build go1.16,!go1.21 package norm @@ -7315,7 +7315,7 @@ const recompMapPacked = "" + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E - "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F + "\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 @@ -7342,7 +7342,7 @@ const recompMapPacked = "" + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 - "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 diff --git a/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go new file mode 100644 index 0000000..e1858b8 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go @@ -0,0 +1,7908 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.21 +// +build go1.21 + +package norm + +import "sync" + +const ( + // Version is the Unicode edition from which the tables are derived. + Version = "15.0.0" + + // MaxTransformChunkSize indicates the maximum number of bytes that Transform + // may need to write atomically for any Form. Making a destination buffer at + // least this size ensures that Transform can always make progress and that + // the user does not need to grow the buffer on an ErrShortDst. + MaxTransformChunkSize = 35 + maxNonStarters*4 +) + +var ccc = [56]uint8{ + 0, 1, 6, 7, 8, 9, 10, 11, + 12, 13, 14, 15, 16, 17, 18, 19, + 20, 21, 22, 23, 24, 25, 26, 27, + 28, 29, 30, 31, 32, 33, 34, 35, + 36, 84, 91, 103, 107, 118, 122, 129, + 130, 132, 202, 214, 216, 218, 220, 222, + 224, 226, 228, 230, 232, 233, 234, 240, +} + +const ( + firstMulti = 0x199A + firstCCC = 0x2DD5 + endMulti = 0x30A1 + firstLeadingCCC = 0x4AEF + firstCCCZeroExcept = 0x4BB9 + firstStarterWithNLead = 0x4BE0 + lastDecomp = 0x4BE2 + maxDecomp = 0x8000 +) + +// decomps: 19426 bytes +var decomps = [...]byte{ + // Bytes 0 - 3f + 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, + 0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41, + 0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41, + 0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41, + 0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41, + 0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41, + 0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41, + 0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41, + // Bytes 40 - 7f + 0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41, + 0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41, + 0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41, + 0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41, + 0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41, + 0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41, + 0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41, + 0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41, + // Bytes 80 - bf + 0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41, + 0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41, + 0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41, + 0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41, + 0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41, + 0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41, + 0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41, + 0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42, + // Bytes c0 - ff + 0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5, + 0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2, + 0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xA6, 0x42, + 0xC3, 0xB0, 0x42, 0xC3, 0xB8, 0x42, 0xC4, 0xA6, + 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1, 0x42, 0xC5, + 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6, 0x8E, 0x42, + 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42, 0xC7, 0x80, + 0x42, 0xC7, 0x81, 0x42, 0xC7, 0x82, 0x42, 0xC8, + // Bytes 100 - 13f + 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90, 0x42, + 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9, 0x93, + 0x42, 0xC9, 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, + 0x96, 0x42, 0xC9, 0x97, 0x42, 0xC9, 0x98, 0x42, + 0xC9, 0x99, 0x42, 0xC9, 0x9B, 0x42, 0xC9, 0x9C, + 0x42, 0xC9, 0x9E, 0x42, 0xC9, 0x9F, 0x42, 0xC9, + 0xA0, 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA2, 0x42, + 0xC9, 0xA3, 0x42, 0xC9, 0xA4, 0x42, 0xC9, 0xA5, + // Bytes 140 - 17f + 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA7, 0x42, 0xC9, + 0xA8, 0x42, 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, + 0xC9, 0xAB, 0x42, 0xC9, 0xAC, 0x42, 0xC9, 0xAD, + 0x42, 0xC9, 0xAE, 0x42, 0xC9, 0xAF, 0x42, 0xC9, + 0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42, + 0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5, + 0x42, 0xC9, 0xB6, 0x42, 0xC9, 0xB7, 0x42, 0xC9, + 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9, 0xBA, 0x42, + // Bytes 180 - 1bf + 0xC9, 0xBB, 0x42, 0xC9, 0xBD, 0x42, 0xC9, 0xBE, + 0x42, 0xCA, 0x80, 0x42, 0xCA, 0x81, 0x42, 0xCA, + 0x82, 0x42, 0xCA, 0x83, 0x42, 0xCA, 0x84, 0x42, + 0xCA, 0x88, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A, + 0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA, + 0x8D, 0x42, 0xCA, 0x8E, 0x42, 0xCA, 0x8F, 0x42, + 0xCA, 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, + 0x42, 0xCA, 0x95, 0x42, 0xCA, 0x98, 0x42, 0xCA, + // Bytes 1c0 - 1ff + 0x99, 0x42, 0xCA, 0x9B, 0x42, 0xCA, 0x9C, 0x42, + 0xCA, 0x9D, 0x42, 0xCA, 0x9F, 0x42, 0xCA, 0xA1, + 0x42, 0xCA, 0xA2, 0x42, 0xCA, 0xA3, 0x42, 0xCA, + 0xA4, 0x42, 0xCA, 0xA5, 0x42, 0xCA, 0xA6, 0x42, + 0xCA, 0xA7, 0x42, 0xCA, 0xA8, 0x42, 0xCA, 0xA9, + 0x42, 0xCA, 0xAA, 0x42, 0xCA, 0xAB, 0x42, 0xCA, + 0xB9, 0x42, 0xCB, 0x90, 0x42, 0xCB, 0x91, 0x42, + 0xCE, 0x91, 0x42, 0xCE, 0x92, 0x42, 0xCE, 0x93, + // Bytes 200 - 23f + 0x42, 0xCE, 0x94, 0x42, 0xCE, 0x95, 0x42, 0xCE, + 0x96, 0x42, 0xCE, 0x97, 0x42, 0xCE, 0x98, 0x42, + 0xCE, 0x99, 0x42, 0xCE, 0x9A, 0x42, 0xCE, 0x9B, + 0x42, 0xCE, 0x9C, 0x42, 0xCE, 0x9D, 0x42, 0xCE, + 0x9E, 0x42, 0xCE, 0x9F, 0x42, 0xCE, 0xA0, 0x42, + 0xCE, 0xA1, 0x42, 0xCE, 0xA3, 0x42, 0xCE, 0xA4, + 0x42, 0xCE, 0xA5, 0x42, 0xCE, 0xA6, 0x42, 0xCE, + 0xA7, 0x42, 0xCE, 0xA8, 0x42, 0xCE, 0xA9, 0x42, + // Bytes 240 - 27f + 0xCE, 0xB1, 0x42, 0xCE, 0xB2, 0x42, 0xCE, 0xB3, + 0x42, 0xCE, 0xB4, 0x42, 0xCE, 0xB5, 0x42, 0xCE, + 0xB6, 0x42, 0xCE, 0xB7, 0x42, 0xCE, 0xB8, 0x42, + 0xCE, 0xB9, 0x42, 0xCE, 0xBA, 0x42, 0xCE, 0xBB, + 0x42, 0xCE, 0xBC, 0x42, 0xCE, 0xBD, 0x42, 0xCE, + 0xBE, 0x42, 0xCE, 0xBF, 0x42, 0xCF, 0x80, 0x42, + 0xCF, 0x81, 0x42, 0xCF, 0x82, 0x42, 0xCF, 0x83, + 0x42, 0xCF, 0x84, 0x42, 0xCF, 0x85, 0x42, 0xCF, + // Bytes 280 - 2bf + 0x86, 0x42, 0xCF, 0x87, 0x42, 0xCF, 0x88, 0x42, + 0xCF, 0x89, 0x42, 0xCF, 0x9C, 0x42, 0xCF, 0x9D, + 0x42, 0xD0, 0xB0, 0x42, 0xD0, 0xB1, 0x42, 0xD0, + 0xB2, 0x42, 0xD0, 0xB3, 0x42, 0xD0, 0xB4, 0x42, + 0xD0, 0xB5, 0x42, 0xD0, 0xB6, 0x42, 0xD0, 0xB7, + 0x42, 0xD0, 0xB8, 0x42, 0xD0, 0xBA, 0x42, 0xD0, + 0xBB, 0x42, 0xD0, 0xBC, 0x42, 0xD0, 0xBD, 0x42, + 0xD0, 0xBE, 0x42, 0xD0, 0xBF, 0x42, 0xD1, 0x80, + // Bytes 2c0 - 2ff + 0x42, 0xD1, 0x81, 0x42, 0xD1, 0x82, 0x42, 0xD1, + 0x83, 0x42, 0xD1, 0x84, 0x42, 0xD1, 0x85, 0x42, + 0xD1, 0x86, 0x42, 0xD1, 0x87, 0x42, 0xD1, 0x88, + 0x42, 0xD1, 0x8A, 0x42, 0xD1, 0x8B, 0x42, 0xD1, + 0x8C, 0x42, 0xD1, 0x8D, 0x42, 0xD1, 0x8E, 0x42, + 0xD1, 0x95, 0x42, 0xD1, 0x96, 0x42, 0xD1, 0x98, + 0x42, 0xD1, 0x9F, 0x42, 0xD2, 0x91, 0x42, 0xD2, + 0xAB, 0x42, 0xD2, 0xAF, 0x42, 0xD2, 0xB1, 0x42, + // Bytes 300 - 33f + 0xD3, 0x8F, 0x42, 0xD3, 0x99, 0x42, 0xD3, 0xA9, + 0x42, 0xD7, 0x90, 0x42, 0xD7, 0x91, 0x42, 0xD7, + 0x92, 0x42, 0xD7, 0x93, 0x42, 0xD7, 0x94, 0x42, + 0xD7, 0x9B, 0x42, 0xD7, 0x9C, 0x42, 0xD7, 0x9D, + 0x42, 0xD7, 0xA2, 0x42, 0xD7, 0xA8, 0x42, 0xD7, + 0xAA, 0x42, 0xD8, 0xA1, 0x42, 0xD8, 0xA7, 0x42, + 0xD8, 0xA8, 0x42, 0xD8, 0xA9, 0x42, 0xD8, 0xAA, + 0x42, 0xD8, 0xAB, 0x42, 0xD8, 0xAC, 0x42, 0xD8, + // Bytes 340 - 37f + 0xAD, 0x42, 0xD8, 0xAE, 0x42, 0xD8, 0xAF, 0x42, + 0xD8, 0xB0, 0x42, 0xD8, 0xB1, 0x42, 0xD8, 0xB2, + 0x42, 0xD8, 0xB3, 0x42, 0xD8, 0xB4, 0x42, 0xD8, + 0xB5, 0x42, 0xD8, 0xB6, 0x42, 0xD8, 0xB7, 0x42, + 0xD8, 0xB8, 0x42, 0xD8, 0xB9, 0x42, 0xD8, 0xBA, + 0x42, 0xD9, 0x81, 0x42, 0xD9, 0x82, 0x42, 0xD9, + 0x83, 0x42, 0xD9, 0x84, 0x42, 0xD9, 0x85, 0x42, + 0xD9, 0x86, 0x42, 0xD9, 0x87, 0x42, 0xD9, 0x88, + // Bytes 380 - 3bf + 0x42, 0xD9, 0x89, 0x42, 0xD9, 0x8A, 0x42, 0xD9, + 0xAE, 0x42, 0xD9, 0xAF, 0x42, 0xD9, 0xB1, 0x42, + 0xD9, 0xB9, 0x42, 0xD9, 0xBA, 0x42, 0xD9, 0xBB, + 0x42, 0xD9, 0xBE, 0x42, 0xD9, 0xBF, 0x42, 0xDA, + 0x80, 0x42, 0xDA, 0x83, 0x42, 0xDA, 0x84, 0x42, + 0xDA, 0x86, 0x42, 0xDA, 0x87, 0x42, 0xDA, 0x88, + 0x42, 0xDA, 0x8C, 0x42, 0xDA, 0x8D, 0x42, 0xDA, + 0x8E, 0x42, 0xDA, 0x91, 0x42, 0xDA, 0x98, 0x42, + // Bytes 3c0 - 3ff + 0xDA, 0xA1, 0x42, 0xDA, 0xA4, 0x42, 0xDA, 0xA6, + 0x42, 0xDA, 0xA9, 0x42, 0xDA, 0xAD, 0x42, 0xDA, + 0xAF, 0x42, 0xDA, 0xB1, 0x42, 0xDA, 0xB3, 0x42, + 0xDA, 0xBA, 0x42, 0xDA, 0xBB, 0x42, 0xDA, 0xBE, + 0x42, 0xDB, 0x81, 0x42, 0xDB, 0x85, 0x42, 0xDB, + 0x86, 0x42, 0xDB, 0x87, 0x42, 0xDB, 0x88, 0x42, + 0xDB, 0x89, 0x42, 0xDB, 0x8B, 0x42, 0xDB, 0x8C, + 0x42, 0xDB, 0x90, 0x42, 0xDB, 0x92, 0x43, 0xE0, + // Bytes 400 - 43f + 0xBC, 0x8B, 0x43, 0xE1, 0x83, 0x9C, 0x43, 0xE1, + 0x84, 0x80, 0x43, 0xE1, 0x84, 0x81, 0x43, 0xE1, + 0x84, 0x82, 0x43, 0xE1, 0x84, 0x83, 0x43, 0xE1, + 0x84, 0x84, 0x43, 0xE1, 0x84, 0x85, 0x43, 0xE1, + 0x84, 0x86, 0x43, 0xE1, 0x84, 0x87, 0x43, 0xE1, + 0x84, 0x88, 0x43, 0xE1, 0x84, 0x89, 0x43, 0xE1, + 0x84, 0x8A, 0x43, 0xE1, 0x84, 0x8B, 0x43, 0xE1, + 0x84, 0x8C, 0x43, 0xE1, 0x84, 0x8D, 0x43, 0xE1, + // Bytes 440 - 47f + 0x84, 0x8E, 0x43, 0xE1, 0x84, 0x8F, 0x43, 0xE1, + 0x84, 0x90, 0x43, 0xE1, 0x84, 0x91, 0x43, 0xE1, + 0x84, 0x92, 0x43, 0xE1, 0x84, 0x94, 0x43, 0xE1, + 0x84, 0x95, 0x43, 0xE1, 0x84, 0x9A, 0x43, 0xE1, + 0x84, 0x9C, 0x43, 0xE1, 0x84, 0x9D, 0x43, 0xE1, + 0x84, 0x9E, 0x43, 0xE1, 0x84, 0xA0, 0x43, 0xE1, + 0x84, 0xA1, 0x43, 0xE1, 0x84, 0xA2, 0x43, 0xE1, + 0x84, 0xA3, 0x43, 0xE1, 0x84, 0xA7, 0x43, 0xE1, + // Bytes 480 - 4bf + 0x84, 0xA9, 0x43, 0xE1, 0x84, 0xAB, 0x43, 0xE1, + 0x84, 0xAC, 0x43, 0xE1, 0x84, 0xAD, 0x43, 0xE1, + 0x84, 0xAE, 0x43, 0xE1, 0x84, 0xAF, 0x43, 0xE1, + 0x84, 0xB2, 0x43, 0xE1, 0x84, 0xB6, 0x43, 0xE1, + 0x85, 0x80, 0x43, 0xE1, 0x85, 0x87, 0x43, 0xE1, + 0x85, 0x8C, 0x43, 0xE1, 0x85, 0x97, 0x43, 0xE1, + 0x85, 0x98, 0x43, 0xE1, 0x85, 0x99, 0x43, 0xE1, + 0x85, 0xA0, 0x43, 0xE1, 0x86, 0x84, 0x43, 0xE1, + // Bytes 4c0 - 4ff + 0x86, 0x85, 0x43, 0xE1, 0x86, 0x88, 0x43, 0xE1, + 0x86, 0x91, 0x43, 0xE1, 0x86, 0x92, 0x43, 0xE1, + 0x86, 0x94, 0x43, 0xE1, 0x86, 0x9E, 0x43, 0xE1, + 0x86, 0xA1, 0x43, 0xE1, 0x87, 0x87, 0x43, 0xE1, + 0x87, 0x88, 0x43, 0xE1, 0x87, 0x8C, 0x43, 0xE1, + 0x87, 0x8E, 0x43, 0xE1, 0x87, 0x93, 0x43, 0xE1, + 0x87, 0x97, 0x43, 0xE1, 0x87, 0x99, 0x43, 0xE1, + 0x87, 0x9D, 0x43, 0xE1, 0x87, 0x9F, 0x43, 0xE1, + // Bytes 500 - 53f + 0x87, 0xB1, 0x43, 0xE1, 0x87, 0xB2, 0x43, 0xE1, + 0xB4, 0x82, 0x43, 0xE1, 0xB4, 0x96, 0x43, 0xE1, + 0xB4, 0x97, 0x43, 0xE1, 0xB4, 0x9C, 0x43, 0xE1, + 0xB4, 0x9D, 0x43, 0xE1, 0xB4, 0xA5, 0x43, 0xE1, + 0xB5, 0xBB, 0x43, 0xE1, 0xB6, 0x85, 0x43, 0xE1, + 0xB6, 0x91, 0x43, 0xE2, 0x80, 0x82, 0x43, 0xE2, + 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43, 0xE2, + 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43, 0xE2, + // Bytes 540 - 57f + 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43, 0xE2, + 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43, 0xE2, + 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43, 0xE2, + 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43, 0xE2, + 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43, 0xE2, + 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43, 0xE2, + 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43, 0xE2, + 0xB1, 0xB1, 0x43, 0xE2, 0xB5, 0xA1, 0x43, 0xE3, + // Bytes 580 - 5bf + 0x80, 0x81, 0x43, 0xE3, 0x80, 0x82, 0x43, 0xE3, + 0x80, 0x88, 0x43, 0xE3, 0x80, 0x89, 0x43, 0xE3, + 0x80, 0x8A, 0x43, 0xE3, 0x80, 0x8B, 0x43, 0xE3, + 0x80, 0x8C, 0x43, 0xE3, 0x80, 0x8D, 0x43, 0xE3, + 0x80, 0x8E, 0x43, 0xE3, 0x80, 0x8F, 0x43, 0xE3, + 0x80, 0x90, 0x43, 0xE3, 0x80, 0x91, 0x43, 0xE3, + 0x80, 0x92, 0x43, 0xE3, 0x80, 0x94, 0x43, 0xE3, + 0x80, 0x95, 0x43, 0xE3, 0x80, 0x96, 0x43, 0xE3, + // Bytes 5c0 - 5ff + 0x80, 0x97, 0x43, 0xE3, 0x82, 0xA1, 0x43, 0xE3, + 0x82, 0xA2, 0x43, 0xE3, 0x82, 0xA3, 0x43, 0xE3, + 0x82, 0xA4, 0x43, 0xE3, 0x82, 0xA5, 0x43, 0xE3, + 0x82, 0xA6, 0x43, 0xE3, 0x82, 0xA7, 0x43, 0xE3, + 0x82, 0xA8, 0x43, 0xE3, 0x82, 0xA9, 0x43, 0xE3, + 0x82, 0xAA, 0x43, 0xE3, 0x82, 0xAB, 0x43, 0xE3, + 0x82, 0xAD, 0x43, 0xE3, 0x82, 0xAF, 0x43, 0xE3, + 0x82, 0xB1, 0x43, 0xE3, 0x82, 0xB3, 0x43, 0xE3, + // Bytes 600 - 63f + 0x82, 0xB5, 0x43, 0xE3, 0x82, 0xB7, 0x43, 0xE3, + 0x82, 0xB9, 0x43, 0xE3, 0x82, 0xBB, 0x43, 0xE3, + 0x82, 0xBD, 0x43, 0xE3, 0x82, 0xBF, 0x43, 0xE3, + 0x83, 0x81, 0x43, 0xE3, 0x83, 0x83, 0x43, 0xE3, + 0x83, 0x84, 0x43, 0xE3, 0x83, 0x86, 0x43, 0xE3, + 0x83, 0x88, 0x43, 0xE3, 0x83, 0x8A, 0x43, 0xE3, + 0x83, 0x8B, 0x43, 0xE3, 0x83, 0x8C, 0x43, 0xE3, + 0x83, 0x8D, 0x43, 0xE3, 0x83, 0x8E, 0x43, 0xE3, + // Bytes 640 - 67f + 0x83, 0x8F, 0x43, 0xE3, 0x83, 0x92, 0x43, 0xE3, + 0x83, 0x95, 0x43, 0xE3, 0x83, 0x98, 0x43, 0xE3, + 0x83, 0x9B, 0x43, 0xE3, 0x83, 0x9E, 0x43, 0xE3, + 0x83, 0x9F, 0x43, 0xE3, 0x83, 0xA0, 0x43, 0xE3, + 0x83, 0xA1, 0x43, 0xE3, 0x83, 0xA2, 0x43, 0xE3, + 0x83, 0xA3, 0x43, 0xE3, 0x83, 0xA4, 0x43, 0xE3, + 0x83, 0xA5, 0x43, 0xE3, 0x83, 0xA6, 0x43, 0xE3, + 0x83, 0xA7, 0x43, 0xE3, 0x83, 0xA8, 0x43, 0xE3, + // Bytes 680 - 6bf + 0x83, 0xA9, 0x43, 0xE3, 0x83, 0xAA, 0x43, 0xE3, + 0x83, 0xAB, 0x43, 0xE3, 0x83, 0xAC, 0x43, 0xE3, + 0x83, 0xAD, 0x43, 0xE3, 0x83, 0xAF, 0x43, 0xE3, + 0x83, 0xB0, 0x43, 0xE3, 0x83, 0xB1, 0x43, 0xE3, + 0x83, 0xB2, 0x43, 0xE3, 0x83, 0xB3, 0x43, 0xE3, + 0x83, 0xBB, 0x43, 0xE3, 0x83, 0xBC, 0x43, 0xE3, + 0x92, 0x9E, 0x43, 0xE3, 0x92, 0xB9, 0x43, 0xE3, + 0x92, 0xBB, 0x43, 0xE3, 0x93, 0x9F, 0x43, 0xE3, + // Bytes 6c0 - 6ff + 0x94, 0x95, 0x43, 0xE3, 0x9B, 0xAE, 0x43, 0xE3, + 0x9B, 0xBC, 0x43, 0xE3, 0x9E, 0x81, 0x43, 0xE3, + 0xA0, 0xAF, 0x43, 0xE3, 0xA1, 0xA2, 0x43, 0xE3, + 0xA1, 0xBC, 0x43, 0xE3, 0xA3, 0x87, 0x43, 0xE3, + 0xA3, 0xA3, 0x43, 0xE3, 0xA4, 0x9C, 0x43, 0xE3, + 0xA4, 0xBA, 0x43, 0xE3, 0xA8, 0xAE, 0x43, 0xE3, + 0xA9, 0xAC, 0x43, 0xE3, 0xAB, 0xA4, 0x43, 0xE3, + 0xAC, 0x88, 0x43, 0xE3, 0xAC, 0x99, 0x43, 0xE3, + // Bytes 700 - 73f + 0xAD, 0x89, 0x43, 0xE3, 0xAE, 0x9D, 0x43, 0xE3, + 0xB0, 0x98, 0x43, 0xE3, 0xB1, 0x8E, 0x43, 0xE3, + 0xB4, 0xB3, 0x43, 0xE3, 0xB6, 0x96, 0x43, 0xE3, + 0xBA, 0xAC, 0x43, 0xE3, 0xBA, 0xB8, 0x43, 0xE3, + 0xBC, 0x9B, 0x43, 0xE3, 0xBF, 0xBC, 0x43, 0xE4, + 0x80, 0x88, 0x43, 0xE4, 0x80, 0x98, 0x43, 0xE4, + 0x80, 0xB9, 0x43, 0xE4, 0x81, 0x86, 0x43, 0xE4, + 0x82, 0x96, 0x43, 0xE4, 0x83, 0xA3, 0x43, 0xE4, + // Bytes 740 - 77f + 0x84, 0xAF, 0x43, 0xE4, 0x88, 0x82, 0x43, 0xE4, + 0x88, 0xA7, 0x43, 0xE4, 0x8A, 0xA0, 0x43, 0xE4, + 0x8C, 0x81, 0x43, 0xE4, 0x8C, 0xB4, 0x43, 0xE4, + 0x8D, 0x99, 0x43, 0xE4, 0x8F, 0x95, 0x43, 0xE4, + 0x8F, 0x99, 0x43, 0xE4, 0x90, 0x8B, 0x43, 0xE4, + 0x91, 0xAB, 0x43, 0xE4, 0x94, 0xAB, 0x43, 0xE4, + 0x95, 0x9D, 0x43, 0xE4, 0x95, 0xA1, 0x43, 0xE4, + 0x95, 0xAB, 0x43, 0xE4, 0x97, 0x97, 0x43, 0xE4, + // Bytes 780 - 7bf + 0x97, 0xB9, 0x43, 0xE4, 0x98, 0xB5, 0x43, 0xE4, + 0x9A, 0xBE, 0x43, 0xE4, 0x9B, 0x87, 0x43, 0xE4, + 0xA6, 0x95, 0x43, 0xE4, 0xA7, 0xA6, 0x43, 0xE4, + 0xA9, 0xAE, 0x43, 0xE4, 0xA9, 0xB6, 0x43, 0xE4, + 0xAA, 0xB2, 0x43, 0xE4, 0xAC, 0xB3, 0x43, 0xE4, + 0xAF, 0x8E, 0x43, 0xE4, 0xB3, 0x8E, 0x43, 0xE4, + 0xB3, 0xAD, 0x43, 0xE4, 0xB3, 0xB8, 0x43, 0xE4, + 0xB5, 0x96, 0x43, 0xE4, 0xB8, 0x80, 0x43, 0xE4, + // Bytes 7c0 - 7ff + 0xB8, 0x81, 0x43, 0xE4, 0xB8, 0x83, 0x43, 0xE4, + 0xB8, 0x89, 0x43, 0xE4, 0xB8, 0x8A, 0x43, 0xE4, + 0xB8, 0x8B, 0x43, 0xE4, 0xB8, 0x8D, 0x43, 0xE4, + 0xB8, 0x99, 0x43, 0xE4, 0xB8, 0xA6, 0x43, 0xE4, + 0xB8, 0xA8, 0x43, 0xE4, 0xB8, 0xAD, 0x43, 0xE4, + 0xB8, 0xB2, 0x43, 0xE4, 0xB8, 0xB6, 0x43, 0xE4, + 0xB8, 0xB8, 0x43, 0xE4, 0xB8, 0xB9, 0x43, 0xE4, + 0xB8, 0xBD, 0x43, 0xE4, 0xB8, 0xBF, 0x43, 0xE4, + // Bytes 800 - 83f + 0xB9, 0x81, 0x43, 0xE4, 0xB9, 0x99, 0x43, 0xE4, + 0xB9, 0x9D, 0x43, 0xE4, 0xBA, 0x82, 0x43, 0xE4, + 0xBA, 0x85, 0x43, 0xE4, 0xBA, 0x86, 0x43, 0xE4, + 0xBA, 0x8C, 0x43, 0xE4, 0xBA, 0x94, 0x43, 0xE4, + 0xBA, 0xA0, 0x43, 0xE4, 0xBA, 0xA4, 0x43, 0xE4, + 0xBA, 0xAE, 0x43, 0xE4, 0xBA, 0xBA, 0x43, 0xE4, + 0xBB, 0x80, 0x43, 0xE4, 0xBB, 0x8C, 0x43, 0xE4, + 0xBB, 0xA4, 0x43, 0xE4, 0xBC, 0x81, 0x43, 0xE4, + // Bytes 840 - 87f + 0xBC, 0x91, 0x43, 0xE4, 0xBD, 0xA0, 0x43, 0xE4, + 0xBE, 0x80, 0x43, 0xE4, 0xBE, 0x86, 0x43, 0xE4, + 0xBE, 0x8B, 0x43, 0xE4, 0xBE, 0xAE, 0x43, 0xE4, + 0xBE, 0xBB, 0x43, 0xE4, 0xBE, 0xBF, 0x43, 0xE5, + 0x80, 0x82, 0x43, 0xE5, 0x80, 0xAB, 0x43, 0xE5, + 0x81, 0xBA, 0x43, 0xE5, 0x82, 0x99, 0x43, 0xE5, + 0x83, 0x8F, 0x43, 0xE5, 0x83, 0x9A, 0x43, 0xE5, + 0x83, 0xA7, 0x43, 0xE5, 0x84, 0xAA, 0x43, 0xE5, + // Bytes 880 - 8bf + 0x84, 0xBF, 0x43, 0xE5, 0x85, 0x80, 0x43, 0xE5, + 0x85, 0x85, 0x43, 0xE5, 0x85, 0x8D, 0x43, 0xE5, + 0x85, 0x94, 0x43, 0xE5, 0x85, 0xA4, 0x43, 0xE5, + 0x85, 0xA5, 0x43, 0xE5, 0x85, 0xA7, 0x43, 0xE5, + 0x85, 0xA8, 0x43, 0xE5, 0x85, 0xA9, 0x43, 0xE5, + 0x85, 0xAB, 0x43, 0xE5, 0x85, 0xAD, 0x43, 0xE5, + 0x85, 0xB7, 0x43, 0xE5, 0x86, 0x80, 0x43, 0xE5, + 0x86, 0x82, 0x43, 0xE5, 0x86, 0x8D, 0x43, 0xE5, + // Bytes 8c0 - 8ff + 0x86, 0x92, 0x43, 0xE5, 0x86, 0x95, 0x43, 0xE5, + 0x86, 0x96, 0x43, 0xE5, 0x86, 0x97, 0x43, 0xE5, + 0x86, 0x99, 0x43, 0xE5, 0x86, 0xA4, 0x43, 0xE5, + 0x86, 0xAB, 0x43, 0xE5, 0x86, 0xAC, 0x43, 0xE5, + 0x86, 0xB5, 0x43, 0xE5, 0x86, 0xB7, 0x43, 0xE5, + 0x87, 0x89, 0x43, 0xE5, 0x87, 0x8C, 0x43, 0xE5, + 0x87, 0x9C, 0x43, 0xE5, 0x87, 0x9E, 0x43, 0xE5, + 0x87, 0xA0, 0x43, 0xE5, 0x87, 0xB5, 0x43, 0xE5, + // Bytes 900 - 93f + 0x88, 0x80, 0x43, 0xE5, 0x88, 0x83, 0x43, 0xE5, + 0x88, 0x87, 0x43, 0xE5, 0x88, 0x97, 0x43, 0xE5, + 0x88, 0x9D, 0x43, 0xE5, 0x88, 0xA9, 0x43, 0xE5, + 0x88, 0xBA, 0x43, 0xE5, 0x88, 0xBB, 0x43, 0xE5, + 0x89, 0x86, 0x43, 0xE5, 0x89, 0x8D, 0x43, 0xE5, + 0x89, 0xB2, 0x43, 0xE5, 0x89, 0xB7, 0x43, 0xE5, + 0x8A, 0x89, 0x43, 0xE5, 0x8A, 0x9B, 0x43, 0xE5, + 0x8A, 0xA3, 0x43, 0xE5, 0x8A, 0xB3, 0x43, 0xE5, + // Bytes 940 - 97f + 0x8A, 0xB4, 0x43, 0xE5, 0x8B, 0x87, 0x43, 0xE5, + 0x8B, 0x89, 0x43, 0xE5, 0x8B, 0x92, 0x43, 0xE5, + 0x8B, 0x9E, 0x43, 0xE5, 0x8B, 0xA4, 0x43, 0xE5, + 0x8B, 0xB5, 0x43, 0xE5, 0x8B, 0xB9, 0x43, 0xE5, + 0x8B, 0xBA, 0x43, 0xE5, 0x8C, 0x85, 0x43, 0xE5, + 0x8C, 0x86, 0x43, 0xE5, 0x8C, 0x95, 0x43, 0xE5, + 0x8C, 0x97, 0x43, 0xE5, 0x8C, 0x9A, 0x43, 0xE5, + 0x8C, 0xB8, 0x43, 0xE5, 0x8C, 0xBB, 0x43, 0xE5, + // Bytes 980 - 9bf + 0x8C, 0xBF, 0x43, 0xE5, 0x8D, 0x81, 0x43, 0xE5, + 0x8D, 0x84, 0x43, 0xE5, 0x8D, 0x85, 0x43, 0xE5, + 0x8D, 0x89, 0x43, 0xE5, 0x8D, 0x91, 0x43, 0xE5, + 0x8D, 0x94, 0x43, 0xE5, 0x8D, 0x9A, 0x43, 0xE5, + 0x8D, 0x9C, 0x43, 0xE5, 0x8D, 0xA9, 0x43, 0xE5, + 0x8D, 0xB0, 0x43, 0xE5, 0x8D, 0xB3, 0x43, 0xE5, + 0x8D, 0xB5, 0x43, 0xE5, 0x8D, 0xBD, 0x43, 0xE5, + 0x8D, 0xBF, 0x43, 0xE5, 0x8E, 0x82, 0x43, 0xE5, + // Bytes 9c0 - 9ff + 0x8E, 0xB6, 0x43, 0xE5, 0x8F, 0x83, 0x43, 0xE5, + 0x8F, 0x88, 0x43, 0xE5, 0x8F, 0x8A, 0x43, 0xE5, + 0x8F, 0x8C, 0x43, 0xE5, 0x8F, 0x9F, 0x43, 0xE5, + 0x8F, 0xA3, 0x43, 0xE5, 0x8F, 0xA5, 0x43, 0xE5, + 0x8F, 0xAB, 0x43, 0xE5, 0x8F, 0xAF, 0x43, 0xE5, + 0x8F, 0xB1, 0x43, 0xE5, 0x8F, 0xB3, 0x43, 0xE5, + 0x90, 0x86, 0x43, 0xE5, 0x90, 0x88, 0x43, 0xE5, + 0x90, 0x8D, 0x43, 0xE5, 0x90, 0x8F, 0x43, 0xE5, + // Bytes a00 - a3f + 0x90, 0x9D, 0x43, 0xE5, 0x90, 0xB8, 0x43, 0xE5, + 0x90, 0xB9, 0x43, 0xE5, 0x91, 0x82, 0x43, 0xE5, + 0x91, 0x88, 0x43, 0xE5, 0x91, 0xA8, 0x43, 0xE5, + 0x92, 0x9E, 0x43, 0xE5, 0x92, 0xA2, 0x43, 0xE5, + 0x92, 0xBD, 0x43, 0xE5, 0x93, 0xB6, 0x43, 0xE5, + 0x94, 0x90, 0x43, 0xE5, 0x95, 0x8F, 0x43, 0xE5, + 0x95, 0x93, 0x43, 0xE5, 0x95, 0x95, 0x43, 0xE5, + 0x95, 0xA3, 0x43, 0xE5, 0x96, 0x84, 0x43, 0xE5, + // Bytes a40 - a7f + 0x96, 0x87, 0x43, 0xE5, 0x96, 0x99, 0x43, 0xE5, + 0x96, 0x9D, 0x43, 0xE5, 0x96, 0xAB, 0x43, 0xE5, + 0x96, 0xB3, 0x43, 0xE5, 0x96, 0xB6, 0x43, 0xE5, + 0x97, 0x80, 0x43, 0xE5, 0x97, 0x82, 0x43, 0xE5, + 0x97, 0xA2, 0x43, 0xE5, 0x98, 0x86, 0x43, 0xE5, + 0x99, 0x91, 0x43, 0xE5, 0x99, 0xA8, 0x43, 0xE5, + 0x99, 0xB4, 0x43, 0xE5, 0x9B, 0x97, 0x43, 0xE5, + 0x9B, 0x9B, 0x43, 0xE5, 0x9B, 0xB9, 0x43, 0xE5, + // Bytes a80 - abf + 0x9C, 0x96, 0x43, 0xE5, 0x9C, 0x97, 0x43, 0xE5, + 0x9C, 0x9F, 0x43, 0xE5, 0x9C, 0xB0, 0x43, 0xE5, + 0x9E, 0x8B, 0x43, 0xE5, 0x9F, 0x8E, 0x43, 0xE5, + 0x9F, 0xB4, 0x43, 0xE5, 0xA0, 0x8D, 0x43, 0xE5, + 0xA0, 0xB1, 0x43, 0xE5, 0xA0, 0xB2, 0x43, 0xE5, + 0xA1, 0x80, 0x43, 0xE5, 0xA1, 0x9A, 0x43, 0xE5, + 0xA1, 0x9E, 0x43, 0xE5, 0xA2, 0xA8, 0x43, 0xE5, + 0xA2, 0xAC, 0x43, 0xE5, 0xA2, 0xB3, 0x43, 0xE5, + // Bytes ac0 - aff + 0xA3, 0x98, 0x43, 0xE5, 0xA3, 0x9F, 0x43, 0xE5, + 0xA3, 0xAB, 0x43, 0xE5, 0xA3, 0xAE, 0x43, 0xE5, + 0xA3, 0xB0, 0x43, 0xE5, 0xA3, 0xB2, 0x43, 0xE5, + 0xA3, 0xB7, 0x43, 0xE5, 0xA4, 0x82, 0x43, 0xE5, + 0xA4, 0x86, 0x43, 0xE5, 0xA4, 0x8A, 0x43, 0xE5, + 0xA4, 0x95, 0x43, 0xE5, 0xA4, 0x9A, 0x43, 0xE5, + 0xA4, 0x9C, 0x43, 0xE5, 0xA4, 0xA2, 0x43, 0xE5, + 0xA4, 0xA7, 0x43, 0xE5, 0xA4, 0xA9, 0x43, 0xE5, + // Bytes b00 - b3f + 0xA5, 0x84, 0x43, 0xE5, 0xA5, 0x88, 0x43, 0xE5, + 0xA5, 0x91, 0x43, 0xE5, 0xA5, 0x94, 0x43, 0xE5, + 0xA5, 0xA2, 0x43, 0xE5, 0xA5, 0xB3, 0x43, 0xE5, + 0xA7, 0x98, 0x43, 0xE5, 0xA7, 0xAC, 0x43, 0xE5, + 0xA8, 0x9B, 0x43, 0xE5, 0xA8, 0xA7, 0x43, 0xE5, + 0xA9, 0xA2, 0x43, 0xE5, 0xA9, 0xA6, 0x43, 0xE5, + 0xAA, 0xB5, 0x43, 0xE5, 0xAC, 0x88, 0x43, 0xE5, + 0xAC, 0xA8, 0x43, 0xE5, 0xAC, 0xBE, 0x43, 0xE5, + // Bytes b40 - b7f + 0xAD, 0x90, 0x43, 0xE5, 0xAD, 0x97, 0x43, 0xE5, + 0xAD, 0xA6, 0x43, 0xE5, 0xAE, 0x80, 0x43, 0xE5, + 0xAE, 0x85, 0x43, 0xE5, 0xAE, 0x97, 0x43, 0xE5, + 0xAF, 0x83, 0x43, 0xE5, 0xAF, 0x98, 0x43, 0xE5, + 0xAF, 0xA7, 0x43, 0xE5, 0xAF, 0xAE, 0x43, 0xE5, + 0xAF, 0xB3, 0x43, 0xE5, 0xAF, 0xB8, 0x43, 0xE5, + 0xAF, 0xBF, 0x43, 0xE5, 0xB0, 0x86, 0x43, 0xE5, + 0xB0, 0x8F, 0x43, 0xE5, 0xB0, 0xA2, 0x43, 0xE5, + // Bytes b80 - bbf + 0xB0, 0xB8, 0x43, 0xE5, 0xB0, 0xBF, 0x43, 0xE5, + 0xB1, 0xA0, 0x43, 0xE5, 0xB1, 0xA2, 0x43, 0xE5, + 0xB1, 0xA4, 0x43, 0xE5, 0xB1, 0xA5, 0x43, 0xE5, + 0xB1, 0xAE, 0x43, 0xE5, 0xB1, 0xB1, 0x43, 0xE5, + 0xB2, 0x8D, 0x43, 0xE5, 0xB3, 0x80, 0x43, 0xE5, + 0xB4, 0x99, 0x43, 0xE5, 0xB5, 0x83, 0x43, 0xE5, + 0xB5, 0x90, 0x43, 0xE5, 0xB5, 0xAB, 0x43, 0xE5, + 0xB5, 0xAE, 0x43, 0xE5, 0xB5, 0xBC, 0x43, 0xE5, + // Bytes bc0 - bff + 0xB6, 0xB2, 0x43, 0xE5, 0xB6, 0xBA, 0x43, 0xE5, + 0xB7, 0x9B, 0x43, 0xE5, 0xB7, 0xA1, 0x43, 0xE5, + 0xB7, 0xA2, 0x43, 0xE5, 0xB7, 0xA5, 0x43, 0xE5, + 0xB7, 0xA6, 0x43, 0xE5, 0xB7, 0xB1, 0x43, 0xE5, + 0xB7, 0xBD, 0x43, 0xE5, 0xB7, 0xBE, 0x43, 0xE5, + 0xB8, 0xA8, 0x43, 0xE5, 0xB8, 0xBD, 0x43, 0xE5, + 0xB9, 0xA9, 0x43, 0xE5, 0xB9, 0xB2, 0x43, 0xE5, + 0xB9, 0xB4, 0x43, 0xE5, 0xB9, 0xBA, 0x43, 0xE5, + // Bytes c00 - c3f + 0xB9, 0xBC, 0x43, 0xE5, 0xB9, 0xBF, 0x43, 0xE5, + 0xBA, 0xA6, 0x43, 0xE5, 0xBA, 0xB0, 0x43, 0xE5, + 0xBA, 0xB3, 0x43, 0xE5, 0xBA, 0xB6, 0x43, 0xE5, + 0xBB, 0x89, 0x43, 0xE5, 0xBB, 0x8A, 0x43, 0xE5, + 0xBB, 0x92, 0x43, 0xE5, 0xBB, 0x93, 0x43, 0xE5, + 0xBB, 0x99, 0x43, 0xE5, 0xBB, 0xAC, 0x43, 0xE5, + 0xBB, 0xB4, 0x43, 0xE5, 0xBB, 0xBE, 0x43, 0xE5, + 0xBC, 0x84, 0x43, 0xE5, 0xBC, 0x8B, 0x43, 0xE5, + // Bytes c40 - c7f + 0xBC, 0x93, 0x43, 0xE5, 0xBC, 0xA2, 0x43, 0xE5, + 0xBD, 0x90, 0x43, 0xE5, 0xBD, 0x93, 0x43, 0xE5, + 0xBD, 0xA1, 0x43, 0xE5, 0xBD, 0xA2, 0x43, 0xE5, + 0xBD, 0xA9, 0x43, 0xE5, 0xBD, 0xAB, 0x43, 0xE5, + 0xBD, 0xB3, 0x43, 0xE5, 0xBE, 0x8B, 0x43, 0xE5, + 0xBE, 0x8C, 0x43, 0xE5, 0xBE, 0x97, 0x43, 0xE5, + 0xBE, 0x9A, 0x43, 0xE5, 0xBE, 0xA9, 0x43, 0xE5, + 0xBE, 0xAD, 0x43, 0xE5, 0xBF, 0x83, 0x43, 0xE5, + // Bytes c80 - cbf + 0xBF, 0x8D, 0x43, 0xE5, 0xBF, 0x97, 0x43, 0xE5, + 0xBF, 0xB5, 0x43, 0xE5, 0xBF, 0xB9, 0x43, 0xE6, + 0x80, 0x92, 0x43, 0xE6, 0x80, 0x9C, 0x43, 0xE6, + 0x81, 0xB5, 0x43, 0xE6, 0x82, 0x81, 0x43, 0xE6, + 0x82, 0x94, 0x43, 0xE6, 0x83, 0x87, 0x43, 0xE6, + 0x83, 0x98, 0x43, 0xE6, 0x83, 0xA1, 0x43, 0xE6, + 0x84, 0x88, 0x43, 0xE6, 0x85, 0x84, 0x43, 0xE6, + 0x85, 0x88, 0x43, 0xE6, 0x85, 0x8C, 0x43, 0xE6, + // Bytes cc0 - cff + 0x85, 0x8E, 0x43, 0xE6, 0x85, 0xA0, 0x43, 0xE6, + 0x85, 0xA8, 0x43, 0xE6, 0x85, 0xBA, 0x43, 0xE6, + 0x86, 0x8E, 0x43, 0xE6, 0x86, 0x90, 0x43, 0xE6, + 0x86, 0xA4, 0x43, 0xE6, 0x86, 0xAF, 0x43, 0xE6, + 0x86, 0xB2, 0x43, 0xE6, 0x87, 0x9E, 0x43, 0xE6, + 0x87, 0xB2, 0x43, 0xE6, 0x87, 0xB6, 0x43, 0xE6, + 0x88, 0x80, 0x43, 0xE6, 0x88, 0x88, 0x43, 0xE6, + 0x88, 0x90, 0x43, 0xE6, 0x88, 0x9B, 0x43, 0xE6, + // Bytes d00 - d3f + 0x88, 0xAE, 0x43, 0xE6, 0x88, 0xB4, 0x43, 0xE6, + 0x88, 0xB6, 0x43, 0xE6, 0x89, 0x8B, 0x43, 0xE6, + 0x89, 0x93, 0x43, 0xE6, 0x89, 0x9D, 0x43, 0xE6, + 0x8A, 0x95, 0x43, 0xE6, 0x8A, 0xB1, 0x43, 0xE6, + 0x8B, 0x89, 0x43, 0xE6, 0x8B, 0x8F, 0x43, 0xE6, + 0x8B, 0x93, 0x43, 0xE6, 0x8B, 0x94, 0x43, 0xE6, + 0x8B, 0xBC, 0x43, 0xE6, 0x8B, 0xBE, 0x43, 0xE6, + 0x8C, 0x87, 0x43, 0xE6, 0x8C, 0xBD, 0x43, 0xE6, + // Bytes d40 - d7f + 0x8D, 0x90, 0x43, 0xE6, 0x8D, 0x95, 0x43, 0xE6, + 0x8D, 0xA8, 0x43, 0xE6, 0x8D, 0xBB, 0x43, 0xE6, + 0x8E, 0x83, 0x43, 0xE6, 0x8E, 0xA0, 0x43, 0xE6, + 0x8E, 0xA9, 0x43, 0xE6, 0x8F, 0x84, 0x43, 0xE6, + 0x8F, 0x85, 0x43, 0xE6, 0x8F, 0xA4, 0x43, 0xE6, + 0x90, 0x9C, 0x43, 0xE6, 0x90, 0xA2, 0x43, 0xE6, + 0x91, 0x92, 0x43, 0xE6, 0x91, 0xA9, 0x43, 0xE6, + 0x91, 0xB7, 0x43, 0xE6, 0x91, 0xBE, 0x43, 0xE6, + // Bytes d80 - dbf + 0x92, 0x9A, 0x43, 0xE6, 0x92, 0x9D, 0x43, 0xE6, + 0x93, 0x84, 0x43, 0xE6, 0x94, 0xAF, 0x43, 0xE6, + 0x94, 0xB4, 0x43, 0xE6, 0x95, 0x8F, 0x43, 0xE6, + 0x95, 0x96, 0x43, 0xE6, 0x95, 0xAC, 0x43, 0xE6, + 0x95, 0xB8, 0x43, 0xE6, 0x96, 0x87, 0x43, 0xE6, + 0x96, 0x97, 0x43, 0xE6, 0x96, 0x99, 0x43, 0xE6, + 0x96, 0xA4, 0x43, 0xE6, 0x96, 0xB0, 0x43, 0xE6, + 0x96, 0xB9, 0x43, 0xE6, 0x97, 0x85, 0x43, 0xE6, + // Bytes dc0 - dff + 0x97, 0xA0, 0x43, 0xE6, 0x97, 0xA2, 0x43, 0xE6, + 0x97, 0xA3, 0x43, 0xE6, 0x97, 0xA5, 0x43, 0xE6, + 0x98, 0x93, 0x43, 0xE6, 0x98, 0xA0, 0x43, 0xE6, + 0x99, 0x89, 0x43, 0xE6, 0x99, 0xB4, 0x43, 0xE6, + 0x9A, 0x88, 0x43, 0xE6, 0x9A, 0x91, 0x43, 0xE6, + 0x9A, 0x9C, 0x43, 0xE6, 0x9A, 0xB4, 0x43, 0xE6, + 0x9B, 0x86, 0x43, 0xE6, 0x9B, 0xB0, 0x43, 0xE6, + 0x9B, 0xB4, 0x43, 0xE6, 0x9B, 0xB8, 0x43, 0xE6, + // Bytes e00 - e3f + 0x9C, 0x80, 0x43, 0xE6, 0x9C, 0x88, 0x43, 0xE6, + 0x9C, 0x89, 0x43, 0xE6, 0x9C, 0x97, 0x43, 0xE6, + 0x9C, 0x9B, 0x43, 0xE6, 0x9C, 0xA1, 0x43, 0xE6, + 0x9C, 0xA8, 0x43, 0xE6, 0x9D, 0x8E, 0x43, 0xE6, + 0x9D, 0x93, 0x43, 0xE6, 0x9D, 0x96, 0x43, 0xE6, + 0x9D, 0x9E, 0x43, 0xE6, 0x9D, 0xBB, 0x43, 0xE6, + 0x9E, 0x85, 0x43, 0xE6, 0x9E, 0x97, 0x43, 0xE6, + 0x9F, 0xB3, 0x43, 0xE6, 0x9F, 0xBA, 0x43, 0xE6, + // Bytes e40 - e7f + 0xA0, 0x97, 0x43, 0xE6, 0xA0, 0x9F, 0x43, 0xE6, + 0xA0, 0xAA, 0x43, 0xE6, 0xA1, 0x92, 0x43, 0xE6, + 0xA2, 0x81, 0x43, 0xE6, 0xA2, 0x85, 0x43, 0xE6, + 0xA2, 0x8E, 0x43, 0xE6, 0xA2, 0xA8, 0x43, 0xE6, + 0xA4, 0x94, 0x43, 0xE6, 0xA5, 0x82, 0x43, 0xE6, + 0xA6, 0xA3, 0x43, 0xE6, 0xA7, 0xAA, 0x43, 0xE6, + 0xA8, 0x82, 0x43, 0xE6, 0xA8, 0x93, 0x43, 0xE6, + 0xAA, 0xA8, 0x43, 0xE6, 0xAB, 0x93, 0x43, 0xE6, + // Bytes e80 - ebf + 0xAB, 0x9B, 0x43, 0xE6, 0xAC, 0x84, 0x43, 0xE6, + 0xAC, 0xA0, 0x43, 0xE6, 0xAC, 0xA1, 0x43, 0xE6, + 0xAD, 0x94, 0x43, 0xE6, 0xAD, 0xA2, 0x43, 0xE6, + 0xAD, 0xA3, 0x43, 0xE6, 0xAD, 0xB2, 0x43, 0xE6, + 0xAD, 0xB7, 0x43, 0xE6, 0xAD, 0xB9, 0x43, 0xE6, + 0xAE, 0x9F, 0x43, 0xE6, 0xAE, 0xAE, 0x43, 0xE6, + 0xAE, 0xB3, 0x43, 0xE6, 0xAE, 0xBA, 0x43, 0xE6, + 0xAE, 0xBB, 0x43, 0xE6, 0xAF, 0x8B, 0x43, 0xE6, + // Bytes ec0 - eff + 0xAF, 0x8D, 0x43, 0xE6, 0xAF, 0x94, 0x43, 0xE6, + 0xAF, 0x9B, 0x43, 0xE6, 0xB0, 0x8F, 0x43, 0xE6, + 0xB0, 0x94, 0x43, 0xE6, 0xB0, 0xB4, 0x43, 0xE6, + 0xB1, 0x8E, 0x43, 0xE6, 0xB1, 0xA7, 0x43, 0xE6, + 0xB2, 0x88, 0x43, 0xE6, 0xB2, 0xBF, 0x43, 0xE6, + 0xB3, 0x8C, 0x43, 0xE6, 0xB3, 0x8D, 0x43, 0xE6, + 0xB3, 0xA5, 0x43, 0xE6, 0xB3, 0xA8, 0x43, 0xE6, + 0xB4, 0x96, 0x43, 0xE6, 0xB4, 0x9B, 0x43, 0xE6, + // Bytes f00 - f3f + 0xB4, 0x9E, 0x43, 0xE6, 0xB4, 0xB4, 0x43, 0xE6, + 0xB4, 0xBE, 0x43, 0xE6, 0xB5, 0x81, 0x43, 0xE6, + 0xB5, 0xA9, 0x43, 0xE6, 0xB5, 0xAA, 0x43, 0xE6, + 0xB5, 0xB7, 0x43, 0xE6, 0xB5, 0xB8, 0x43, 0xE6, + 0xB6, 0x85, 0x43, 0xE6, 0xB7, 0x8B, 0x43, 0xE6, + 0xB7, 0x9A, 0x43, 0xE6, 0xB7, 0xAA, 0x43, 0xE6, + 0xB7, 0xB9, 0x43, 0xE6, 0xB8, 0x9A, 0x43, 0xE6, + 0xB8, 0xAF, 0x43, 0xE6, 0xB9, 0xAE, 0x43, 0xE6, + // Bytes f40 - f7f + 0xBA, 0x80, 0x43, 0xE6, 0xBA, 0x9C, 0x43, 0xE6, + 0xBA, 0xBA, 0x43, 0xE6, 0xBB, 0x87, 0x43, 0xE6, + 0xBB, 0x8B, 0x43, 0xE6, 0xBB, 0x91, 0x43, 0xE6, + 0xBB, 0x9B, 0x43, 0xE6, 0xBC, 0x8F, 0x43, 0xE6, + 0xBC, 0x94, 0x43, 0xE6, 0xBC, 0xA2, 0x43, 0xE6, + 0xBC, 0xA3, 0x43, 0xE6, 0xBD, 0xAE, 0x43, 0xE6, + 0xBF, 0x86, 0x43, 0xE6, 0xBF, 0xAB, 0x43, 0xE6, + 0xBF, 0xBE, 0x43, 0xE7, 0x80, 0x9B, 0x43, 0xE7, + // Bytes f80 - fbf + 0x80, 0x9E, 0x43, 0xE7, 0x80, 0xB9, 0x43, 0xE7, + 0x81, 0x8A, 0x43, 0xE7, 0x81, 0xAB, 0x43, 0xE7, + 0x81, 0xB0, 0x43, 0xE7, 0x81, 0xB7, 0x43, 0xE7, + 0x81, 0xBD, 0x43, 0xE7, 0x82, 0x99, 0x43, 0xE7, + 0x82, 0xAD, 0x43, 0xE7, 0x83, 0x88, 0x43, 0xE7, + 0x83, 0x99, 0x43, 0xE7, 0x84, 0xA1, 0x43, 0xE7, + 0x85, 0x85, 0x43, 0xE7, 0x85, 0x89, 0x43, 0xE7, + 0x85, 0xAE, 0x43, 0xE7, 0x86, 0x9C, 0x43, 0xE7, + // Bytes fc0 - fff + 0x87, 0x8E, 0x43, 0xE7, 0x87, 0x90, 0x43, 0xE7, + 0x88, 0x90, 0x43, 0xE7, 0x88, 0x9B, 0x43, 0xE7, + 0x88, 0xA8, 0x43, 0xE7, 0x88, 0xAA, 0x43, 0xE7, + 0x88, 0xAB, 0x43, 0xE7, 0x88, 0xB5, 0x43, 0xE7, + 0x88, 0xB6, 0x43, 0xE7, 0x88, 0xBB, 0x43, 0xE7, + 0x88, 0xBF, 0x43, 0xE7, 0x89, 0x87, 0x43, 0xE7, + 0x89, 0x90, 0x43, 0xE7, 0x89, 0x99, 0x43, 0xE7, + 0x89, 0x9B, 0x43, 0xE7, 0x89, 0xA2, 0x43, 0xE7, + // Bytes 1000 - 103f + 0x89, 0xB9, 0x43, 0xE7, 0x8A, 0x80, 0x43, 0xE7, + 0x8A, 0x95, 0x43, 0xE7, 0x8A, 0xAC, 0x43, 0xE7, + 0x8A, 0xAF, 0x43, 0xE7, 0x8B, 0x80, 0x43, 0xE7, + 0x8B, 0xBC, 0x43, 0xE7, 0x8C, 0xAA, 0x43, 0xE7, + 0x8D, 0xB5, 0x43, 0xE7, 0x8D, 0xBA, 0x43, 0xE7, + 0x8E, 0x84, 0x43, 0xE7, 0x8E, 0x87, 0x43, 0xE7, + 0x8E, 0x89, 0x43, 0xE7, 0x8E, 0x8B, 0x43, 0xE7, + 0x8E, 0xA5, 0x43, 0xE7, 0x8E, 0xB2, 0x43, 0xE7, + // Bytes 1040 - 107f + 0x8F, 0x9E, 0x43, 0xE7, 0x90, 0x86, 0x43, 0xE7, + 0x90, 0x89, 0x43, 0xE7, 0x90, 0xA2, 0x43, 0xE7, + 0x91, 0x87, 0x43, 0xE7, 0x91, 0x9C, 0x43, 0xE7, + 0x91, 0xA9, 0x43, 0xE7, 0x91, 0xB1, 0x43, 0xE7, + 0x92, 0x85, 0x43, 0xE7, 0x92, 0x89, 0x43, 0xE7, + 0x92, 0x98, 0x43, 0xE7, 0x93, 0x8A, 0x43, 0xE7, + 0x93, 0x9C, 0x43, 0xE7, 0x93, 0xA6, 0x43, 0xE7, + 0x94, 0x86, 0x43, 0xE7, 0x94, 0x98, 0x43, 0xE7, + // Bytes 1080 - 10bf + 0x94, 0x9F, 0x43, 0xE7, 0x94, 0xA4, 0x43, 0xE7, + 0x94, 0xA8, 0x43, 0xE7, 0x94, 0xB0, 0x43, 0xE7, + 0x94, 0xB2, 0x43, 0xE7, 0x94, 0xB3, 0x43, 0xE7, + 0x94, 0xB7, 0x43, 0xE7, 0x94, 0xBB, 0x43, 0xE7, + 0x94, 0xBE, 0x43, 0xE7, 0x95, 0x99, 0x43, 0xE7, + 0x95, 0xA5, 0x43, 0xE7, 0x95, 0xB0, 0x43, 0xE7, + 0x96, 0x8B, 0x43, 0xE7, 0x96, 0x92, 0x43, 0xE7, + 0x97, 0xA2, 0x43, 0xE7, 0x98, 0x90, 0x43, 0xE7, + // Bytes 10c0 - 10ff + 0x98, 0x9D, 0x43, 0xE7, 0x98, 0x9F, 0x43, 0xE7, + 0x99, 0x82, 0x43, 0xE7, 0x99, 0xA9, 0x43, 0xE7, + 0x99, 0xB6, 0x43, 0xE7, 0x99, 0xBD, 0x43, 0xE7, + 0x9A, 0xAE, 0x43, 0xE7, 0x9A, 0xBF, 0x43, 0xE7, + 0x9B, 0x8A, 0x43, 0xE7, 0x9B, 0x9B, 0x43, 0xE7, + 0x9B, 0xA3, 0x43, 0xE7, 0x9B, 0xA7, 0x43, 0xE7, + 0x9B, 0xAE, 0x43, 0xE7, 0x9B, 0xB4, 0x43, 0xE7, + 0x9C, 0x81, 0x43, 0xE7, 0x9C, 0x9E, 0x43, 0xE7, + // Bytes 1100 - 113f + 0x9C, 0x9F, 0x43, 0xE7, 0x9D, 0x80, 0x43, 0xE7, + 0x9D, 0x8A, 0x43, 0xE7, 0x9E, 0x8B, 0x43, 0xE7, + 0x9E, 0xA7, 0x43, 0xE7, 0x9F, 0x9B, 0x43, 0xE7, + 0x9F, 0xA2, 0x43, 0xE7, 0x9F, 0xB3, 0x43, 0xE7, + 0xA1, 0x8E, 0x43, 0xE7, 0xA1, 0xAB, 0x43, 0xE7, + 0xA2, 0x8C, 0x43, 0xE7, 0xA2, 0x91, 0x43, 0xE7, + 0xA3, 0x8A, 0x43, 0xE7, 0xA3, 0x8C, 0x43, 0xE7, + 0xA3, 0xBB, 0x43, 0xE7, 0xA4, 0xAA, 0x43, 0xE7, + // Bytes 1140 - 117f + 0xA4, 0xBA, 0x43, 0xE7, 0xA4, 0xBC, 0x43, 0xE7, + 0xA4, 0xBE, 0x43, 0xE7, 0xA5, 0x88, 0x43, 0xE7, + 0xA5, 0x89, 0x43, 0xE7, 0xA5, 0x90, 0x43, 0xE7, + 0xA5, 0x96, 0x43, 0xE7, 0xA5, 0x9D, 0x43, 0xE7, + 0xA5, 0x9E, 0x43, 0xE7, 0xA5, 0xA5, 0x43, 0xE7, + 0xA5, 0xBF, 0x43, 0xE7, 0xA6, 0x81, 0x43, 0xE7, + 0xA6, 0x8D, 0x43, 0xE7, 0xA6, 0x8E, 0x43, 0xE7, + 0xA6, 0x8F, 0x43, 0xE7, 0xA6, 0xAE, 0x43, 0xE7, + // Bytes 1180 - 11bf + 0xA6, 0xB8, 0x43, 0xE7, 0xA6, 0xBE, 0x43, 0xE7, + 0xA7, 0x8A, 0x43, 0xE7, 0xA7, 0x98, 0x43, 0xE7, + 0xA7, 0xAB, 0x43, 0xE7, 0xA8, 0x9C, 0x43, 0xE7, + 0xA9, 0x80, 0x43, 0xE7, 0xA9, 0x8A, 0x43, 0xE7, + 0xA9, 0x8F, 0x43, 0xE7, 0xA9, 0xB4, 0x43, 0xE7, + 0xA9, 0xBA, 0x43, 0xE7, 0xAA, 0x81, 0x43, 0xE7, + 0xAA, 0xB1, 0x43, 0xE7, 0xAB, 0x8B, 0x43, 0xE7, + 0xAB, 0xAE, 0x43, 0xE7, 0xAB, 0xB9, 0x43, 0xE7, + // Bytes 11c0 - 11ff + 0xAC, 0xA0, 0x43, 0xE7, 0xAE, 0x8F, 0x43, 0xE7, + 0xAF, 0x80, 0x43, 0xE7, 0xAF, 0x86, 0x43, 0xE7, + 0xAF, 0x89, 0x43, 0xE7, 0xB0, 0xBE, 0x43, 0xE7, + 0xB1, 0xA0, 0x43, 0xE7, 0xB1, 0xB3, 0x43, 0xE7, + 0xB1, 0xBB, 0x43, 0xE7, 0xB2, 0x92, 0x43, 0xE7, + 0xB2, 0xBE, 0x43, 0xE7, 0xB3, 0x92, 0x43, 0xE7, + 0xB3, 0x96, 0x43, 0xE7, 0xB3, 0xA3, 0x43, 0xE7, + 0xB3, 0xA7, 0x43, 0xE7, 0xB3, 0xA8, 0x43, 0xE7, + // Bytes 1200 - 123f + 0xB3, 0xB8, 0x43, 0xE7, 0xB4, 0x80, 0x43, 0xE7, + 0xB4, 0x90, 0x43, 0xE7, 0xB4, 0xA2, 0x43, 0xE7, + 0xB4, 0xAF, 0x43, 0xE7, 0xB5, 0x82, 0x43, 0xE7, + 0xB5, 0x9B, 0x43, 0xE7, 0xB5, 0xA3, 0x43, 0xE7, + 0xB6, 0xA0, 0x43, 0xE7, 0xB6, 0xBE, 0x43, 0xE7, + 0xB7, 0x87, 0x43, 0xE7, 0xB7, 0xB4, 0x43, 0xE7, + 0xB8, 0x82, 0x43, 0xE7, 0xB8, 0x89, 0x43, 0xE7, + 0xB8, 0xB7, 0x43, 0xE7, 0xB9, 0x81, 0x43, 0xE7, + // Bytes 1240 - 127f + 0xB9, 0x85, 0x43, 0xE7, 0xBC, 0xB6, 0x43, 0xE7, + 0xBC, 0xBE, 0x43, 0xE7, 0xBD, 0x91, 0x43, 0xE7, + 0xBD, 0xB2, 0x43, 0xE7, 0xBD, 0xB9, 0x43, 0xE7, + 0xBD, 0xBA, 0x43, 0xE7, 0xBE, 0x85, 0x43, 0xE7, + 0xBE, 0x8A, 0x43, 0xE7, 0xBE, 0x95, 0x43, 0xE7, + 0xBE, 0x9A, 0x43, 0xE7, 0xBE, 0xBD, 0x43, 0xE7, + 0xBF, 0xBA, 0x43, 0xE8, 0x80, 0x81, 0x43, 0xE8, + 0x80, 0x85, 0x43, 0xE8, 0x80, 0x8C, 0x43, 0xE8, + // Bytes 1280 - 12bf + 0x80, 0x92, 0x43, 0xE8, 0x80, 0xB3, 0x43, 0xE8, + 0x81, 0x86, 0x43, 0xE8, 0x81, 0xA0, 0x43, 0xE8, + 0x81, 0xAF, 0x43, 0xE8, 0x81, 0xB0, 0x43, 0xE8, + 0x81, 0xBE, 0x43, 0xE8, 0x81, 0xBF, 0x43, 0xE8, + 0x82, 0x89, 0x43, 0xE8, 0x82, 0x8B, 0x43, 0xE8, + 0x82, 0xAD, 0x43, 0xE8, 0x82, 0xB2, 0x43, 0xE8, + 0x84, 0x83, 0x43, 0xE8, 0x84, 0xBE, 0x43, 0xE8, + 0x87, 0x98, 0x43, 0xE8, 0x87, 0xA3, 0x43, 0xE8, + // Bytes 12c0 - 12ff + 0x87, 0xA8, 0x43, 0xE8, 0x87, 0xAA, 0x43, 0xE8, + 0x87, 0xAD, 0x43, 0xE8, 0x87, 0xB3, 0x43, 0xE8, + 0x87, 0xBC, 0x43, 0xE8, 0x88, 0x81, 0x43, 0xE8, + 0x88, 0x84, 0x43, 0xE8, 0x88, 0x8C, 0x43, 0xE8, + 0x88, 0x98, 0x43, 0xE8, 0x88, 0x9B, 0x43, 0xE8, + 0x88, 0x9F, 0x43, 0xE8, 0x89, 0xAE, 0x43, 0xE8, + 0x89, 0xAF, 0x43, 0xE8, 0x89, 0xB2, 0x43, 0xE8, + 0x89, 0xB8, 0x43, 0xE8, 0x89, 0xB9, 0x43, 0xE8, + // Bytes 1300 - 133f + 0x8A, 0x8B, 0x43, 0xE8, 0x8A, 0x91, 0x43, 0xE8, + 0x8A, 0x9D, 0x43, 0xE8, 0x8A, 0xB1, 0x43, 0xE8, + 0x8A, 0xB3, 0x43, 0xE8, 0x8A, 0xBD, 0x43, 0xE8, + 0x8B, 0xA5, 0x43, 0xE8, 0x8B, 0xA6, 0x43, 0xE8, + 0x8C, 0x9D, 0x43, 0xE8, 0x8C, 0xA3, 0x43, 0xE8, + 0x8C, 0xB6, 0x43, 0xE8, 0x8D, 0x92, 0x43, 0xE8, + 0x8D, 0x93, 0x43, 0xE8, 0x8D, 0xA3, 0x43, 0xE8, + 0x8E, 0xAD, 0x43, 0xE8, 0x8E, 0xBD, 0x43, 0xE8, + // Bytes 1340 - 137f + 0x8F, 0x89, 0x43, 0xE8, 0x8F, 0x8A, 0x43, 0xE8, + 0x8F, 0x8C, 0x43, 0xE8, 0x8F, 0x9C, 0x43, 0xE8, + 0x8F, 0xA7, 0x43, 0xE8, 0x8F, 0xAF, 0x43, 0xE8, + 0x8F, 0xB1, 0x43, 0xE8, 0x90, 0xBD, 0x43, 0xE8, + 0x91, 0x89, 0x43, 0xE8, 0x91, 0x97, 0x43, 0xE8, + 0x93, 0xAE, 0x43, 0xE8, 0x93, 0xB1, 0x43, 0xE8, + 0x93, 0xB3, 0x43, 0xE8, 0x93, 0xBC, 0x43, 0xE8, + 0x94, 0x96, 0x43, 0xE8, 0x95, 0xA4, 0x43, 0xE8, + // Bytes 1380 - 13bf + 0x97, 0x8D, 0x43, 0xE8, 0x97, 0xBA, 0x43, 0xE8, + 0x98, 0x86, 0x43, 0xE8, 0x98, 0x92, 0x43, 0xE8, + 0x98, 0xAD, 0x43, 0xE8, 0x98, 0xBF, 0x43, 0xE8, + 0x99, 0x8D, 0x43, 0xE8, 0x99, 0x90, 0x43, 0xE8, + 0x99, 0x9C, 0x43, 0xE8, 0x99, 0xA7, 0x43, 0xE8, + 0x99, 0xA9, 0x43, 0xE8, 0x99, 0xAB, 0x43, 0xE8, + 0x9A, 0x88, 0x43, 0xE8, 0x9A, 0xA9, 0x43, 0xE8, + 0x9B, 0xA2, 0x43, 0xE8, 0x9C, 0x8E, 0x43, 0xE8, + // Bytes 13c0 - 13ff + 0x9C, 0xA8, 0x43, 0xE8, 0x9D, 0xAB, 0x43, 0xE8, + 0x9D, 0xB9, 0x43, 0xE8, 0x9E, 0x86, 0x43, 0xE8, + 0x9E, 0xBA, 0x43, 0xE8, 0x9F, 0xA1, 0x43, 0xE8, + 0xA0, 0x81, 0x43, 0xE8, 0xA0, 0x9F, 0x43, 0xE8, + 0xA1, 0x80, 0x43, 0xE8, 0xA1, 0x8C, 0x43, 0xE8, + 0xA1, 0xA0, 0x43, 0xE8, 0xA1, 0xA3, 0x43, 0xE8, + 0xA3, 0x82, 0x43, 0xE8, 0xA3, 0x8F, 0x43, 0xE8, + 0xA3, 0x97, 0x43, 0xE8, 0xA3, 0x9E, 0x43, 0xE8, + // Bytes 1400 - 143f + 0xA3, 0xA1, 0x43, 0xE8, 0xA3, 0xB8, 0x43, 0xE8, + 0xA3, 0xBA, 0x43, 0xE8, 0xA4, 0x90, 0x43, 0xE8, + 0xA5, 0x81, 0x43, 0xE8, 0xA5, 0xA4, 0x43, 0xE8, + 0xA5, 0xBE, 0x43, 0xE8, 0xA6, 0x86, 0x43, 0xE8, + 0xA6, 0x8B, 0x43, 0xE8, 0xA6, 0x96, 0x43, 0xE8, + 0xA7, 0x92, 0x43, 0xE8, 0xA7, 0xA3, 0x43, 0xE8, + 0xA8, 0x80, 0x43, 0xE8, 0xAA, 0xA0, 0x43, 0xE8, + 0xAA, 0xAA, 0x43, 0xE8, 0xAA, 0xBF, 0x43, 0xE8, + // Bytes 1440 - 147f + 0xAB, 0x8B, 0x43, 0xE8, 0xAB, 0x92, 0x43, 0xE8, + 0xAB, 0x96, 0x43, 0xE8, 0xAB, 0xAD, 0x43, 0xE8, + 0xAB, 0xB8, 0x43, 0xE8, 0xAB, 0xBE, 0x43, 0xE8, + 0xAC, 0x81, 0x43, 0xE8, 0xAC, 0xB9, 0x43, 0xE8, + 0xAD, 0x98, 0x43, 0xE8, 0xAE, 0x80, 0x43, 0xE8, + 0xAE, 0x8A, 0x43, 0xE8, 0xB0, 0xB7, 0x43, 0xE8, + 0xB1, 0x86, 0x43, 0xE8, 0xB1, 0x88, 0x43, 0xE8, + 0xB1, 0x95, 0x43, 0xE8, 0xB1, 0xB8, 0x43, 0xE8, + // Bytes 1480 - 14bf + 0xB2, 0x9D, 0x43, 0xE8, 0xB2, 0xA1, 0x43, 0xE8, + 0xB2, 0xA9, 0x43, 0xE8, 0xB2, 0xAB, 0x43, 0xE8, + 0xB3, 0x81, 0x43, 0xE8, 0xB3, 0x82, 0x43, 0xE8, + 0xB3, 0x87, 0x43, 0xE8, 0xB3, 0x88, 0x43, 0xE8, + 0xB3, 0x93, 0x43, 0xE8, 0xB4, 0x88, 0x43, 0xE8, + 0xB4, 0x9B, 0x43, 0xE8, 0xB5, 0xA4, 0x43, 0xE8, + 0xB5, 0xB0, 0x43, 0xE8, 0xB5, 0xB7, 0x43, 0xE8, + 0xB6, 0xB3, 0x43, 0xE8, 0xB6, 0xBC, 0x43, 0xE8, + // Bytes 14c0 - 14ff + 0xB7, 0x8B, 0x43, 0xE8, 0xB7, 0xAF, 0x43, 0xE8, + 0xB7, 0xB0, 0x43, 0xE8, 0xBA, 0xAB, 0x43, 0xE8, + 0xBB, 0x8A, 0x43, 0xE8, 0xBB, 0x94, 0x43, 0xE8, + 0xBC, 0xA6, 0x43, 0xE8, 0xBC, 0xAA, 0x43, 0xE8, + 0xBC, 0xB8, 0x43, 0xE8, 0xBC, 0xBB, 0x43, 0xE8, + 0xBD, 0xA2, 0x43, 0xE8, 0xBE, 0x9B, 0x43, 0xE8, + 0xBE, 0x9E, 0x43, 0xE8, 0xBE, 0xB0, 0x43, 0xE8, + 0xBE, 0xB5, 0x43, 0xE8, 0xBE, 0xB6, 0x43, 0xE9, + // Bytes 1500 - 153f + 0x80, 0xA3, 0x43, 0xE9, 0x80, 0xB8, 0x43, 0xE9, + 0x81, 0x8A, 0x43, 0xE9, 0x81, 0xA9, 0x43, 0xE9, + 0x81, 0xB2, 0x43, 0xE9, 0x81, 0xBC, 0x43, 0xE9, + 0x82, 0x8F, 0x43, 0xE9, 0x82, 0x91, 0x43, 0xE9, + 0x82, 0x94, 0x43, 0xE9, 0x83, 0x8E, 0x43, 0xE9, + 0x83, 0x9E, 0x43, 0xE9, 0x83, 0xB1, 0x43, 0xE9, + 0x83, 0xBD, 0x43, 0xE9, 0x84, 0x91, 0x43, 0xE9, + 0x84, 0x9B, 0x43, 0xE9, 0x85, 0x89, 0x43, 0xE9, + // Bytes 1540 - 157f + 0x85, 0x8D, 0x43, 0xE9, 0x85, 0xAA, 0x43, 0xE9, + 0x86, 0x99, 0x43, 0xE9, 0x86, 0xB4, 0x43, 0xE9, + 0x87, 0x86, 0x43, 0xE9, 0x87, 0x8C, 0x43, 0xE9, + 0x87, 0x8F, 0x43, 0xE9, 0x87, 0x91, 0x43, 0xE9, + 0x88, 0xB4, 0x43, 0xE9, 0x88, 0xB8, 0x43, 0xE9, + 0x89, 0xB6, 0x43, 0xE9, 0x89, 0xBC, 0x43, 0xE9, + 0x8B, 0x97, 0x43, 0xE9, 0x8B, 0x98, 0x43, 0xE9, + 0x8C, 0x84, 0x43, 0xE9, 0x8D, 0x8A, 0x43, 0xE9, + // Bytes 1580 - 15bf + 0x8F, 0xB9, 0x43, 0xE9, 0x90, 0x95, 0x43, 0xE9, + 0x95, 0xB7, 0x43, 0xE9, 0x96, 0x80, 0x43, 0xE9, + 0x96, 0x8B, 0x43, 0xE9, 0x96, 0xAD, 0x43, 0xE9, + 0x96, 0xB7, 0x43, 0xE9, 0x98, 0x9C, 0x43, 0xE9, + 0x98, 0xAE, 0x43, 0xE9, 0x99, 0x8B, 0x43, 0xE9, + 0x99, 0x8D, 0x43, 0xE9, 0x99, 0xB5, 0x43, 0xE9, + 0x99, 0xB8, 0x43, 0xE9, 0x99, 0xBC, 0x43, 0xE9, + 0x9A, 0x86, 0x43, 0xE9, 0x9A, 0xA3, 0x43, 0xE9, + // Bytes 15c0 - 15ff + 0x9A, 0xB6, 0x43, 0xE9, 0x9A, 0xB7, 0x43, 0xE9, + 0x9A, 0xB8, 0x43, 0xE9, 0x9A, 0xB9, 0x43, 0xE9, + 0x9B, 0x83, 0x43, 0xE9, 0x9B, 0xA2, 0x43, 0xE9, + 0x9B, 0xA3, 0x43, 0xE9, 0x9B, 0xA8, 0x43, 0xE9, + 0x9B, 0xB6, 0x43, 0xE9, 0x9B, 0xB7, 0x43, 0xE9, + 0x9C, 0xA3, 0x43, 0xE9, 0x9C, 0xB2, 0x43, 0xE9, + 0x9D, 0x88, 0x43, 0xE9, 0x9D, 0x91, 0x43, 0xE9, + 0x9D, 0x96, 0x43, 0xE9, 0x9D, 0x9E, 0x43, 0xE9, + // Bytes 1600 - 163f + 0x9D, 0xA2, 0x43, 0xE9, 0x9D, 0xA9, 0x43, 0xE9, + 0x9F, 0x8B, 0x43, 0xE9, 0x9F, 0x9B, 0x43, 0xE9, + 0x9F, 0xA0, 0x43, 0xE9, 0x9F, 0xAD, 0x43, 0xE9, + 0x9F, 0xB3, 0x43, 0xE9, 0x9F, 0xBF, 0x43, 0xE9, + 0xA0, 0x81, 0x43, 0xE9, 0xA0, 0x85, 0x43, 0xE9, + 0xA0, 0x8B, 0x43, 0xE9, 0xA0, 0x98, 0x43, 0xE9, + 0xA0, 0xA9, 0x43, 0xE9, 0xA0, 0xBB, 0x43, 0xE9, + 0xA1, 0x9E, 0x43, 0xE9, 0xA2, 0xA8, 0x43, 0xE9, + // Bytes 1640 - 167f + 0xA3, 0x9B, 0x43, 0xE9, 0xA3, 0x9F, 0x43, 0xE9, + 0xA3, 0xA2, 0x43, 0xE9, 0xA3, 0xAF, 0x43, 0xE9, + 0xA3, 0xBC, 0x43, 0xE9, 0xA4, 0xA8, 0x43, 0xE9, + 0xA4, 0xA9, 0x43, 0xE9, 0xA6, 0x96, 0x43, 0xE9, + 0xA6, 0x99, 0x43, 0xE9, 0xA6, 0xA7, 0x43, 0xE9, + 0xA6, 0xAC, 0x43, 0xE9, 0xA7, 0x82, 0x43, 0xE9, + 0xA7, 0xB1, 0x43, 0xE9, 0xA7, 0xBE, 0x43, 0xE9, + 0xA9, 0xAA, 0x43, 0xE9, 0xAA, 0xA8, 0x43, 0xE9, + // Bytes 1680 - 16bf + 0xAB, 0x98, 0x43, 0xE9, 0xAB, 0x9F, 0x43, 0xE9, + 0xAC, 0x92, 0x43, 0xE9, 0xAC, 0xA5, 0x43, 0xE9, + 0xAC, 0xAF, 0x43, 0xE9, 0xAC, 0xB2, 0x43, 0xE9, + 0xAC, 0xBC, 0x43, 0xE9, 0xAD, 0x9A, 0x43, 0xE9, + 0xAD, 0xAF, 0x43, 0xE9, 0xB1, 0x80, 0x43, 0xE9, + 0xB1, 0x97, 0x43, 0xE9, 0xB3, 0xA5, 0x43, 0xE9, + 0xB3, 0xBD, 0x43, 0xE9, 0xB5, 0xA7, 0x43, 0xE9, + 0xB6, 0xB4, 0x43, 0xE9, 0xB7, 0xBA, 0x43, 0xE9, + // Bytes 16c0 - 16ff + 0xB8, 0x9E, 0x43, 0xE9, 0xB9, 0xB5, 0x43, 0xE9, + 0xB9, 0xBF, 0x43, 0xE9, 0xBA, 0x97, 0x43, 0xE9, + 0xBA, 0x9F, 0x43, 0xE9, 0xBA, 0xA5, 0x43, 0xE9, + 0xBA, 0xBB, 0x43, 0xE9, 0xBB, 0x83, 0x43, 0xE9, + 0xBB, 0x8D, 0x43, 0xE9, 0xBB, 0x8E, 0x43, 0xE9, + 0xBB, 0x91, 0x43, 0xE9, 0xBB, 0xB9, 0x43, 0xE9, + 0xBB, 0xBD, 0x43, 0xE9, 0xBB, 0xBE, 0x43, 0xE9, + 0xBC, 0x85, 0x43, 0xE9, 0xBC, 0x8E, 0x43, 0xE9, + // Bytes 1700 - 173f + 0xBC, 0x8F, 0x43, 0xE9, 0xBC, 0x93, 0x43, 0xE9, + 0xBC, 0x96, 0x43, 0xE9, 0xBC, 0xA0, 0x43, 0xE9, + 0xBC, 0xBB, 0x43, 0xE9, 0xBD, 0x83, 0x43, 0xE9, + 0xBD, 0x8A, 0x43, 0xE9, 0xBD, 0x92, 0x43, 0xE9, + 0xBE, 0x8D, 0x43, 0xE9, 0xBE, 0x8E, 0x43, 0xE9, + 0xBE, 0x9C, 0x43, 0xE9, 0xBE, 0x9F, 0x43, 0xE9, + 0xBE, 0xA0, 0x43, 0xEA, 0x99, 0x91, 0x43, 0xEA, + 0x9A, 0x89, 0x43, 0xEA, 0x9C, 0xA7, 0x43, 0xEA, + // Bytes 1740 - 177f + 0x9D, 0xAF, 0x43, 0xEA, 0x9E, 0x8E, 0x43, 0xEA, + 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x43, 0xEA, + 0xAD, 0xA6, 0x43, 0xEA, 0xAD, 0xA7, 0x44, 0xF0, + 0x9D, 0xBC, 0x84, 0x44, 0xF0, 0x9D, 0xBC, 0x85, + 0x44, 0xF0, 0x9D, 0xBC, 0x86, 0x44, 0xF0, 0x9D, + 0xBC, 0x88, 0x44, 0xF0, 0x9D, 0xBC, 0x8A, 0x44, + 0xF0, 0x9D, 0xBC, 0x9E, 0x44, 0xF0, 0xA0, 0x84, + 0xA2, 0x44, 0xF0, 0xA0, 0x94, 0x9C, 0x44, 0xF0, + // Bytes 1780 - 17bf + 0xA0, 0x94, 0xA5, 0x44, 0xF0, 0xA0, 0x95, 0x8B, + 0x44, 0xF0, 0xA0, 0x98, 0xBA, 0x44, 0xF0, 0xA0, + 0xA0, 0x84, 0x44, 0xF0, 0xA0, 0xA3, 0x9E, 0x44, + 0xF0, 0xA0, 0xA8, 0xAC, 0x44, 0xF0, 0xA0, 0xAD, + 0xA3, 0x44, 0xF0, 0xA1, 0x93, 0xA4, 0x44, 0xF0, + 0xA1, 0x9A, 0xA8, 0x44, 0xF0, 0xA1, 0x9B, 0xAA, + 0x44, 0xF0, 0xA1, 0xA7, 0x88, 0x44, 0xF0, 0xA1, + 0xAC, 0x98, 0x44, 0xF0, 0xA1, 0xB4, 0x8B, 0x44, + // Bytes 17c0 - 17ff + 0xF0, 0xA1, 0xB7, 0xA4, 0x44, 0xF0, 0xA1, 0xB7, + 0xA6, 0x44, 0xF0, 0xA2, 0x86, 0x83, 0x44, 0xF0, + 0xA2, 0x86, 0x9F, 0x44, 0xF0, 0xA2, 0x8C, 0xB1, + 0x44, 0xF0, 0xA2, 0x9B, 0x94, 0x44, 0xF0, 0xA2, + 0xA1, 0x84, 0x44, 0xF0, 0xA2, 0xA1, 0x8A, 0x44, + 0xF0, 0xA2, 0xAC, 0x8C, 0x44, 0xF0, 0xA2, 0xAF, + 0xB1, 0x44, 0xF0, 0xA3, 0x80, 0x8A, 0x44, 0xF0, + 0xA3, 0x8A, 0xB8, 0x44, 0xF0, 0xA3, 0x8D, 0x9F, + // Bytes 1800 - 183f + 0x44, 0xF0, 0xA3, 0x8E, 0x93, 0x44, 0xF0, 0xA3, + 0x8E, 0x9C, 0x44, 0xF0, 0xA3, 0x8F, 0x83, 0x44, + 0xF0, 0xA3, 0x8F, 0x95, 0x44, 0xF0, 0xA3, 0x91, + 0xAD, 0x44, 0xF0, 0xA3, 0x9A, 0xA3, 0x44, 0xF0, + 0xA3, 0xA2, 0xA7, 0x44, 0xF0, 0xA3, 0xAA, 0x8D, + 0x44, 0xF0, 0xA3, 0xAB, 0xBA, 0x44, 0xF0, 0xA3, + 0xB2, 0xBC, 0x44, 0xF0, 0xA3, 0xB4, 0x9E, 0x44, + 0xF0, 0xA3, 0xBB, 0x91, 0x44, 0xF0, 0xA3, 0xBD, + // Bytes 1840 - 187f + 0x9E, 0x44, 0xF0, 0xA3, 0xBE, 0x8E, 0x44, 0xF0, + 0xA4, 0x89, 0xA3, 0x44, 0xF0, 0xA4, 0x8B, 0xAE, + 0x44, 0xF0, 0xA4, 0x8E, 0xAB, 0x44, 0xF0, 0xA4, + 0x98, 0x88, 0x44, 0xF0, 0xA4, 0x9C, 0xB5, 0x44, + 0xF0, 0xA4, 0xA0, 0x94, 0x44, 0xF0, 0xA4, 0xB0, + 0xB6, 0x44, 0xF0, 0xA4, 0xB2, 0x92, 0x44, 0xF0, + 0xA4, 0xBE, 0xA1, 0x44, 0xF0, 0xA4, 0xBE, 0xB8, + 0x44, 0xF0, 0xA5, 0x81, 0x84, 0x44, 0xF0, 0xA5, + // Bytes 1880 - 18bf + 0x83, 0xB2, 0x44, 0xF0, 0xA5, 0x83, 0xB3, 0x44, + 0xF0, 0xA5, 0x84, 0x99, 0x44, 0xF0, 0xA5, 0x84, + 0xB3, 0x44, 0xF0, 0xA5, 0x89, 0x89, 0x44, 0xF0, + 0xA5, 0x90, 0x9D, 0x44, 0xF0, 0xA5, 0x98, 0xA6, + 0x44, 0xF0, 0xA5, 0x9A, 0x9A, 0x44, 0xF0, 0xA5, + 0x9B, 0x85, 0x44, 0xF0, 0xA5, 0xA5, 0xBC, 0x44, + 0xF0, 0xA5, 0xAA, 0xA7, 0x44, 0xF0, 0xA5, 0xAE, + 0xAB, 0x44, 0xF0, 0xA5, 0xB2, 0x80, 0x44, 0xF0, + // Bytes 18c0 - 18ff + 0xA5, 0xB3, 0x90, 0x44, 0xF0, 0xA5, 0xBE, 0x86, + 0x44, 0xF0, 0xA6, 0x87, 0x9A, 0x44, 0xF0, 0xA6, + 0x88, 0xA8, 0x44, 0xF0, 0xA6, 0x89, 0x87, 0x44, + 0xF0, 0xA6, 0x8B, 0x99, 0x44, 0xF0, 0xA6, 0x8C, + 0xBE, 0x44, 0xF0, 0xA6, 0x93, 0x9A, 0x44, 0xF0, + 0xA6, 0x94, 0xA3, 0x44, 0xF0, 0xA6, 0x96, 0xA8, + 0x44, 0xF0, 0xA6, 0x9E, 0xA7, 0x44, 0xF0, 0xA6, + 0x9E, 0xB5, 0x44, 0xF0, 0xA6, 0xAC, 0xBC, 0x44, + // Bytes 1900 - 193f + 0xF0, 0xA6, 0xB0, 0xB6, 0x44, 0xF0, 0xA6, 0xB3, + 0x95, 0x44, 0xF0, 0xA6, 0xB5, 0xAB, 0x44, 0xF0, + 0xA6, 0xBC, 0xAC, 0x44, 0xF0, 0xA6, 0xBE, 0xB1, + 0x44, 0xF0, 0xA7, 0x83, 0x92, 0x44, 0xF0, 0xA7, + 0x8F, 0x8A, 0x44, 0xF0, 0xA7, 0x99, 0xA7, 0x44, + 0xF0, 0xA7, 0xA2, 0xAE, 0x44, 0xF0, 0xA7, 0xA5, + 0xA6, 0x44, 0xF0, 0xA7, 0xB2, 0xA8, 0x44, 0xF0, + 0xA7, 0xBB, 0x93, 0x44, 0xF0, 0xA7, 0xBC, 0xAF, + // Bytes 1940 - 197f + 0x44, 0xF0, 0xA8, 0x97, 0x92, 0x44, 0xF0, 0xA8, + 0x97, 0xAD, 0x44, 0xF0, 0xA8, 0x9C, 0xAE, 0x44, + 0xF0, 0xA8, 0xAF, 0xBA, 0x44, 0xF0, 0xA8, 0xB5, + 0xB7, 0x44, 0xF0, 0xA9, 0x85, 0x85, 0x44, 0xF0, + 0xA9, 0x87, 0x9F, 0x44, 0xF0, 0xA9, 0x88, 0x9A, + 0x44, 0xF0, 0xA9, 0x90, 0x8A, 0x44, 0xF0, 0xA9, + 0x92, 0x96, 0x44, 0xF0, 0xA9, 0x96, 0xB6, 0x44, + 0xF0, 0xA9, 0xAC, 0xB0, 0x44, 0xF0, 0xAA, 0x83, + // Bytes 1980 - 19bf + 0x8E, 0x44, 0xF0, 0xAA, 0x84, 0x85, 0x44, 0xF0, + 0xAA, 0x88, 0x8E, 0x44, 0xF0, 0xAA, 0x8A, 0x91, + 0x44, 0xF0, 0xAA, 0x8E, 0x92, 0x44, 0xF0, 0xAA, + 0x98, 0x80, 0x42, 0x21, 0x21, 0x42, 0x21, 0x3F, + 0x42, 0x2E, 0x2E, 0x42, 0x30, 0x2C, 0x42, 0x30, + 0x2E, 0x42, 0x31, 0x2C, 0x42, 0x31, 0x2E, 0x42, + 0x31, 0x30, 0x42, 0x31, 0x31, 0x42, 0x31, 0x32, + 0x42, 0x31, 0x33, 0x42, 0x31, 0x34, 0x42, 0x31, + // Bytes 19c0 - 19ff + 0x35, 0x42, 0x31, 0x36, 0x42, 0x31, 0x37, 0x42, + 0x31, 0x38, 0x42, 0x31, 0x39, 0x42, 0x32, 0x2C, + 0x42, 0x32, 0x2E, 0x42, 0x32, 0x30, 0x42, 0x32, + 0x31, 0x42, 0x32, 0x32, 0x42, 0x32, 0x33, 0x42, + 0x32, 0x34, 0x42, 0x32, 0x35, 0x42, 0x32, 0x36, + 0x42, 0x32, 0x37, 0x42, 0x32, 0x38, 0x42, 0x32, + 0x39, 0x42, 0x33, 0x2C, 0x42, 0x33, 0x2E, 0x42, + 0x33, 0x30, 0x42, 0x33, 0x31, 0x42, 0x33, 0x32, + // Bytes 1a00 - 1a3f + 0x42, 0x33, 0x33, 0x42, 0x33, 0x34, 0x42, 0x33, + 0x35, 0x42, 0x33, 0x36, 0x42, 0x33, 0x37, 0x42, + 0x33, 0x38, 0x42, 0x33, 0x39, 0x42, 0x34, 0x2C, + 0x42, 0x34, 0x2E, 0x42, 0x34, 0x30, 0x42, 0x34, + 0x31, 0x42, 0x34, 0x32, 0x42, 0x34, 0x33, 0x42, + 0x34, 0x34, 0x42, 0x34, 0x35, 0x42, 0x34, 0x36, + 0x42, 0x34, 0x37, 0x42, 0x34, 0x38, 0x42, 0x34, + 0x39, 0x42, 0x35, 0x2C, 0x42, 0x35, 0x2E, 0x42, + // Bytes 1a40 - 1a7f + 0x35, 0x30, 0x42, 0x36, 0x2C, 0x42, 0x36, 0x2E, + 0x42, 0x37, 0x2C, 0x42, 0x37, 0x2E, 0x42, 0x38, + 0x2C, 0x42, 0x38, 0x2E, 0x42, 0x39, 0x2C, 0x42, + 0x39, 0x2E, 0x42, 0x3D, 0x3D, 0x42, 0x3F, 0x21, + 0x42, 0x3F, 0x3F, 0x42, 0x41, 0x55, 0x42, 0x42, + 0x71, 0x42, 0x43, 0x44, 0x42, 0x44, 0x4A, 0x42, + 0x44, 0x5A, 0x42, 0x44, 0x7A, 0x42, 0x47, 0x42, + 0x42, 0x47, 0x79, 0x42, 0x48, 0x50, 0x42, 0x48, + // Bytes 1a80 - 1abf + 0x56, 0x42, 0x48, 0x67, 0x42, 0x48, 0x7A, 0x42, + 0x49, 0x49, 0x42, 0x49, 0x4A, 0x42, 0x49, 0x55, + 0x42, 0x49, 0x56, 0x42, 0x49, 0x58, 0x42, 0x4B, + 0x42, 0x42, 0x4B, 0x4B, 0x42, 0x4B, 0x4D, 0x42, + 0x4C, 0x4A, 0x42, 0x4C, 0x6A, 0x42, 0x4D, 0x42, + 0x42, 0x4D, 0x43, 0x42, 0x4D, 0x44, 0x42, 0x4D, + 0x52, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42, + 0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F, + // Bytes 1ac0 - 1aff + 0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50, + 0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42, + 0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76, + 0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57, + 0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42, + 0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64, + 0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64, + 0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42, + // Bytes 1b00 - 1b3f + 0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66, + 0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66, + 0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42, + 0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76, + 0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B, + 0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42, + 0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74, + 0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C, + // Bytes 1b40 - 1b7f + 0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42, + 0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56, + 0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D, + 0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42, + 0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46, + 0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E, + 0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42, + 0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46, + // Bytes 1b80 - 1bbf + 0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70, + 0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42, + 0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69, + 0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29, + 0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29, + 0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29, + 0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29, + 0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29, + // Bytes 1bc0 - 1bff + 0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29, + 0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29, + 0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29, + 0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29, + 0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29, + 0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29, + 0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29, + 0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29, + // Bytes 1c00 - 1c3f + 0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29, + 0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29, + 0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29, + 0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29, + 0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29, + 0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29, + 0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29, + 0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29, + // Bytes 1c40 - 1c7f + 0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29, + 0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29, + 0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29, + 0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29, + 0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29, + 0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29, + 0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29, + 0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29, + // Bytes 1c80 - 1cbf + 0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29, + 0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E, + 0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E, + 0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E, + 0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E, + 0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E, + 0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E, + 0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D, + // Bytes 1cc0 - 1cff + 0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E, + 0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A, + 0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49, + 0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7, + 0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61, + 0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D, + 0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45, + 0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A, + // Bytes 1d00 - 1d3f + 0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49, + 0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73, + 0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72, + 0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75, + 0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32, + 0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32, + 0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67, + 0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C, + // Bytes 1d40 - 1d7f + 0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61, + 0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A, + 0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32, + 0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9, + 0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7, + 0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32, + 0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C, + 0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69, + // Bytes 1d80 - 1dbf + 0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43, + 0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E, + 0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46, + 0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57, + 0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C, + 0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73, + 0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31, + 0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44, + // Bytes 1dc0 - 1dff + 0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34, + 0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28, + 0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29, + 0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31, + 0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44, + 0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81, + 0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31, + 0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9, + // Bytes 1e00 - 1e3f + 0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6, + 0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44, + 0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C, + 0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34, + 0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88, + 0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6, + 0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44, + 0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97, + // Bytes 1e40 - 1e7f + 0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36, + 0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5, + 0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7, + 0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44, + 0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82, + 0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39, + 0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9, + 0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E, + // Bytes 1e80 - 1ebf + 0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44, + 0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69, + 0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5, + 0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB, + 0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4, + 0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44, + 0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9, + 0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8, + // Bytes 1ec0 - 1eff + 0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE, + 0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8, + 0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44, + 0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9, + 0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8, + 0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC, + 0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA, + 0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44, + // Bytes 1f00 - 1f3f + 0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9, + 0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8, + 0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89, + 0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB, + 0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44, + 0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9, + 0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8, + 0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89, + // Bytes 1f40 - 1f7f + 0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC, + 0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44, + 0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9, + 0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8, + 0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89, + 0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE, + 0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44, + 0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9, + // Bytes 1f80 - 1fbf + 0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8, + 0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD, + 0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3, + 0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44, + 0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9, + 0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8, + 0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD, + 0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4, + // Bytes 1fc0 - 1fff + 0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44, + 0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9, + 0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8, + 0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE, + 0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5, + 0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44, + 0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8, + 0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8, + // Bytes 2000 - 203f + 0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1, + 0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6, + 0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44, + 0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9, + 0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8, + 0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85, + 0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9, + 0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44, + // Bytes 2040 - 207f + 0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8, + 0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8, + 0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A, + 0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81, + 0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44, + 0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9, + 0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9, + 0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85, + // Bytes 2080 - 20bf + 0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82, + 0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44, + 0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8, + 0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9, + 0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85, + 0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83, + 0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44, + 0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8, + // Bytes 20c0 - 20ff + 0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9, + 0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87, + 0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84, + 0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44, + 0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8, + 0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9, + 0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89, + 0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86, + // Bytes 2100 - 213f + 0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44, + 0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8, + 0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9, + 0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86, + 0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86, + 0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44, + 0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9, + 0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9, + // Bytes 2140 - 217f + 0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4, + 0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A, + 0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44, + 0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8, + 0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9, + 0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87, + 0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A, + 0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44, + // Bytes 2180 - 21bf + 0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84, + 0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29, + // Bytes 21c0 - 21ff + 0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29, + 0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28, + 0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8, + 0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29, + 0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28, + 0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB, + // Bytes 2200 - 223f + 0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29, + 0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28, + 0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85, + 0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29, + 0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28, + 0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90, + 0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29, + 0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28, + // Bytes 2240 - 227f + 0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD, + 0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29, + 0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28, + 0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C, + 0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29, + 0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28, + 0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89, + 0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29, + // Bytes 2280 - 22bf + 0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28, + 0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5, + 0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29, + 0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28, + 0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3, + 0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29, + 0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6, + // Bytes 22c0 - 22ff + 0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7, + 0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5, + 0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31, + // Bytes 2300 - 233f + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9, + // Bytes 2340 - 237f + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35, + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39, + 0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6, + // Bytes 2380 - 23bf + 0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5, + 0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32, + // Bytes 23c0 - 23ff + 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33, + 0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6, + 0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34, + 0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81, + 0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36, + // Bytes 2400 - 243f + 0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88, + 0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D, + 0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31, + 0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2, + 0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88, + 0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9, + // Bytes 2440 - 247f + 0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85, + 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46, + 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, + 0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9, + 0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC, + // Bytes 2480 - 24bf + 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46, + 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8, + 0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89, + 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + // Bytes 24c0 - 24ff + 0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC, + 0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8, + 0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89, + 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46, + 0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8, + // Bytes 2500 - 253f + 0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, + 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, + 0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, + 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9, + 0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE, + 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8, + 0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5, + // Bytes 2540 - 257f + 0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9, + 0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, + 0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A, + 0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46, + 0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, + 0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8, + // Bytes 2580 - 25bf + 0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, + 0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81, + 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9, + 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84, + // Bytes 25c0 - 25ff + 0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85, + 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + 0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + 0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84, + 0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8, + 0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC, + 0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, + // Bytes 2600 - 263f + 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89, + 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, + 0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, + 0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC, + 0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, + 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A, + // Bytes 2640 - 267f + 0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, + 0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, + 0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85, + 0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE, + 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9, + 0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD, + 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46, + // Bytes 2680 - 26bf + 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9, + 0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46, + 0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + // Bytes 26c0 - 26ff + 0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, + 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, + 0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85, + 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, + 0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A, + // Bytes 2700 - 273f + 0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9, + 0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, + 0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A, + 0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9, + // Bytes 2740 - 277f + 0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB, + 0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2, + 0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46, + 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0, + 0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD, + 0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0, + // Bytes 2780 - 27bf + 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE, + 0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7, + 0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46, + 0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, + 0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, + 0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0, + 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE, + // Bytes 27c0 - 27ff + 0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46, + 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81, + 0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88, + 0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82, + 0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88, + // Bytes 2800 - 283f + 0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46, + 0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3, + 0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA, + 0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3, + 0x83, 0xA0, 0x46, 0xE4, 0xBB, 0xA4, 0xE5, 0x92, + 0x8C, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD, 0xA3, + 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90, 0x46, + // Bytes 2840 - 287f + 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46, 0xE6, + 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72, 0x61, + 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3, 0x80, + 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28, 0xE1, + 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x29, + 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + // Bytes 2880 - 28bf + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x89, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, + 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x29, + // Bytes 28c0 - 28ff + 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x92, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61, 0x64, + 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8, 0xA7, + 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48, 0xD8, + 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87, 0x48, + // Bytes 2900 - 293f + 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9, 0x84, + 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7, 0xD9, + 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8, 0xB9, + 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84, 0xD9, + 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8, 0xAD, + 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0x49, + // Bytes 2940 - 297f + 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2, 0x80, + 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, + 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3, 0x80, + 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B, 0x9D, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, + // Bytes 2980 - 29bf + 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3, 0x80, + 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C, 0xAC, + 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE7, + 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, + 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95, 0x49, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + // Bytes 29c0 - 29ff + 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6, 0xE3, + 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x82, + 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9, 0x49, + 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1, 0xE3, + 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3, 0x82, + // Bytes 2a00 - 2a3f + 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A, 0x49, + 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, + 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86, 0xE3, + 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, + 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3, 0x83, + 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0xA4, + // Bytes 2a40 - 2a7f + 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3, 0x49, + 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98, 0xE3, + 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, + 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, 0x49, + // Bytes 2a80 - 2abf + 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3, 0x83, + 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF, 0x49, + 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82, 0xA2, + 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF, 0xE3, + // Bytes 2ac0 - 2aff + 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2, 0x80, + 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, + 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2, 0x88, + 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x4C, + 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82, 0xA8, + 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3, 0x83, + 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + // Bytes 2b00 - 2b3f + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, + 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, + 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD, 0xE3, + 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B, 0xE3, + 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x83, + // Bytes 2b40 - 2b7f + 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0xA4, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F, 0xE3, + // Bytes 2b80 - 2bbf + 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x84, + 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF, 0x4C, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83, 0x98, + // Bytes 2bc0 - 2bff + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3, 0x82, + 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C, 0xE3, + 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82, 0xAF, + 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, + 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, + // Bytes 2c00 - 2c3f + 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3, 0x83, + 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0x4C, + 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4, 0xBC, + 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92, 0xE1, + 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9, 0x84, + 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, + // Bytes 2c40 - 2c7f + 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83, 0x83, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83, 0xBC, + // Bytes 2c80 - 2cbf + 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B, 0xE3, + 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E, 0xE3, + 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83, 0xA7, + // Bytes 2cc0 - 2cff + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1, 0xE3, + 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x88, + 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB, 0xE3, + 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84, 0x8B, + 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1, 0x85, + 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3, 0x82, + 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0xE3, + // Bytes 2d00 - 2d3f + 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, + 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9, + 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3, 0x83, + // Bytes 2d40 - 2d7f + 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, + 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x82, + 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88, 0x52, + 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, + 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3, 0x82, + // Bytes 2d80 - 2dbf + 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7, 0xE3, + 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, + 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3, 0xE3, + 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + 0xE3, 0x83, 0xB3, 0x61, 0xD8, 0xB5, 0xD9, 0x84, + 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84, 0xD9, + // Bytes 2dc0 - 2dff + 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9, 0x84, + 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88, 0xD8, + 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, 0xE0, 0xA7, + 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, 0xE0, 0xAD, + 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, 0xE0, 0xAE, + // Bytes 2e00 - 2e3f + 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xAF, + 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF, + 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xB2, + 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3, + 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, 0xE0, 0xB5, + 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB5, + // Bytes 2e40 - 2e7f + 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, 0xE0, 0xB5, + 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB7, + 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, 0xE1, 0x80, + 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, 0xE1, 0xAC, + 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + // Bytes 2e80 - 2ebf + 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC, + 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAD, + 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x08, 0xF0, 0x91, + 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01, 0x08, + // Bytes 2ec0 - 2eff + 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84, 0xA7, + 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0, 0x91, + 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, + 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0, 0x91, + 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01, 0x08, + 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xBA, + 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, + 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96, 0xB8, + // Bytes 2f00 - 2f3f + 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0, 0x91, + 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, + 0xF0, 0x91, 0xA4, 0xB5, 0xF0, 0x91, 0xA4, 0xB0, + 0x01, 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0xE0, 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, + 0xE0, 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x16, 0x44, + 0x44, 0x5A, 0xCC, 0x8C, 0xCD, 0x44, 0x44, 0x7A, + 0xCC, 0x8C, 0xCD, 0x44, 0x64, 0x7A, 0xCC, 0x8C, + // Bytes 2f40 - 2f7f + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, + 0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x46, 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x86, 0xE1, 0x85, 0xA1, + // Bytes 2f80 - 2fbf + 0x01, 0x46, 0xE1, 0x84, 0x87, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x89, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xAE, + 0x01, 0x46, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x90, 0xE1, 0x85, 0xA1, + // Bytes 2fc0 - 2fff + 0x01, 0x46, 0xE1, 0x84, 0x91, 0xE1, 0x85, 0xA1, + 0x01, 0x46, 0xE1, 0x84, 0x92, 0xE1, 0x85, 0xA1, + 0x01, 0x49, 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, + 0xE3, 0x82, 0x99, 0x11, 0x4C, 0xE1, 0x84, 0x8C, + 0xE1, 0x85, 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, + 0xB4, 0x01, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, + 0x99, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x11, + 0x4C, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, + // Bytes 3000 - 303f + 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x11, 0x4C, 0xE3, + 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, + 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE1, 0x84, 0x8E, + 0xE1, 0x85, 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, + 0x80, 0xE1, 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3, + 0x82, 0xB7, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, + // Bytes 3040 - 307f + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, + 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0xBC, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x11, + 0x4F, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, + 0x83, 0xB3, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x52, 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x88, 0xE3, 0x82, 0x99, 0x11, 0x52, 0xE3, 0x83, + // Bytes 3080 - 30bf + 0x95, 0xE3, 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, + 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x86, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, + 0x01, 0x86, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F, + 0x01, 0x03, 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, + 0xCC, 0xB8, 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, + 0x03, 0x41, 0xCC, 0x80, 0xCD, 0x03, 0x41, 0xCC, + 0x81, 0xCD, 0x03, 0x41, 0xCC, 0x83, 0xCD, 0x03, + // Bytes 30c0 - 30ff + 0x41, 0xCC, 0x84, 0xCD, 0x03, 0x41, 0xCC, 0x89, + 0xCD, 0x03, 0x41, 0xCC, 0x8C, 0xCD, 0x03, 0x41, + 0xCC, 0x8F, 0xCD, 0x03, 0x41, 0xCC, 0x91, 0xCD, + 0x03, 0x41, 0xCC, 0xA5, 0xB9, 0x03, 0x41, 0xCC, + 0xA8, 0xA9, 0x03, 0x42, 0xCC, 0x87, 0xCD, 0x03, + 0x42, 0xCC, 0xA3, 0xB9, 0x03, 0x42, 0xCC, 0xB1, + 0xB9, 0x03, 0x43, 0xCC, 0x81, 0xCD, 0x03, 0x43, + 0xCC, 0x82, 0xCD, 0x03, 0x43, 0xCC, 0x87, 0xCD, + // Bytes 3100 - 313f + 0x03, 0x43, 0xCC, 0x8C, 0xCD, 0x03, 0x44, 0xCC, + 0x87, 0xCD, 0x03, 0x44, 0xCC, 0x8C, 0xCD, 0x03, + 0x44, 0xCC, 0xA3, 0xB9, 0x03, 0x44, 0xCC, 0xA7, + 0xA9, 0x03, 0x44, 0xCC, 0xAD, 0xB9, 0x03, 0x44, + 0xCC, 0xB1, 0xB9, 0x03, 0x45, 0xCC, 0x80, 0xCD, + 0x03, 0x45, 0xCC, 0x81, 0xCD, 0x03, 0x45, 0xCC, + 0x83, 0xCD, 0x03, 0x45, 0xCC, 0x86, 0xCD, 0x03, + 0x45, 0xCC, 0x87, 0xCD, 0x03, 0x45, 0xCC, 0x88, + // Bytes 3140 - 317f + 0xCD, 0x03, 0x45, 0xCC, 0x89, 0xCD, 0x03, 0x45, + 0xCC, 0x8C, 0xCD, 0x03, 0x45, 0xCC, 0x8F, 0xCD, + 0x03, 0x45, 0xCC, 0x91, 0xCD, 0x03, 0x45, 0xCC, + 0xA8, 0xA9, 0x03, 0x45, 0xCC, 0xAD, 0xB9, 0x03, + 0x45, 0xCC, 0xB0, 0xB9, 0x03, 0x46, 0xCC, 0x87, + 0xCD, 0x03, 0x47, 0xCC, 0x81, 0xCD, 0x03, 0x47, + 0xCC, 0x82, 0xCD, 0x03, 0x47, 0xCC, 0x84, 0xCD, + 0x03, 0x47, 0xCC, 0x86, 0xCD, 0x03, 0x47, 0xCC, + // Bytes 3180 - 31bf + 0x87, 0xCD, 0x03, 0x47, 0xCC, 0x8C, 0xCD, 0x03, + 0x47, 0xCC, 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0x82, + 0xCD, 0x03, 0x48, 0xCC, 0x87, 0xCD, 0x03, 0x48, + 0xCC, 0x88, 0xCD, 0x03, 0x48, 0xCC, 0x8C, 0xCD, + 0x03, 0x48, 0xCC, 0xA3, 0xB9, 0x03, 0x48, 0xCC, + 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0xAE, 0xB9, 0x03, + 0x49, 0xCC, 0x80, 0xCD, 0x03, 0x49, 0xCC, 0x81, + 0xCD, 0x03, 0x49, 0xCC, 0x82, 0xCD, 0x03, 0x49, + // Bytes 31c0 - 31ff + 0xCC, 0x83, 0xCD, 0x03, 0x49, 0xCC, 0x84, 0xCD, + 0x03, 0x49, 0xCC, 0x86, 0xCD, 0x03, 0x49, 0xCC, + 0x87, 0xCD, 0x03, 0x49, 0xCC, 0x89, 0xCD, 0x03, + 0x49, 0xCC, 0x8C, 0xCD, 0x03, 0x49, 0xCC, 0x8F, + 0xCD, 0x03, 0x49, 0xCC, 0x91, 0xCD, 0x03, 0x49, + 0xCC, 0xA3, 0xB9, 0x03, 0x49, 0xCC, 0xA8, 0xA9, + 0x03, 0x49, 0xCC, 0xB0, 0xB9, 0x03, 0x4A, 0xCC, + 0x82, 0xCD, 0x03, 0x4B, 0xCC, 0x81, 0xCD, 0x03, + // Bytes 3200 - 323f + 0x4B, 0xCC, 0x8C, 0xCD, 0x03, 0x4B, 0xCC, 0xA3, + 0xB9, 0x03, 0x4B, 0xCC, 0xA7, 0xA9, 0x03, 0x4B, + 0xCC, 0xB1, 0xB9, 0x03, 0x4C, 0xCC, 0x81, 0xCD, + 0x03, 0x4C, 0xCC, 0x8C, 0xCD, 0x03, 0x4C, 0xCC, + 0xA7, 0xA9, 0x03, 0x4C, 0xCC, 0xAD, 0xB9, 0x03, + 0x4C, 0xCC, 0xB1, 0xB9, 0x03, 0x4D, 0xCC, 0x81, + 0xCD, 0x03, 0x4D, 0xCC, 0x87, 0xCD, 0x03, 0x4D, + 0xCC, 0xA3, 0xB9, 0x03, 0x4E, 0xCC, 0x80, 0xCD, + // Bytes 3240 - 327f + 0x03, 0x4E, 0xCC, 0x81, 0xCD, 0x03, 0x4E, 0xCC, + 0x83, 0xCD, 0x03, 0x4E, 0xCC, 0x87, 0xCD, 0x03, + 0x4E, 0xCC, 0x8C, 0xCD, 0x03, 0x4E, 0xCC, 0xA3, + 0xB9, 0x03, 0x4E, 0xCC, 0xA7, 0xA9, 0x03, 0x4E, + 0xCC, 0xAD, 0xB9, 0x03, 0x4E, 0xCC, 0xB1, 0xB9, + 0x03, 0x4F, 0xCC, 0x80, 0xCD, 0x03, 0x4F, 0xCC, + 0x81, 0xCD, 0x03, 0x4F, 0xCC, 0x86, 0xCD, 0x03, + 0x4F, 0xCC, 0x89, 0xCD, 0x03, 0x4F, 0xCC, 0x8B, + // Bytes 3280 - 32bf + 0xCD, 0x03, 0x4F, 0xCC, 0x8C, 0xCD, 0x03, 0x4F, + 0xCC, 0x8F, 0xCD, 0x03, 0x4F, 0xCC, 0x91, 0xCD, + 0x03, 0x50, 0xCC, 0x81, 0xCD, 0x03, 0x50, 0xCC, + 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x81, 0xCD, 0x03, + 0x52, 0xCC, 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x8C, + 0xCD, 0x03, 0x52, 0xCC, 0x8F, 0xCD, 0x03, 0x52, + 0xCC, 0x91, 0xCD, 0x03, 0x52, 0xCC, 0xA7, 0xA9, + 0x03, 0x52, 0xCC, 0xB1, 0xB9, 0x03, 0x53, 0xCC, + // Bytes 32c0 - 32ff + 0x82, 0xCD, 0x03, 0x53, 0xCC, 0x87, 0xCD, 0x03, + 0x53, 0xCC, 0xA6, 0xB9, 0x03, 0x53, 0xCC, 0xA7, + 0xA9, 0x03, 0x54, 0xCC, 0x87, 0xCD, 0x03, 0x54, + 0xCC, 0x8C, 0xCD, 0x03, 0x54, 0xCC, 0xA3, 0xB9, + 0x03, 0x54, 0xCC, 0xA6, 0xB9, 0x03, 0x54, 0xCC, + 0xA7, 0xA9, 0x03, 0x54, 0xCC, 0xAD, 0xB9, 0x03, + 0x54, 0xCC, 0xB1, 0xB9, 0x03, 0x55, 0xCC, 0x80, + 0xCD, 0x03, 0x55, 0xCC, 0x81, 0xCD, 0x03, 0x55, + // Bytes 3300 - 333f + 0xCC, 0x82, 0xCD, 0x03, 0x55, 0xCC, 0x86, 0xCD, + 0x03, 0x55, 0xCC, 0x89, 0xCD, 0x03, 0x55, 0xCC, + 0x8A, 0xCD, 0x03, 0x55, 0xCC, 0x8B, 0xCD, 0x03, + 0x55, 0xCC, 0x8C, 0xCD, 0x03, 0x55, 0xCC, 0x8F, + 0xCD, 0x03, 0x55, 0xCC, 0x91, 0xCD, 0x03, 0x55, + 0xCC, 0xA3, 0xB9, 0x03, 0x55, 0xCC, 0xA4, 0xB9, + 0x03, 0x55, 0xCC, 0xA8, 0xA9, 0x03, 0x55, 0xCC, + 0xAD, 0xB9, 0x03, 0x55, 0xCC, 0xB0, 0xB9, 0x03, + // Bytes 3340 - 337f + 0x56, 0xCC, 0x83, 0xCD, 0x03, 0x56, 0xCC, 0xA3, + 0xB9, 0x03, 0x57, 0xCC, 0x80, 0xCD, 0x03, 0x57, + 0xCC, 0x81, 0xCD, 0x03, 0x57, 0xCC, 0x82, 0xCD, + 0x03, 0x57, 0xCC, 0x87, 0xCD, 0x03, 0x57, 0xCC, + 0x88, 0xCD, 0x03, 0x57, 0xCC, 0xA3, 0xB9, 0x03, + 0x58, 0xCC, 0x87, 0xCD, 0x03, 0x58, 0xCC, 0x88, + 0xCD, 0x03, 0x59, 0xCC, 0x80, 0xCD, 0x03, 0x59, + 0xCC, 0x81, 0xCD, 0x03, 0x59, 0xCC, 0x82, 0xCD, + // Bytes 3380 - 33bf + 0x03, 0x59, 0xCC, 0x83, 0xCD, 0x03, 0x59, 0xCC, + 0x84, 0xCD, 0x03, 0x59, 0xCC, 0x87, 0xCD, 0x03, + 0x59, 0xCC, 0x88, 0xCD, 0x03, 0x59, 0xCC, 0x89, + 0xCD, 0x03, 0x59, 0xCC, 0xA3, 0xB9, 0x03, 0x5A, + 0xCC, 0x81, 0xCD, 0x03, 0x5A, 0xCC, 0x82, 0xCD, + 0x03, 0x5A, 0xCC, 0x87, 0xCD, 0x03, 0x5A, 0xCC, + 0x8C, 0xCD, 0x03, 0x5A, 0xCC, 0xA3, 0xB9, 0x03, + 0x5A, 0xCC, 0xB1, 0xB9, 0x03, 0x61, 0xCC, 0x80, + // Bytes 33c0 - 33ff + 0xCD, 0x03, 0x61, 0xCC, 0x81, 0xCD, 0x03, 0x61, + 0xCC, 0x83, 0xCD, 0x03, 0x61, 0xCC, 0x84, 0xCD, + 0x03, 0x61, 0xCC, 0x89, 0xCD, 0x03, 0x61, 0xCC, + 0x8C, 0xCD, 0x03, 0x61, 0xCC, 0x8F, 0xCD, 0x03, + 0x61, 0xCC, 0x91, 0xCD, 0x03, 0x61, 0xCC, 0xA5, + 0xB9, 0x03, 0x61, 0xCC, 0xA8, 0xA9, 0x03, 0x62, + 0xCC, 0x87, 0xCD, 0x03, 0x62, 0xCC, 0xA3, 0xB9, + 0x03, 0x62, 0xCC, 0xB1, 0xB9, 0x03, 0x63, 0xCC, + // Bytes 3400 - 343f + 0x81, 0xCD, 0x03, 0x63, 0xCC, 0x82, 0xCD, 0x03, + 0x63, 0xCC, 0x87, 0xCD, 0x03, 0x63, 0xCC, 0x8C, + 0xCD, 0x03, 0x64, 0xCC, 0x87, 0xCD, 0x03, 0x64, + 0xCC, 0x8C, 0xCD, 0x03, 0x64, 0xCC, 0xA3, 0xB9, + 0x03, 0x64, 0xCC, 0xA7, 0xA9, 0x03, 0x64, 0xCC, + 0xAD, 0xB9, 0x03, 0x64, 0xCC, 0xB1, 0xB9, 0x03, + 0x65, 0xCC, 0x80, 0xCD, 0x03, 0x65, 0xCC, 0x81, + 0xCD, 0x03, 0x65, 0xCC, 0x83, 0xCD, 0x03, 0x65, + // Bytes 3440 - 347f + 0xCC, 0x86, 0xCD, 0x03, 0x65, 0xCC, 0x87, 0xCD, + 0x03, 0x65, 0xCC, 0x88, 0xCD, 0x03, 0x65, 0xCC, + 0x89, 0xCD, 0x03, 0x65, 0xCC, 0x8C, 0xCD, 0x03, + 0x65, 0xCC, 0x8F, 0xCD, 0x03, 0x65, 0xCC, 0x91, + 0xCD, 0x03, 0x65, 0xCC, 0xA8, 0xA9, 0x03, 0x65, + 0xCC, 0xAD, 0xB9, 0x03, 0x65, 0xCC, 0xB0, 0xB9, + 0x03, 0x66, 0xCC, 0x87, 0xCD, 0x03, 0x67, 0xCC, + 0x81, 0xCD, 0x03, 0x67, 0xCC, 0x82, 0xCD, 0x03, + // Bytes 3480 - 34bf + 0x67, 0xCC, 0x84, 0xCD, 0x03, 0x67, 0xCC, 0x86, + 0xCD, 0x03, 0x67, 0xCC, 0x87, 0xCD, 0x03, 0x67, + 0xCC, 0x8C, 0xCD, 0x03, 0x67, 0xCC, 0xA7, 0xA9, + 0x03, 0x68, 0xCC, 0x82, 0xCD, 0x03, 0x68, 0xCC, + 0x87, 0xCD, 0x03, 0x68, 0xCC, 0x88, 0xCD, 0x03, + 0x68, 0xCC, 0x8C, 0xCD, 0x03, 0x68, 0xCC, 0xA3, + 0xB9, 0x03, 0x68, 0xCC, 0xA7, 0xA9, 0x03, 0x68, + 0xCC, 0xAE, 0xB9, 0x03, 0x68, 0xCC, 0xB1, 0xB9, + // Bytes 34c0 - 34ff + 0x03, 0x69, 0xCC, 0x80, 0xCD, 0x03, 0x69, 0xCC, + 0x81, 0xCD, 0x03, 0x69, 0xCC, 0x82, 0xCD, 0x03, + 0x69, 0xCC, 0x83, 0xCD, 0x03, 0x69, 0xCC, 0x84, + 0xCD, 0x03, 0x69, 0xCC, 0x86, 0xCD, 0x03, 0x69, + 0xCC, 0x89, 0xCD, 0x03, 0x69, 0xCC, 0x8C, 0xCD, + 0x03, 0x69, 0xCC, 0x8F, 0xCD, 0x03, 0x69, 0xCC, + 0x91, 0xCD, 0x03, 0x69, 0xCC, 0xA3, 0xB9, 0x03, + 0x69, 0xCC, 0xA8, 0xA9, 0x03, 0x69, 0xCC, 0xB0, + // Bytes 3500 - 353f + 0xB9, 0x03, 0x6A, 0xCC, 0x82, 0xCD, 0x03, 0x6A, + 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, 0x81, 0xCD, + 0x03, 0x6B, 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, + 0xA3, 0xB9, 0x03, 0x6B, 0xCC, 0xA7, 0xA9, 0x03, + 0x6B, 0xCC, 0xB1, 0xB9, 0x03, 0x6C, 0xCC, 0x81, + 0xCD, 0x03, 0x6C, 0xCC, 0x8C, 0xCD, 0x03, 0x6C, + 0xCC, 0xA7, 0xA9, 0x03, 0x6C, 0xCC, 0xAD, 0xB9, + 0x03, 0x6C, 0xCC, 0xB1, 0xB9, 0x03, 0x6D, 0xCC, + // Bytes 3540 - 357f + 0x81, 0xCD, 0x03, 0x6D, 0xCC, 0x87, 0xCD, 0x03, + 0x6D, 0xCC, 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0x80, + 0xCD, 0x03, 0x6E, 0xCC, 0x81, 0xCD, 0x03, 0x6E, + 0xCC, 0x83, 0xCD, 0x03, 0x6E, 0xCC, 0x87, 0xCD, + 0x03, 0x6E, 0xCC, 0x8C, 0xCD, 0x03, 0x6E, 0xCC, + 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0xA7, 0xA9, 0x03, + 0x6E, 0xCC, 0xAD, 0xB9, 0x03, 0x6E, 0xCC, 0xB1, + 0xB9, 0x03, 0x6F, 0xCC, 0x80, 0xCD, 0x03, 0x6F, + // Bytes 3580 - 35bf + 0xCC, 0x81, 0xCD, 0x03, 0x6F, 0xCC, 0x86, 0xCD, + 0x03, 0x6F, 0xCC, 0x89, 0xCD, 0x03, 0x6F, 0xCC, + 0x8B, 0xCD, 0x03, 0x6F, 0xCC, 0x8C, 0xCD, 0x03, + 0x6F, 0xCC, 0x8F, 0xCD, 0x03, 0x6F, 0xCC, 0x91, + 0xCD, 0x03, 0x70, 0xCC, 0x81, 0xCD, 0x03, 0x70, + 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, 0x81, 0xCD, + 0x03, 0x72, 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, + 0x8C, 0xCD, 0x03, 0x72, 0xCC, 0x8F, 0xCD, 0x03, + // Bytes 35c0 - 35ff + 0x72, 0xCC, 0x91, 0xCD, 0x03, 0x72, 0xCC, 0xA7, + 0xA9, 0x03, 0x72, 0xCC, 0xB1, 0xB9, 0x03, 0x73, + 0xCC, 0x82, 0xCD, 0x03, 0x73, 0xCC, 0x87, 0xCD, + 0x03, 0x73, 0xCC, 0xA6, 0xB9, 0x03, 0x73, 0xCC, + 0xA7, 0xA9, 0x03, 0x74, 0xCC, 0x87, 0xCD, 0x03, + 0x74, 0xCC, 0x88, 0xCD, 0x03, 0x74, 0xCC, 0x8C, + 0xCD, 0x03, 0x74, 0xCC, 0xA3, 0xB9, 0x03, 0x74, + 0xCC, 0xA6, 0xB9, 0x03, 0x74, 0xCC, 0xA7, 0xA9, + // Bytes 3600 - 363f + 0x03, 0x74, 0xCC, 0xAD, 0xB9, 0x03, 0x74, 0xCC, + 0xB1, 0xB9, 0x03, 0x75, 0xCC, 0x80, 0xCD, 0x03, + 0x75, 0xCC, 0x81, 0xCD, 0x03, 0x75, 0xCC, 0x82, + 0xCD, 0x03, 0x75, 0xCC, 0x86, 0xCD, 0x03, 0x75, + 0xCC, 0x89, 0xCD, 0x03, 0x75, 0xCC, 0x8A, 0xCD, + 0x03, 0x75, 0xCC, 0x8B, 0xCD, 0x03, 0x75, 0xCC, + 0x8C, 0xCD, 0x03, 0x75, 0xCC, 0x8F, 0xCD, 0x03, + 0x75, 0xCC, 0x91, 0xCD, 0x03, 0x75, 0xCC, 0xA3, + // Bytes 3640 - 367f + 0xB9, 0x03, 0x75, 0xCC, 0xA4, 0xB9, 0x03, 0x75, + 0xCC, 0xA8, 0xA9, 0x03, 0x75, 0xCC, 0xAD, 0xB9, + 0x03, 0x75, 0xCC, 0xB0, 0xB9, 0x03, 0x76, 0xCC, + 0x83, 0xCD, 0x03, 0x76, 0xCC, 0xA3, 0xB9, 0x03, + 0x77, 0xCC, 0x80, 0xCD, 0x03, 0x77, 0xCC, 0x81, + 0xCD, 0x03, 0x77, 0xCC, 0x82, 0xCD, 0x03, 0x77, + 0xCC, 0x87, 0xCD, 0x03, 0x77, 0xCC, 0x88, 0xCD, + 0x03, 0x77, 0xCC, 0x8A, 0xCD, 0x03, 0x77, 0xCC, + // Bytes 3680 - 36bf + 0xA3, 0xB9, 0x03, 0x78, 0xCC, 0x87, 0xCD, 0x03, + 0x78, 0xCC, 0x88, 0xCD, 0x03, 0x79, 0xCC, 0x80, + 0xCD, 0x03, 0x79, 0xCC, 0x81, 0xCD, 0x03, 0x79, + 0xCC, 0x82, 0xCD, 0x03, 0x79, 0xCC, 0x83, 0xCD, + 0x03, 0x79, 0xCC, 0x84, 0xCD, 0x03, 0x79, 0xCC, + 0x87, 0xCD, 0x03, 0x79, 0xCC, 0x88, 0xCD, 0x03, + 0x79, 0xCC, 0x89, 0xCD, 0x03, 0x79, 0xCC, 0x8A, + 0xCD, 0x03, 0x79, 0xCC, 0xA3, 0xB9, 0x03, 0x7A, + // Bytes 36c0 - 36ff + 0xCC, 0x81, 0xCD, 0x03, 0x7A, 0xCC, 0x82, 0xCD, + 0x03, 0x7A, 0xCC, 0x87, 0xCD, 0x03, 0x7A, 0xCC, + 0x8C, 0xCD, 0x03, 0x7A, 0xCC, 0xA3, 0xB9, 0x03, + 0x7A, 0xCC, 0xB1, 0xB9, 0x04, 0xC2, 0xA8, 0xCC, + 0x80, 0xCE, 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, + 0x04, 0xC2, 0xA8, 0xCD, 0x82, 0xCE, 0x04, 0xC3, + 0x86, 0xCC, 0x81, 0xCD, 0x04, 0xC3, 0x86, 0xCC, + 0x84, 0xCD, 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xCD, + // Bytes 3700 - 373f + 0x04, 0xC3, 0xA6, 0xCC, 0x81, 0xCD, 0x04, 0xC3, + 0xA6, 0xCC, 0x84, 0xCD, 0x04, 0xC3, 0xB8, 0xCC, + 0x81, 0xCD, 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xCD, + 0x04, 0xC6, 0xB7, 0xCC, 0x8C, 0xCD, 0x04, 0xCA, + 0x92, 0xCC, 0x8C, 0xCD, 0x04, 0xCE, 0x91, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0x91, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0x91, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0x91, 0xCD, + // Bytes 3740 - 377f + 0x85, 0xDD, 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0x95, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0x97, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x97, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xDD, + 0x04, 0xCE, 0x99, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0x99, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0x99, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + // Bytes 3780 - 37bf + 0x9F, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x9F, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x80, 0xCD, 0x04, 0xCE, + 0xA5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, + 0x84, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xCD, + 0x04, 0xCE, 0xA5, 0xCC, 0x88, 0xCD, 0x04, 0xCE, + 0xA9, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0xA9, 0xCC, + 0x81, 0xCD, 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xDD, + // Bytes 37c0 - 37ff + 0x04, 0xCE, 0xB1, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB1, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB1, 0xCD, + 0x85, 0xDD, 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xB5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, + 0xB7, 0xCD, 0x85, 0xDD, 0x04, 0xCE, 0xB9, 0xCC, + 0x80, 0xCD, 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, + 0x04, 0xCE, 0xB9, 0xCC, 0x84, 0xCD, 0x04, 0xCE, + 0xB9, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB9, 0xCD, + // Bytes 3800 - 383f + 0x82, 0xCD, 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xCD, + 0x04, 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x81, 0xCC, 0x93, 0xCD, 0x04, 0xCF, 0x81, 0xCC, + 0x94, 0xCD, 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xCD, + 0x04, 0xCF, 0x85, 0xCC, 0x81, 0xCD, 0x04, 0xCF, + 0x85, 0xCC, 0x84, 0xCD, 0x04, 0xCF, 0x85, 0xCC, + 0x86, 0xCD, 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xCD, + 0x04, 0xCF, 0x89, 0xCD, 0x85, 0xDD, 0x04, 0xCF, + // Bytes 3840 - 387f + 0x92, 0xCC, 0x81, 0xCD, 0x04, 0xCF, 0x92, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0x90, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x90, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x93, 0xCC, + 0x81, 0xCD, 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0x95, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0x95, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x96, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xCD, + // Bytes 3880 - 38bf + 0x04, 0xD0, 0x97, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x98, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0x98, 0xCC, + 0x84, 0xCD, 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xCD, + 0x04, 0xD0, 0x98, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0x9A, 0xCC, 0x81, 0xCD, 0x04, 0xD0, 0x9E, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xCD, + 0x04, 0xD0, 0xA3, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + 0xA3, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, + // Bytes 38c0 - 38ff + 0x8B, 0xCD, 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xAB, 0xCC, 0x88, 0xCD, 0x04, 0xD0, + 0xAD, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB3, 0xCC, 0x81, 0xCD, 0x04, 0xD0, + 0xB5, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, + 0x86, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xCD, + 0x04, 0xD0, 0xB6, 0xCC, 0x86, 0xCD, 0x04, 0xD0, + // Bytes 3900 - 393f + 0xB6, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB7, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xCD, + 0x04, 0xD0, 0xB8, 0xCC, 0x84, 0xCD, 0x04, 0xD0, + 0xB8, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, + 0x88, 0xCD, 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xCD, + 0x04, 0xD0, 0xBE, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0x83, 0xCC, 0x84, 0xCD, 0x04, 0xD1, 0x83, 0xCC, + 0x86, 0xCD, 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xCD, + // Bytes 3940 - 397f + 0x04, 0xD1, 0x83, 0xCC, 0x8B, 0xCD, 0x04, 0xD1, + 0x87, 0xCC, 0x88, 0xCD, 0x04, 0xD1, 0x8B, 0xCC, + 0x88, 0xCD, 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xCD, + 0x04, 0xD1, 0x96, 0xCC, 0x88, 0xCD, 0x04, 0xD1, + 0xB4, 0xCC, 0x8F, 0xCD, 0x04, 0xD1, 0xB5, 0xCC, + 0x8F, 0xCD, 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xCD, + 0x04, 0xD3, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xD3, + 0xA8, 0xCC, 0x88, 0xCD, 0x04, 0xD3, 0xA9, 0xCC, + // Bytes 3980 - 39bf + 0x88, 0xCD, 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xCD, + 0x04, 0xD8, 0xA7, 0xD9, 0x94, 0xCD, 0x04, 0xD8, + 0xA7, 0xD9, 0x95, 0xB9, 0x04, 0xD9, 0x88, 0xD9, + 0x94, 0xCD, 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xCD, + 0x04, 0xDB, 0x81, 0xD9, 0x94, 0xCD, 0x04, 0xDB, + 0x92, 0xD9, 0x94, 0xCD, 0x04, 0xDB, 0x95, 0xD9, + 0x94, 0xCD, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + // Bytes 39c0 - 39ff + 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x41, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x41, + 0xCC, 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x41, 0xCC, + 0x86, 0xCC, 0x81, 0xCE, 0x05, 0x41, 0xCC, 0x86, + 0xCC, 0x83, 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC, + 0x89, 0xCE, 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, + 0xCE, 0x05, 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCE, + 0x05, 0x41, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, + // Bytes 3a00 - 3a3f + 0x41, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x41, + 0xCC, 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x43, 0xCC, + 0xA7, 0xCC, 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, + 0xCC, 0x80, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, + 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, + 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCE, + 0x05, 0x45, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, + 0x45, 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x45, + // Bytes 3a40 - 3a7f + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x45, 0xCC, + 0xA7, 0xCC, 0x86, 0xCE, 0x05, 0x49, 0xCC, 0x88, + 0xCC, 0x81, 0xCE, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, + 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, + 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, + 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, + 0x4F, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x4F, + 0xCC, 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + // Bytes 3a80 - 3abf + 0x83, 0xCC, 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x83, + 0xCC, 0x88, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, + 0x80, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, + 0xCE, 0x05, 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + 0x05, 0x4F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x4F, 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x4F, + 0xCC, 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC, + 0x9B, 0xCC, 0x83, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, + // Bytes 3ac0 - 3aff + 0xCC, 0x89, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, + 0xA3, 0xBA, 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, + 0xCE, 0x05, 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, + 0x05, 0x52, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, + 0x53, 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x53, + 0xCC, 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x53, 0xCC, + 0xA3, 0xCC, 0x87, 0xCE, 0x05, 0x55, 0xCC, 0x83, + 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x84, 0xCC, + // Bytes 3b00 - 3b3f + 0x88, 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x55, 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x55, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x55, 0xCC, + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, + // Bytes 3b40 - 3b7f + 0xBA, 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x61, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x61, + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x61, 0xCC, + 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x61, 0xCC, 0x86, + 0xCC, 0x81, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, + 0x83, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, + 0xCE, 0x05, 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCE, + // Bytes 3b80 - 3bbf + 0x05, 0x61, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, + 0x61, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, 0x61, + 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x61, 0xCC, + 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x63, 0xCC, 0xA7, + 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, + 0x80, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, + 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCE, + 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, + // Bytes 3bc0 - 3bff + 0x65, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, 0x65, + 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, + 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x65, 0xCC, 0xA7, + 0xCC, 0x86, 0xCE, 0x05, 0x69, 0xCC, 0x88, 0xCC, + 0x81, 0xCE, 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, + 0xCE, 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCE, + 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05, + 0x6F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x6F, + // Bytes 3c00 - 3c3f + 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x6F, 0xCC, + 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x83, + 0xCC, 0x84, 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC, + 0x88, 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, + 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCE, + 0x05, 0x6F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05, + 0x6F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x6F, + 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x6F, 0xCC, + // Bytes 3c40 - 3c7f + 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, + 0xCC, 0x83, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, + 0x89, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, + 0xBA, 0x05, 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, + 0x05, 0x6F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, 0x05, + 0x72, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, 0x73, + 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, + 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, 0xA3, + // Bytes 3c80 - 3cbf + 0xCC, 0x87, 0xCE, 0x05, 0x75, 0xCC, 0x83, 0xCC, + 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, + 0xCE, 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCE, + 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x05, + 0x75, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x75, + 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x75, 0xCC, + 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x75, 0xCC, 0x9B, + 0xCC, 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, + // Bytes 3cc0 - 3cff + 0x83, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, + 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA, + 0x05, 0xE1, 0xBE, 0xBF, 0xCC, 0x80, 0xCE, 0x05, + 0xE1, 0xBE, 0xBF, 0xCC, 0x81, 0xCE, 0x05, 0xE1, + 0xBE, 0xBF, 0xCD, 0x82, 0xCE, 0x05, 0xE1, 0xBF, + 0xBE, 0xCC, 0x80, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, + 0xCC, 0x81, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, + 0x82, 0xCE, 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, + // Bytes 3d00 - 3d3f + 0x05, 0x05, 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x87, 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x87, 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, + 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, + // Bytes 3d40 - 3d7f + 0x05, 0xE2, 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x88, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0x85, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, + // Bytes 3d80 - 3dbf + 0xE2, 0x89, 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x89, 0xB3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0xB6, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + // Bytes 3dc0 - 3dff + 0x8A, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + 0x86, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x8A, 0xAB, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + // Bytes 3e00 - 3e3f + 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, + 0x05, 0x06, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, + // Bytes 3e40 - 3e7f + 0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3e80 - 3ebf + 0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, + // Bytes 3ec0 - 3eff + 0xCE, 0x06, 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, + // Bytes 3f00 - 3f3f + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 3f40 - 3f7f + 0xDE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 3f80 - 3fbf + 0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, + // Bytes 3fc0 - 3fff + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, + 0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, + 0xCE, 0x06, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, + // Bytes 4000 - 403f + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, + 0xDE, 0x06, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, + 0xDE, 0x06, 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, + 0x0D, 0x06, 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, + 0x89, 0x06, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, + // Bytes 4040 - 407f + 0x15, 0x06, 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, + // Bytes 4080 - 40bf + 0x11, 0x06, 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, + // Bytes 40c0 - 40ff + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, + // Bytes 4100 - 413f + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4140 - 417f + 0x11, 0x06, 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, + // Bytes 4180 - 41bf + 0x11, 0x06, 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, + // Bytes 41c0 - 41ff + 0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, + 0x11, 0x06, 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, + // Bytes 4200 - 423f + 0x11, 0x06, 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, + 0x11, 0x06, 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, + 0x11, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, + // Bytes 4240 - 427f + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + // Bytes 4280 - 42bf + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, + // Bytes 42c0 - 42ff + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + // Bytes 4300 - 433f + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, + 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, + 0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, + 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, + 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, + 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + // Bytes 4340 - 437f + 0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, + 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, + 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x94, + 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, + 0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, + 0xDF, 0x08, 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, + // Bytes 4380 - 43bf + 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, 0x82, 0x9B, + 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, + 0x82, 0xA5, 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x42, + 0xC2, 0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xCD, + 0x43, 0x20, 0xCC, 0x83, 0xCD, 0x43, 0x20, 0xCC, + 0x84, 0xCD, 0x43, 0x20, 0xCC, 0x85, 0xCD, 0x43, + 0x20, 0xCC, 0x86, 0xCD, 0x43, 0x20, 0xCC, 0x87, + 0xCD, 0x43, 0x20, 0xCC, 0x88, 0xCD, 0x43, 0x20, + // Bytes 43c0 - 43ff + 0xCC, 0x8A, 0xCD, 0x43, 0x20, 0xCC, 0x8B, 0xCD, + 0x43, 0x20, 0xCC, 0x93, 0xCD, 0x43, 0x20, 0xCC, + 0x94, 0xCD, 0x43, 0x20, 0xCC, 0xA7, 0xA9, 0x43, + 0x20, 0xCC, 0xA8, 0xA9, 0x43, 0x20, 0xCC, 0xB3, + 0xB9, 0x43, 0x20, 0xCD, 0x82, 0xCD, 0x43, 0x20, + 0xCD, 0x85, 0xDD, 0x43, 0x20, 0xD9, 0x8B, 0x5D, + 0x43, 0x20, 0xD9, 0x8C, 0x61, 0x43, 0x20, 0xD9, + 0x8D, 0x65, 0x43, 0x20, 0xD9, 0x8E, 0x69, 0x43, + // Bytes 4400 - 443f + 0x20, 0xD9, 0x8F, 0x6D, 0x43, 0x20, 0xD9, 0x90, + 0x71, 0x43, 0x20, 0xD9, 0x91, 0x75, 0x43, 0x20, + 0xD9, 0x92, 0x79, 0x43, 0x41, 0xCC, 0x8A, 0xCD, + 0x43, 0x73, 0xCC, 0x87, 0xCD, 0x44, 0x20, 0xE3, + 0x82, 0x99, 0x11, 0x44, 0x20, 0xE3, 0x82, 0x9A, + 0x11, 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, 0x44, + 0xCE, 0x91, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x95, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x97, 0xCC, 0x81, + // Bytes 4440 - 447f + 0xCD, 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0x9F, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, 0xCC, 0x88, + 0xCD, 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB5, + 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB7, 0xCC, 0x81, + 0xCD, 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, 0x44, + 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x85, + // Bytes 4480 - 44bf + 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x89, 0xCC, 0x81, + 0xCD, 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x35, 0x44, + 0xD7, 0x90, 0xD6, 0xB8, 0x39, 0x44, 0xD7, 0x90, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x92, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x93, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x94, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x3D, 0x44, + // Bytes 44c0 - 44ff + 0xD7, 0x95, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x96, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x98, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x29, 0x44, + 0xD7, 0x99, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9A, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x4D, 0x44, + 0xD7, 0x9C, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9E, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, + // Bytes 4500 - 453f + 0x45, 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA3, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, + 0x4D, 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x45, 0x44, + 0xD7, 0xA7, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA8, + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, + 0x45, 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x51, 0x44, + 0xD7, 0xA9, 0xD7, 0x82, 0x55, 0x44, 0xD7, 0xAA, + // Bytes 4540 - 457f + 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, + 0x35, 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x5D, 0x44, + 0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x44, 0xD8, 0xA7, + 0xD9, 0x94, 0xCD, 0x44, 0xD8, 0xA7, 0xD9, 0x95, + 0xB9, 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x7D, 0x44, + 0xD8, 0xB1, 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x80, + 0xD9, 0x8B, 0x5D, 0x44, 0xD9, 0x80, 0xD9, 0x8E, + 0x69, 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x6D, 0x44, + // Bytes 4580 - 45bf + 0xD9, 0x80, 0xD9, 0x90, 0x71, 0x44, 0xD9, 0x80, + 0xD9, 0x91, 0x75, 0x44, 0xD9, 0x80, 0xD9, 0x92, + 0x79, 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x7D, 0x44, + 0xD9, 0x88, 0xD9, 0x94, 0xCD, 0x44, 0xD9, 0x89, + 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x8A, 0xD9, 0x94, + 0xCD, 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xCD, 0x44, + 0xDB, 0x95, 0xD9, 0x94, 0xCD, 0x45, 0x20, 0xCC, + 0x88, 0xCC, 0x80, 0xCE, 0x45, 0x20, 0xCC, 0x88, + // Bytes 45c0 - 45ff + 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, 0x88, 0xCD, + 0x82, 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, + 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCE, + 0x45, 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x45, + 0x20, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x45, 0x20, + 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, + 0x94, 0xCD, 0x82, 0xCE, 0x45, 0x20, 0xD9, 0x8C, + 0xD9, 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8D, 0xD9, + // Bytes 4600 - 463f + 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, + 0x76, 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x76, + 0x45, 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x45, + 0x20, 0xD9, 0x91, 0xD9, 0xB0, 0x7E, 0x45, 0xE2, + 0xAB, 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xCF, 0x85, + 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xD7, 0xA9, + 0xD6, 0xBC, 0xD7, 0x81, 0x52, 0x46, 0xD7, 0xA9, + // Bytes 4640 - 467f + 0xD6, 0xBC, 0xD7, 0x82, 0x56, 0x46, 0xD9, 0x80, + 0xD9, 0x8E, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x8F, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80, + 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x46, 0xE0, 0xA4, + 0x95, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x96, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x97, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0x9C, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + // Bytes 4680 - 46bf + 0xA1, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xA2, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAB, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4, + 0xAF, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA1, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xA2, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6, + 0xAF, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x96, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + // Bytes 46c0 - 46ff + 0x97, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0x9C, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xAB, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB2, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8, + 0xB8, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA1, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xAC, + 0xA2, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE0, 0xBE, + // Bytes 4700 - 473f + 0xB3, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE3, 0x83, + 0x86, 0xE3, 0x82, 0x99, 0x11, 0x48, 0xF0, 0x9D, + 0x85, 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x48, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xBA, + 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x49, 0xE0, 0xBE, + 0xB2, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, + // Bytes 4740 - 477f + 0x49, 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, + 0xBE, 0x80, 0xA2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, + 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, + 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xB0, 0xB2, 0x4C, 0xF0, 0x9D, + 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + // Bytes 4780 - 47bf + 0x85, 0xB1, 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, + 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, + 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xB2, 0x4C, + 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, + 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, 0xF0, 0x9D, + 0x86, 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, + 0x85, 0xAE, 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, + // Bytes 47c0 - 47ff + 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, + 0xB2, 0x83, 0x41, 0xCC, 0x82, 0xCD, 0x83, 0x41, + 0xCC, 0x86, 0xCD, 0x83, 0x41, 0xCC, 0x87, 0xCD, + 0x83, 0x41, 0xCC, 0x88, 0xCD, 0x83, 0x41, 0xCC, + 0x8A, 0xCD, 0x83, 0x41, 0xCC, 0xA3, 0xB9, 0x83, + 0x43, 0xCC, 0xA7, 0xA9, 0x83, 0x45, 0xCC, 0x82, + 0xCD, 0x83, 0x45, 0xCC, 0x84, 0xCD, 0x83, 0x45, + 0xCC, 0xA3, 0xB9, 0x83, 0x45, 0xCC, 0xA7, 0xA9, + // Bytes 4800 - 483f + 0x83, 0x49, 0xCC, 0x88, 0xCD, 0x83, 0x4C, 0xCC, + 0xA3, 0xB9, 0x83, 0x4F, 0xCC, 0x82, 0xCD, 0x83, + 0x4F, 0xCC, 0x83, 0xCD, 0x83, 0x4F, 0xCC, 0x84, + 0xCD, 0x83, 0x4F, 0xCC, 0x87, 0xCD, 0x83, 0x4F, + 0xCC, 0x88, 0xCD, 0x83, 0x4F, 0xCC, 0x9B, 0xB1, + 0x83, 0x4F, 0xCC, 0xA3, 0xB9, 0x83, 0x4F, 0xCC, + 0xA8, 0xA9, 0x83, 0x52, 0xCC, 0xA3, 0xB9, 0x83, + 0x53, 0xCC, 0x81, 0xCD, 0x83, 0x53, 0xCC, 0x8C, + // Bytes 4840 - 487f + 0xCD, 0x83, 0x53, 0xCC, 0xA3, 0xB9, 0x83, 0x55, + 0xCC, 0x83, 0xCD, 0x83, 0x55, 0xCC, 0x84, 0xCD, + 0x83, 0x55, 0xCC, 0x88, 0xCD, 0x83, 0x55, 0xCC, + 0x9B, 0xB1, 0x83, 0x61, 0xCC, 0x82, 0xCD, 0x83, + 0x61, 0xCC, 0x86, 0xCD, 0x83, 0x61, 0xCC, 0x87, + 0xCD, 0x83, 0x61, 0xCC, 0x88, 0xCD, 0x83, 0x61, + 0xCC, 0x8A, 0xCD, 0x83, 0x61, 0xCC, 0xA3, 0xB9, + 0x83, 0x63, 0xCC, 0xA7, 0xA9, 0x83, 0x65, 0xCC, + // Bytes 4880 - 48bf + 0x82, 0xCD, 0x83, 0x65, 0xCC, 0x84, 0xCD, 0x83, + 0x65, 0xCC, 0xA3, 0xB9, 0x83, 0x65, 0xCC, 0xA7, + 0xA9, 0x83, 0x69, 0xCC, 0x88, 0xCD, 0x83, 0x6C, + 0xCC, 0xA3, 0xB9, 0x83, 0x6F, 0xCC, 0x82, 0xCD, + 0x83, 0x6F, 0xCC, 0x83, 0xCD, 0x83, 0x6F, 0xCC, + 0x84, 0xCD, 0x83, 0x6F, 0xCC, 0x87, 0xCD, 0x83, + 0x6F, 0xCC, 0x88, 0xCD, 0x83, 0x6F, 0xCC, 0x9B, + 0xB1, 0x83, 0x6F, 0xCC, 0xA3, 0xB9, 0x83, 0x6F, + // Bytes 48c0 - 48ff + 0xCC, 0xA8, 0xA9, 0x83, 0x72, 0xCC, 0xA3, 0xB9, + 0x83, 0x73, 0xCC, 0x81, 0xCD, 0x83, 0x73, 0xCC, + 0x8C, 0xCD, 0x83, 0x73, 0xCC, 0xA3, 0xB9, 0x83, + 0x75, 0xCC, 0x83, 0xCD, 0x83, 0x75, 0xCC, 0x84, + 0xCD, 0x83, 0x75, 0xCC, 0x88, 0xCD, 0x83, 0x75, + 0xCC, 0x9B, 0xB1, 0x84, 0xCE, 0x91, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x95, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x95, + // Bytes 4900 - 493f + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x99, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xCD, 0x84, + 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xA9, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xA9, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x84, + // Bytes 4940 - 497f + 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x84, 0xCE, 0xB1, + 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x94, + 0xCD, 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x84, + 0xCE, 0xB5, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB5, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x80, + 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x84, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB7, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCD, 0x82, + // Bytes 4980 - 49bf + 0xCD, 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x84, + 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB9, + 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x93, + 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xCD, 0x84, + 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x84, 0xCF, 0x85, + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x85, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x84, + 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x84, 0xCF, 0x89, + // Bytes 49c0 - 49ff + 0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x94, + 0xCD, 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4a00 - 4a3f + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + // Bytes 4a40 - 4a7f + 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + // Bytes 4a80 - 4abf + 0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86, + // Bytes 4ac0 - 4aff + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86, + 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x42, + 0xCC, 0x80, 0xCD, 0x33, 0x42, 0xCC, 0x81, 0xCD, + 0x33, 0x42, 0xCC, 0x93, 0xCD, 0x33, 0x43, 0xE1, + // Bytes 4b00 - 4b3f + 0x85, 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, + // Bytes 4b40 - 4b7f + 0x43, 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, + 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, + 0x43, 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, + 0x85, 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, + // Bytes 4b80 - 4bbf + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, + 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, + 0x43, 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, + 0x86, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, + 0x01, 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCE, + 0x33, 0x43, 0xE3, 0x82, 0x99, 0x11, 0x04, 0x43, + // Bytes 4bc0 - 4bff + 0xE3, 0x82, 0x9A, 0x11, 0x04, 0x46, 0xE0, 0xBD, + 0xB1, 0xE0, 0xBD, 0xB2, 0xA2, 0x27, 0x46, 0xE0, + 0xBD, 0xB1, 0xE0, 0xBD, 0xB4, 0xA6, 0x27, 0x46, + 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, 0x27, + 0x00, 0x01, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfcTrie. Total size: 10798 bytes (10.54 KiB). Checksum: b5981cc85e3bd14. +type nfcTrie struct{} + +func newNfcTrie(i int) *nfcTrie { + return &nfcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 46: + return uint16(nfcValues[n<<6+uint32(b)]) + default: + n -= 46 + return uint16(nfcSparse.lookup(n, b)) + } +} + +// nfcValues: 48 blocks, 3072 entries, 6144 bytes +// The third block is the zero block. +var nfcValues = [3072]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, + // Block 0x5, offset 0x140 + 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0xa000, + // Block 0x6, offset 0x180 + 0x184: 0x8100, 0x185: 0x8100, + 0x186: 0x8100, + 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x8100, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x8100, 0x285: 0x36e2, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x3862, 0x2c1: 0x386e, 0x2c3: 0x385c, + 0x2c6: 0xa000, 0x2c7: 0x384a, + 0x2cc: 0x389e, 0x2cd: 0x3886, 0x2ce: 0x38b0, 0x2d0: 0xa000, + 0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000, + 0x2d8: 0xa000, 0x2d9: 0x3892, 0x2da: 0xa000, + 0x2de: 0xa000, 0x2e3: 0xa000, + 0x2e7: 0xa000, + 0x2eb: 0xa000, 0x2ed: 0xa000, + 0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000, + 0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x3916, 0x2fa: 0xa000, + 0x2fe: 0xa000, + // Block 0xc, offset 0x300 + 0x301: 0x3874, 0x302: 0x38f8, + 0x310: 0x3850, 0x311: 0x38d4, + 0x312: 0x3856, 0x313: 0x38da, 0x316: 0x3868, 0x317: 0x38ec, + 0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x396a, 0x31b: 0x3970, 0x31c: 0x387a, 0x31d: 0x38fe, + 0x31e: 0x3880, 0x31f: 0x3904, 0x322: 0x388c, 0x323: 0x3910, + 0x324: 0x3898, 0x325: 0x391c, 0x326: 0x38a4, 0x327: 0x3928, 0x328: 0xa000, 0x329: 0xa000, + 0x32a: 0x3976, 0x32b: 0x397c, 0x32c: 0x38ce, 0x32d: 0x3952, 0x32e: 0x38aa, 0x32f: 0x392e, + 0x330: 0x38b6, 0x331: 0x393a, 0x332: 0x38bc, 0x333: 0x3940, 0x334: 0x38c2, 0x335: 0x3946, + 0x338: 0x38c8, 0x339: 0x394c, + // Block 0xd, offset 0x340 + 0x351: 0x812e, + 0x352: 0x8133, 0x353: 0x8133, 0x354: 0x8133, 0x355: 0x8133, 0x356: 0x812e, 0x357: 0x8133, + 0x358: 0x8133, 0x359: 0x8133, 0x35a: 0x812f, 0x35b: 0x812e, 0x35c: 0x8133, 0x35d: 0x8133, + 0x35e: 0x8133, 0x35f: 0x8133, 0x360: 0x8133, 0x361: 0x8133, 0x362: 0x812e, 0x363: 0x812e, + 0x364: 0x812e, 0x365: 0x812e, 0x366: 0x812e, 0x367: 0x812e, 0x368: 0x8133, 0x369: 0x8133, + 0x36a: 0x812e, 0x36b: 0x8133, 0x36c: 0x8133, 0x36d: 0x812f, 0x36e: 0x8132, 0x36f: 0x8133, + 0x370: 0x8106, 0x371: 0x8107, 0x372: 0x8108, 0x373: 0x8109, 0x374: 0x810a, 0x375: 0x810b, + 0x376: 0x810c, 0x377: 0x810d, 0x378: 0x810e, 0x379: 0x810f, 0x37a: 0x810f, 0x37b: 0x8110, + 0x37c: 0x8111, 0x37d: 0x8112, 0x37f: 0x8113, + // Block 0xe, offset 0x380 + 0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8117, + 0x38c: 0x8118, 0x38d: 0x8119, 0x38e: 0x811a, 0x38f: 0x811b, 0x390: 0x811c, 0x391: 0x811d, + 0x392: 0x811e, 0x393: 0x9933, 0x394: 0x9933, 0x395: 0x992e, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x8133, 0x39b: 0x8133, 0x39c: 0x812e, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x812e, + 0x3b0: 0x811f, + // Block 0xf, offset 0x3c0 + 0x3ca: 0x8133, 0x3cb: 0x8133, + 0x3cc: 0x8133, 0x3cd: 0x8133, 0x3ce: 0x8133, 0x3cf: 0x812e, 0x3d0: 0x812e, 0x3d1: 0x812e, + 0x3d2: 0x812e, 0x3d3: 0x812e, 0x3d4: 0x8133, 0x3d5: 0x8133, 0x3d6: 0x8133, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x8133, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x8133, 0x3e0: 0x8133, 0x3e1: 0x8133, 0x3e3: 0x812e, + 0x3e4: 0x8133, 0x3e5: 0x8133, 0x3e6: 0x812e, 0x3e7: 0x8133, 0x3e8: 0x8133, 0x3e9: 0x812e, + 0x3ea: 0x8133, 0x3eb: 0x8133, 0x3ec: 0x8133, 0x3ed: 0x812e, 0x3ee: 0x812e, 0x3ef: 0x812e, + 0x3f0: 0x8117, 0x3f1: 0x8118, 0x3f2: 0x8119, 0x3f3: 0x8133, 0x3f4: 0x8133, 0x3f5: 0x8133, + 0x3f6: 0x812e, 0x3f7: 0x8133, 0x3f8: 0x8133, 0x3f9: 0x812e, 0x3fa: 0x812e, 0x3fb: 0x8133, + 0x3fc: 0x8133, 0x3fd: 0x8133, 0x3fe: 0x8133, 0x3ff: 0x8133, + // Block 0x10, offset 0x400 + 0x405: 0xa000, + 0x406: 0x2e5d, 0x407: 0xa000, 0x408: 0x2e65, 0x409: 0xa000, 0x40a: 0x2e6d, 0x40b: 0xa000, + 0x40c: 0x2e75, 0x40d: 0xa000, 0x40e: 0x2e7d, 0x411: 0xa000, + 0x412: 0x2e85, + 0x434: 0x8103, 0x435: 0x9900, + 0x43a: 0xa000, 0x43b: 0x2e8d, + 0x43c: 0xa000, 0x43d: 0x2e95, 0x43e: 0xa000, 0x43f: 0xa000, + // Block 0x11, offset 0x440 + 0x440: 0x8133, 0x441: 0x8133, 0x442: 0x812e, 0x443: 0x8133, 0x444: 0x8133, 0x445: 0x8133, + 0x446: 0x8133, 0x447: 0x8133, 0x448: 0x8133, 0x449: 0x8133, 0x44a: 0x812e, 0x44b: 0x8133, + 0x44c: 0x8133, 0x44d: 0x8136, 0x44e: 0x812b, 0x44f: 0x812e, 0x450: 0x812a, 0x451: 0x8133, + 0x452: 0x8133, 0x453: 0x8133, 0x454: 0x8133, 0x455: 0x8133, 0x456: 0x8133, 0x457: 0x8133, + 0x458: 0x8133, 0x459: 0x8133, 0x45a: 0x8133, 0x45b: 0x8133, 0x45c: 0x8133, 0x45d: 0x8133, + 0x45e: 0x8133, 0x45f: 0x8133, 0x460: 0x8133, 0x461: 0x8133, 0x462: 0x8133, 0x463: 0x8133, + 0x464: 0x8133, 0x465: 0x8133, 0x466: 0x8133, 0x467: 0x8133, 0x468: 0x8133, 0x469: 0x8133, + 0x46a: 0x8133, 0x46b: 0x8133, 0x46c: 0x8133, 0x46d: 0x8133, 0x46e: 0x8133, 0x46f: 0x8133, + 0x470: 0x8133, 0x471: 0x8133, 0x472: 0x8133, 0x473: 0x8133, 0x474: 0x8133, 0x475: 0x8133, + 0x476: 0x8134, 0x477: 0x8132, 0x478: 0x8132, 0x479: 0x812e, 0x47a: 0x812d, 0x47b: 0x8133, + 0x47c: 0x8135, 0x47d: 0x812e, 0x47e: 0x8133, 0x47f: 0x812e, + // Block 0x12, offset 0x480 + 0x480: 0x30d8, 0x481: 0x33e4, 0x482: 0x30e2, 0x483: 0x33ee, 0x484: 0x30e7, 0x485: 0x33f3, + 0x486: 0x30ec, 0x487: 0x33f8, 0x488: 0x3a0d, 0x489: 0x3b9c, 0x48a: 0x3105, 0x48b: 0x3411, + 0x48c: 0x310f, 0x48d: 0x341b, 0x48e: 0x311e, 0x48f: 0x342a, 0x490: 0x3114, 0x491: 0x3420, + 0x492: 0x3119, 0x493: 0x3425, 0x494: 0x3a30, 0x495: 0x3bbf, 0x496: 0x3a37, 0x497: 0x3bc6, + 0x498: 0x315a, 0x499: 0x3466, 0x49a: 0x315f, 0x49b: 0x346b, 0x49c: 0x3a45, 0x49d: 0x3bd4, + 0x49e: 0x3164, 0x49f: 0x3470, 0x4a0: 0x3173, 0x4a1: 0x347f, 0x4a2: 0x3191, 0x4a3: 0x349d, + 0x4a4: 0x31a0, 0x4a5: 0x34ac, 0x4a6: 0x3196, 0x4a7: 0x34a2, 0x4a8: 0x31a5, 0x4a9: 0x34b1, + 0x4aa: 0x31aa, 0x4ab: 0x34b6, 0x4ac: 0x31f0, 0x4ad: 0x34fc, 0x4ae: 0x3a4c, 0x4af: 0x3bdb, + 0x4b0: 0x31fa, 0x4b1: 0x350b, 0x4b2: 0x3204, 0x4b3: 0x3515, 0x4b4: 0x320e, 0x4b5: 0x351f, + 0x4b6: 0x4805, 0x4b7: 0x4896, 0x4b8: 0x3a53, 0x4b9: 0x3be2, 0x4ba: 0x3227, 0x4bb: 0x3538, + 0x4bc: 0x3222, 0x4bd: 0x3533, 0x4be: 0x322c, 0x4bf: 0x353d, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x3231, 0x4c1: 0x3542, 0x4c2: 0x3236, 0x4c3: 0x3547, 0x4c4: 0x324a, 0x4c5: 0x355b, + 0x4c6: 0x3254, 0x4c7: 0x3565, 0x4c8: 0x3263, 0x4c9: 0x3574, 0x4ca: 0x325e, 0x4cb: 0x356f, + 0x4cc: 0x3a76, 0x4cd: 0x3c05, 0x4ce: 0x3a84, 0x4cf: 0x3c13, 0x4d0: 0x3a8b, 0x4d1: 0x3c1a, + 0x4d2: 0x3a92, 0x4d3: 0x3c21, 0x4d4: 0x3290, 0x4d5: 0x35a1, 0x4d6: 0x3295, 0x4d7: 0x35a6, + 0x4d8: 0x329f, 0x4d9: 0x35b0, 0x4da: 0x4832, 0x4db: 0x48c3, 0x4dc: 0x3ad8, 0x4dd: 0x3c67, + 0x4de: 0x32b8, 0x4df: 0x35c9, 0x4e0: 0x32c2, 0x4e1: 0x35d3, 0x4e2: 0x4841, 0x4e3: 0x48d2, + 0x4e4: 0x3adf, 0x4e5: 0x3c6e, 0x4e6: 0x3ae6, 0x4e7: 0x3c75, 0x4e8: 0x3aed, 0x4e9: 0x3c7c, + 0x4ea: 0x32d1, 0x4eb: 0x35e2, 0x4ec: 0x32db, 0x4ed: 0x35f1, 0x4ee: 0x32ef, 0x4ef: 0x3605, + 0x4f0: 0x32ea, 0x4f1: 0x3600, 0x4f2: 0x332b, 0x4f3: 0x3641, 0x4f4: 0x333a, 0x4f5: 0x3650, + 0x4f6: 0x3335, 0x4f7: 0x364b, 0x4f8: 0x3af4, 0x4f9: 0x3c83, 0x4fa: 0x3afb, 0x4fb: 0x3c8a, + 0x4fc: 0x333f, 0x4fd: 0x3655, 0x4fe: 0x3344, 0x4ff: 0x365a, + // Block 0x14, offset 0x500 + 0x500: 0x3349, 0x501: 0x365f, 0x502: 0x334e, 0x503: 0x3664, 0x504: 0x335d, 0x505: 0x3673, + 0x506: 0x3358, 0x507: 0x366e, 0x508: 0x3362, 0x509: 0x367d, 0x50a: 0x3367, 0x50b: 0x3682, + 0x50c: 0x336c, 0x50d: 0x3687, 0x50e: 0x338a, 0x50f: 0x36a5, 0x510: 0x33a3, 0x511: 0x36c3, + 0x512: 0x33b2, 0x513: 0x36d2, 0x514: 0x33b7, 0x515: 0x36d7, 0x516: 0x34bb, 0x517: 0x35e7, + 0x518: 0x3678, 0x519: 0x36b4, 0x51b: 0x3712, + 0x520: 0x47e2, 0x521: 0x4873, 0x522: 0x30c4, 0x523: 0x33d0, + 0x524: 0x39b9, 0x525: 0x3b48, 0x526: 0x39b2, 0x527: 0x3b41, 0x528: 0x39c7, 0x529: 0x3b56, + 0x52a: 0x39c0, 0x52b: 0x3b4f, 0x52c: 0x39ff, 0x52d: 0x3b8e, 0x52e: 0x39d5, 0x52f: 0x3b64, + 0x530: 0x39ce, 0x531: 0x3b5d, 0x532: 0x39e3, 0x533: 0x3b72, 0x534: 0x39dc, 0x535: 0x3b6b, + 0x536: 0x3a06, 0x537: 0x3b95, 0x538: 0x47f6, 0x539: 0x4887, 0x53a: 0x3141, 0x53b: 0x344d, + 0x53c: 0x312d, 0x53d: 0x3439, 0x53e: 0x3a1b, 0x53f: 0x3baa, + // Block 0x15, offset 0x540 + 0x540: 0x3a14, 0x541: 0x3ba3, 0x542: 0x3a29, 0x543: 0x3bb8, 0x544: 0x3a22, 0x545: 0x3bb1, + 0x546: 0x3a3e, 0x547: 0x3bcd, 0x548: 0x31d2, 0x549: 0x34de, 0x54a: 0x31e6, 0x54b: 0x34f2, + 0x54c: 0x4828, 0x54d: 0x48b9, 0x54e: 0x3277, 0x54f: 0x3588, 0x550: 0x3a61, 0x551: 0x3bf0, + 0x552: 0x3a5a, 0x553: 0x3be9, 0x554: 0x3a6f, 0x555: 0x3bfe, 0x556: 0x3a68, 0x557: 0x3bf7, + 0x558: 0x3aca, 0x559: 0x3c59, 0x55a: 0x3aae, 0x55b: 0x3c3d, 0x55c: 0x3aa7, 0x55d: 0x3c36, + 0x55e: 0x3abc, 0x55f: 0x3c4b, 0x560: 0x3ab5, 0x561: 0x3c44, 0x562: 0x3ac3, 0x563: 0x3c52, + 0x564: 0x3326, 0x565: 0x363c, 0x566: 0x3308, 0x567: 0x361e, 0x568: 0x3b25, 0x569: 0x3cb4, + 0x56a: 0x3b1e, 0x56b: 0x3cad, 0x56c: 0x3b33, 0x56d: 0x3cc2, 0x56e: 0x3b2c, 0x56f: 0x3cbb, + 0x570: 0x3b3a, 0x571: 0x3cc9, 0x572: 0x3371, 0x573: 0x368c, 0x574: 0x3399, 0x575: 0x36b9, + 0x576: 0x3394, 0x577: 0x36af, 0x578: 0x3380, 0x579: 0x369b, + // Block 0x16, offset 0x580 + 0x580: 0x4945, 0x581: 0x494b, 0x582: 0x4a5f, 0x583: 0x4a77, 0x584: 0x4a67, 0x585: 0x4a7f, + 0x586: 0x4a6f, 0x587: 0x4a87, 0x588: 0x48eb, 0x589: 0x48f1, 0x58a: 0x49cf, 0x58b: 0x49e7, + 0x58c: 0x49d7, 0x58d: 0x49ef, 0x58e: 0x49df, 0x58f: 0x49f7, 0x590: 0x4957, 0x591: 0x495d, + 0x592: 0x3ef9, 0x593: 0x3f09, 0x594: 0x3f01, 0x595: 0x3f11, + 0x598: 0x48f7, 0x599: 0x48fd, 0x59a: 0x3e29, 0x59b: 0x3e39, 0x59c: 0x3e31, 0x59d: 0x3e41, + 0x5a0: 0x496f, 0x5a1: 0x4975, 0x5a2: 0x4a8f, 0x5a3: 0x4aa7, + 0x5a4: 0x4a97, 0x5a5: 0x4aaf, 0x5a6: 0x4a9f, 0x5a7: 0x4ab7, 0x5a8: 0x4903, 0x5a9: 0x4909, + 0x5aa: 0x49ff, 0x5ab: 0x4a17, 0x5ac: 0x4a07, 0x5ad: 0x4a1f, 0x5ae: 0x4a0f, 0x5af: 0x4a27, + 0x5b0: 0x4987, 0x5b1: 0x498d, 0x5b2: 0x3f59, 0x5b3: 0x3f71, 0x5b4: 0x3f61, 0x5b5: 0x3f79, + 0x5b6: 0x3f69, 0x5b7: 0x3f81, 0x5b8: 0x490f, 0x5b9: 0x4915, 0x5ba: 0x3e59, 0x5bb: 0x3e71, + 0x5bc: 0x3e61, 0x5bd: 0x3e79, 0x5be: 0x3e69, 0x5bf: 0x3e81, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x4993, 0x5c1: 0x4999, 0x5c2: 0x3f89, 0x5c3: 0x3f99, 0x5c4: 0x3f91, 0x5c5: 0x3fa1, + 0x5c8: 0x491b, 0x5c9: 0x4921, 0x5ca: 0x3e89, 0x5cb: 0x3e99, + 0x5cc: 0x3e91, 0x5cd: 0x3ea1, 0x5d0: 0x49a5, 0x5d1: 0x49ab, + 0x5d2: 0x3fc1, 0x5d3: 0x3fd9, 0x5d4: 0x3fc9, 0x5d5: 0x3fe1, 0x5d6: 0x3fd1, 0x5d7: 0x3fe9, + 0x5d9: 0x4927, 0x5db: 0x3ea9, 0x5dd: 0x3eb1, + 0x5df: 0x3eb9, 0x5e0: 0x49bd, 0x5e1: 0x49c3, 0x5e2: 0x4abf, 0x5e3: 0x4ad7, + 0x5e4: 0x4ac7, 0x5e5: 0x4adf, 0x5e6: 0x4acf, 0x5e7: 0x4ae7, 0x5e8: 0x492d, 0x5e9: 0x4933, + 0x5ea: 0x4a2f, 0x5eb: 0x4a47, 0x5ec: 0x4a37, 0x5ed: 0x4a4f, 0x5ee: 0x4a3f, 0x5ef: 0x4a57, + 0x5f0: 0x4939, 0x5f1: 0x445f, 0x5f2: 0x37d2, 0x5f3: 0x4465, 0x5f4: 0x4963, 0x5f5: 0x446b, + 0x5f6: 0x37e4, 0x5f7: 0x4471, 0x5f8: 0x3802, 0x5f9: 0x4477, 0x5fa: 0x381a, 0x5fb: 0x447d, + 0x5fc: 0x49b1, 0x5fd: 0x4483, + // Block 0x18, offset 0x600 + 0x600: 0x3ee1, 0x601: 0x3ee9, 0x602: 0x42c5, 0x603: 0x42e3, 0x604: 0x42cf, 0x605: 0x42ed, + 0x606: 0x42d9, 0x607: 0x42f7, 0x608: 0x3e19, 0x609: 0x3e21, 0x60a: 0x4211, 0x60b: 0x422f, + 0x60c: 0x421b, 0x60d: 0x4239, 0x60e: 0x4225, 0x60f: 0x4243, 0x610: 0x3f29, 0x611: 0x3f31, + 0x612: 0x4301, 0x613: 0x431f, 0x614: 0x430b, 0x615: 0x4329, 0x616: 0x4315, 0x617: 0x4333, + 0x618: 0x3e49, 0x619: 0x3e51, 0x61a: 0x424d, 0x61b: 0x426b, 0x61c: 0x4257, 0x61d: 0x4275, + 0x61e: 0x4261, 0x61f: 0x427f, 0x620: 0x4001, 0x621: 0x4009, 0x622: 0x433d, 0x623: 0x435b, + 0x624: 0x4347, 0x625: 0x4365, 0x626: 0x4351, 0x627: 0x436f, 0x628: 0x3ec1, 0x629: 0x3ec9, + 0x62a: 0x4289, 0x62b: 0x42a7, 0x62c: 0x4293, 0x62d: 0x42b1, 0x62e: 0x429d, 0x62f: 0x42bb, + 0x630: 0x37c6, 0x631: 0x37c0, 0x632: 0x3ed1, 0x633: 0x37cc, 0x634: 0x3ed9, + 0x636: 0x4951, 0x637: 0x3ef1, 0x638: 0x3736, 0x639: 0x3730, 0x63a: 0x3724, 0x63b: 0x442f, + 0x63c: 0x373c, 0x63d: 0x8100, 0x63e: 0x0257, 0x63f: 0xa100, + // Block 0x19, offset 0x640 + 0x640: 0x8100, 0x641: 0x36e8, 0x642: 0x3f19, 0x643: 0x37de, 0x644: 0x3f21, + 0x646: 0x497b, 0x647: 0x3f39, 0x648: 0x3742, 0x649: 0x4435, 0x64a: 0x374e, 0x64b: 0x443b, + 0x64c: 0x375a, 0x64d: 0x3cd0, 0x64e: 0x3cd7, 0x64f: 0x3cde, 0x650: 0x37f6, 0x651: 0x37f0, + 0x652: 0x3f41, 0x653: 0x4625, 0x656: 0x37fc, 0x657: 0x3f51, + 0x658: 0x3772, 0x659: 0x376c, 0x65a: 0x3760, 0x65b: 0x4441, 0x65d: 0x3ce5, + 0x65e: 0x3cec, 0x65f: 0x3cf3, 0x660: 0x382c, 0x661: 0x3826, 0x662: 0x3fa9, 0x663: 0x462d, + 0x664: 0x380e, 0x665: 0x3814, 0x666: 0x3832, 0x667: 0x3fb9, 0x668: 0x37a2, 0x669: 0x379c, + 0x66a: 0x3790, 0x66b: 0x444d, 0x66c: 0x378a, 0x66d: 0x36dc, 0x66e: 0x4429, 0x66f: 0x0081, + 0x672: 0x3ff1, 0x673: 0x3838, 0x674: 0x3ff9, + 0x676: 0x49c9, 0x677: 0x4011, 0x678: 0x377e, 0x679: 0x4447, 0x67a: 0x37ae, 0x67b: 0x4459, + 0x67c: 0x37ba, 0x67d: 0x4397, 0x67e: 0xa100, + // Block 0x1a, offset 0x680 + 0x681: 0x3d47, 0x683: 0xa000, 0x684: 0x3d4e, 0x685: 0xa000, + 0x687: 0x3d55, 0x688: 0xa000, 0x689: 0x3d5c, + 0x68d: 0xa000, + 0x6a0: 0x30a6, 0x6a1: 0xa000, 0x6a2: 0x3d6a, + 0x6a4: 0xa000, 0x6a5: 0xa000, + 0x6ad: 0x3d63, 0x6ae: 0x30a1, 0x6af: 0x30ab, + 0x6b0: 0x3d71, 0x6b1: 0x3d78, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3d7f, 0x6b5: 0x3d86, + 0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3d8d, 0x6b9: 0x3d94, 0x6ba: 0xa000, 0x6bb: 0xa000, + 0x6bc: 0xa000, 0x6bd: 0xa000, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3d9b, 0x6c1: 0x3da2, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3db7, 0x6c5: 0x3dbe, + 0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3dc5, 0x6c9: 0x3dcc, + 0x6d1: 0xa000, + 0x6d2: 0xa000, + 0x6e2: 0xa000, + 0x6e8: 0xa000, 0x6e9: 0xa000, + 0x6eb: 0xa000, 0x6ec: 0x3de1, 0x6ed: 0x3de8, 0x6ee: 0x3def, 0x6ef: 0x3df6, + 0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000, + // Block 0x1c, offset 0x700 + 0x706: 0xa000, 0x70b: 0xa000, + 0x70c: 0x4049, 0x70d: 0xa000, 0x70e: 0x4051, 0x70f: 0xa000, 0x710: 0x4059, 0x711: 0xa000, + 0x712: 0x4061, 0x713: 0xa000, 0x714: 0x4069, 0x715: 0xa000, 0x716: 0x4071, 0x717: 0xa000, + 0x718: 0x4079, 0x719: 0xa000, 0x71a: 0x4081, 0x71b: 0xa000, 0x71c: 0x4089, 0x71d: 0xa000, + 0x71e: 0x4091, 0x71f: 0xa000, 0x720: 0x4099, 0x721: 0xa000, 0x722: 0x40a1, + 0x724: 0xa000, 0x725: 0x40a9, 0x726: 0xa000, 0x727: 0x40b1, 0x728: 0xa000, 0x729: 0x40b9, + 0x72f: 0xa000, + 0x730: 0x40c1, 0x731: 0x40c9, 0x732: 0xa000, 0x733: 0x40d1, 0x734: 0x40d9, 0x735: 0xa000, + 0x736: 0x40e1, 0x737: 0x40e9, 0x738: 0xa000, 0x739: 0x40f1, 0x73a: 0x40f9, 0x73b: 0xa000, + 0x73c: 0x4101, 0x73d: 0x4109, + // Block 0x1d, offset 0x740 + 0x754: 0x4041, + 0x759: 0x9904, 0x75a: 0x9904, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000, + 0x75e: 0x4111, + 0x766: 0xa000, + 0x76b: 0xa000, 0x76c: 0x4121, 0x76d: 0xa000, 0x76e: 0x4129, 0x76f: 0xa000, + 0x770: 0x4131, 0x771: 0xa000, 0x772: 0x4139, 0x773: 0xa000, 0x774: 0x4141, 0x775: 0xa000, + 0x776: 0x4149, 0x777: 0xa000, 0x778: 0x4151, 0x779: 0xa000, 0x77a: 0x4159, 0x77b: 0xa000, + 0x77c: 0x4161, 0x77d: 0xa000, 0x77e: 0x4169, 0x77f: 0xa000, + // Block 0x1e, offset 0x780 + 0x780: 0x4171, 0x781: 0xa000, 0x782: 0x4179, 0x784: 0xa000, 0x785: 0x4181, + 0x786: 0xa000, 0x787: 0x4189, 0x788: 0xa000, 0x789: 0x4191, + 0x78f: 0xa000, 0x790: 0x4199, 0x791: 0x41a1, + 0x792: 0xa000, 0x793: 0x41a9, 0x794: 0x41b1, 0x795: 0xa000, 0x796: 0x41b9, 0x797: 0x41c1, + 0x798: 0xa000, 0x799: 0x41c9, 0x79a: 0x41d1, 0x79b: 0xa000, 0x79c: 0x41d9, 0x79d: 0x41e1, + 0x7af: 0xa000, + 0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x4119, + 0x7b7: 0x41e9, 0x7b8: 0x41f1, 0x7b9: 0x41f9, 0x7ba: 0x4201, + 0x7bd: 0xa000, 0x7be: 0x4209, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x1472, 0x7c1: 0x0df6, 0x7c2: 0x14ce, 0x7c3: 0x149a, 0x7c4: 0x0f52, 0x7c5: 0x07e6, + 0x7c6: 0x09da, 0x7c7: 0x1726, 0x7c8: 0x1726, 0x7c9: 0x0b06, 0x7ca: 0x155a, 0x7cb: 0x0a3e, + 0x7cc: 0x0b02, 0x7cd: 0x0cea, 0x7ce: 0x10ca, 0x7cf: 0x125a, 0x7d0: 0x1392, 0x7d1: 0x13ce, + 0x7d2: 0x1402, 0x7d3: 0x1516, 0x7d4: 0x0e6e, 0x7d5: 0x0efa, 0x7d6: 0x0fa6, 0x7d7: 0x103e, + 0x7d8: 0x135a, 0x7d9: 0x1542, 0x7da: 0x166e, 0x7db: 0x080a, 0x7dc: 0x09ae, 0x7dd: 0x0e82, + 0x7de: 0x0fca, 0x7df: 0x138e, 0x7e0: 0x16be, 0x7e1: 0x0bae, 0x7e2: 0x0f72, 0x7e3: 0x137e, + 0x7e4: 0x1412, 0x7e5: 0x0d1e, 0x7e6: 0x12b6, 0x7e7: 0x13da, 0x7e8: 0x0c1a, 0x7e9: 0x0e0a, + 0x7ea: 0x0f12, 0x7eb: 0x1016, 0x7ec: 0x1522, 0x7ed: 0x084a, 0x7ee: 0x08e2, 0x7ef: 0x094e, + 0x7f0: 0x0d86, 0x7f1: 0x0e7a, 0x7f2: 0x0fc6, 0x7f3: 0x10ea, 0x7f4: 0x1272, 0x7f5: 0x1386, + 0x7f6: 0x139e, 0x7f7: 0x14c2, 0x7f8: 0x15ea, 0x7f9: 0x169e, 0x7fa: 0x16ba, 0x7fb: 0x1126, + 0x7fc: 0x1166, 0x7fd: 0x121e, 0x7fe: 0x133e, 0x7ff: 0x1576, + // Block 0x20, offset 0x800 + 0x800: 0x16c6, 0x801: 0x1446, 0x802: 0x0ac2, 0x803: 0x0c36, 0x804: 0x11d6, 0x805: 0x1296, + 0x806: 0x0ffa, 0x807: 0x112e, 0x808: 0x1492, 0x809: 0x15e2, 0x80a: 0x0abe, 0x80b: 0x0b8a, + 0x80c: 0x0e72, 0x80d: 0x0f26, 0x80e: 0x0f5a, 0x80f: 0x120e, 0x810: 0x1236, 0x811: 0x15a2, + 0x812: 0x094a, 0x813: 0x12a2, 0x814: 0x08ee, 0x815: 0x08ea, 0x816: 0x1192, 0x817: 0x1222, + 0x818: 0x1356, 0x819: 0x15aa, 0x81a: 0x1462, 0x81b: 0x0d22, 0x81c: 0x0e6e, 0x81d: 0x1452, + 0x81e: 0x07f2, 0x81f: 0x0b5e, 0x820: 0x0c8e, 0x821: 0x102a, 0x822: 0x10aa, 0x823: 0x096e, + 0x824: 0x1136, 0x825: 0x085a, 0x826: 0x0c72, 0x827: 0x07d2, 0x828: 0x0ee6, 0x829: 0x0d9e, + 0x82a: 0x120a, 0x82b: 0x09c2, 0x82c: 0x0aae, 0x82d: 0x10f6, 0x82e: 0x135e, 0x82f: 0x1436, + 0x830: 0x0eb2, 0x831: 0x14f2, 0x832: 0x0ede, 0x833: 0x0d32, 0x834: 0x1316, 0x835: 0x0d52, + 0x836: 0x10a6, 0x837: 0x0826, 0x838: 0x08a2, 0x839: 0x08e6, 0x83a: 0x0e4e, 0x83b: 0x11f6, + 0x83c: 0x12ee, 0x83d: 0x1442, 0x83e: 0x1556, 0x83f: 0x0956, + // Block 0x21, offset 0x840 + 0x840: 0x0a0a, 0x841: 0x0b12, 0x842: 0x0c2a, 0x843: 0x0dba, 0x844: 0x0f76, 0x845: 0x113a, + 0x846: 0x1592, 0x847: 0x1676, 0x848: 0x16ca, 0x849: 0x16e2, 0x84a: 0x0932, 0x84b: 0x0dee, + 0x84c: 0x0e9e, 0x84d: 0x14e6, 0x84e: 0x0bf6, 0x84f: 0x0cd2, 0x850: 0x0cee, 0x851: 0x0d7e, + 0x852: 0x0f66, 0x853: 0x0fb2, 0x854: 0x1062, 0x855: 0x1186, 0x856: 0x122a, 0x857: 0x128e, + 0x858: 0x14d6, 0x859: 0x1366, 0x85a: 0x14fe, 0x85b: 0x157a, 0x85c: 0x090a, 0x85d: 0x0936, + 0x85e: 0x0a1e, 0x85f: 0x0fa2, 0x860: 0x13ee, 0x861: 0x1436, 0x862: 0x0c16, 0x863: 0x0c86, + 0x864: 0x0d4a, 0x865: 0x0eaa, 0x866: 0x11d2, 0x867: 0x101e, 0x868: 0x0836, 0x869: 0x0a7a, + 0x86a: 0x0b5e, 0x86b: 0x0bc2, 0x86c: 0x0c92, 0x86d: 0x103a, 0x86e: 0x1056, 0x86f: 0x1266, + 0x870: 0x1286, 0x871: 0x155e, 0x872: 0x15de, 0x873: 0x15ee, 0x874: 0x162a, 0x875: 0x084e, + 0x876: 0x117a, 0x877: 0x154a, 0x878: 0x15c6, 0x879: 0x0caa, 0x87a: 0x0812, 0x87b: 0x0872, + 0x87c: 0x0b62, 0x87d: 0x0b82, 0x87e: 0x0daa, 0x87f: 0x0e6e, + // Block 0x22, offset 0x880 + 0x880: 0x0fbe, 0x881: 0x10c6, 0x882: 0x1372, 0x883: 0x1512, 0x884: 0x171e, 0x885: 0x0dde, + 0x886: 0x159e, 0x887: 0x092e, 0x888: 0x0e2a, 0x889: 0x0e36, 0x88a: 0x0f0a, 0x88b: 0x0f42, + 0x88c: 0x1046, 0x88d: 0x10a2, 0x88e: 0x1122, 0x88f: 0x1206, 0x890: 0x1636, 0x891: 0x08aa, + 0x892: 0x0cfe, 0x893: 0x15ae, 0x894: 0x0862, 0x895: 0x0ba6, 0x896: 0x0f2a, 0x897: 0x14da, + 0x898: 0x0c62, 0x899: 0x0cb2, 0x89a: 0x0e3e, 0x89b: 0x102a, 0x89c: 0x15b6, 0x89d: 0x0912, + 0x89e: 0x09fa, 0x89f: 0x0b92, 0x8a0: 0x0dce, 0x8a1: 0x0e1a, 0x8a2: 0x0e5a, 0x8a3: 0x0eee, + 0x8a4: 0x1042, 0x8a5: 0x10b6, 0x8a6: 0x1252, 0x8a7: 0x13f2, 0x8a8: 0x13fe, 0x8a9: 0x1552, + 0x8aa: 0x15d2, 0x8ab: 0x097e, 0x8ac: 0x0f46, 0x8ad: 0x09fe, 0x8ae: 0x0fc2, 0x8af: 0x1066, + 0x8b0: 0x1382, 0x8b1: 0x15ba, 0x8b2: 0x16a6, 0x8b3: 0x16ce, 0x8b4: 0x0e32, 0x8b5: 0x0f22, + 0x8b6: 0x12be, 0x8b7: 0x11b2, 0x8b8: 0x11be, 0x8b9: 0x11e2, 0x8ba: 0x1012, 0x8bb: 0x0f9a, + 0x8bc: 0x145e, 0x8bd: 0x082e, 0x8be: 0x1326, 0x8bf: 0x0916, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x0906, 0x8c1: 0x0c06, 0x8c2: 0x0d26, 0x8c3: 0x11ee, 0x8c4: 0x0b4e, 0x8c5: 0x0efe, + 0x8c6: 0x0dea, 0x8c7: 0x14e2, 0x8c8: 0x13e2, 0x8c9: 0x15a6, 0x8ca: 0x141e, 0x8cb: 0x0c22, + 0x8cc: 0x0882, 0x8cd: 0x0a56, 0x8d0: 0x0aaa, + 0x8d2: 0x0dda, 0x8d5: 0x08f2, 0x8d6: 0x101a, 0x8d7: 0x10de, + 0x8d8: 0x1142, 0x8d9: 0x115e, 0x8da: 0x1162, 0x8db: 0x1176, 0x8dc: 0x15f6, 0x8dd: 0x11e6, + 0x8de: 0x126a, 0x8e0: 0x138a, 0x8e2: 0x144e, + 0x8e5: 0x1502, 0x8e6: 0x152e, + 0x8ea: 0x164a, 0x8eb: 0x164e, 0x8ec: 0x1652, 0x8ed: 0x16b6, 0x8ee: 0x1526, 0x8ef: 0x15c2, + 0x8f0: 0x0852, 0x8f1: 0x0876, 0x8f2: 0x088a, 0x8f3: 0x0946, 0x8f4: 0x0952, 0x8f5: 0x0992, + 0x8f6: 0x0a46, 0x8f7: 0x0a62, 0x8f8: 0x0a6a, 0x8f9: 0x0aa6, 0x8fa: 0x0ab2, 0x8fb: 0x0b8e, + 0x8fc: 0x0b96, 0x8fd: 0x0c9e, 0x8fe: 0x0cc6, 0x8ff: 0x0cce, + // Block 0x24, offset 0x900 + 0x900: 0x0ce6, 0x901: 0x0d92, 0x902: 0x0dc2, 0x903: 0x0de2, 0x904: 0x0e52, 0x905: 0x0f16, + 0x906: 0x0f32, 0x907: 0x0f62, 0x908: 0x0fb6, 0x909: 0x0fd6, 0x90a: 0x104a, 0x90b: 0x112a, + 0x90c: 0x1146, 0x90d: 0x114e, 0x90e: 0x114a, 0x90f: 0x1152, 0x910: 0x1156, 0x911: 0x115a, + 0x912: 0x116e, 0x913: 0x1172, 0x914: 0x1196, 0x915: 0x11aa, 0x916: 0x11c6, 0x917: 0x122a, + 0x918: 0x1232, 0x919: 0x123a, 0x91a: 0x124e, 0x91b: 0x1276, 0x91c: 0x12c6, 0x91d: 0x12fa, + 0x91e: 0x12fa, 0x91f: 0x1362, 0x920: 0x140a, 0x921: 0x1422, 0x922: 0x1456, 0x923: 0x145a, + 0x924: 0x149e, 0x925: 0x14a2, 0x926: 0x14fa, 0x927: 0x1502, 0x928: 0x15d6, 0x929: 0x161a, + 0x92a: 0x1632, 0x92b: 0x0c96, 0x92c: 0x184b, 0x92d: 0x12de, + 0x930: 0x07da, 0x931: 0x08de, 0x932: 0x089e, 0x933: 0x0846, 0x934: 0x0886, 0x935: 0x08b2, + 0x936: 0x0942, 0x937: 0x095e, 0x938: 0x0a46, 0x939: 0x0a32, 0x93a: 0x0a42, 0x93b: 0x0a5e, + 0x93c: 0x0aaa, 0x93d: 0x0aba, 0x93e: 0x0afe, 0x93f: 0x0b0a, + // Block 0x25, offset 0x940 + 0x940: 0x0b26, 0x941: 0x0b36, 0x942: 0x0c1e, 0x943: 0x0c26, 0x944: 0x0c56, 0x945: 0x0c76, + 0x946: 0x0ca6, 0x947: 0x0cbe, 0x948: 0x0cae, 0x949: 0x0cce, 0x94a: 0x0cc2, 0x94b: 0x0ce6, + 0x94c: 0x0d02, 0x94d: 0x0d5a, 0x94e: 0x0d66, 0x94f: 0x0d6e, 0x950: 0x0d96, 0x951: 0x0dda, + 0x952: 0x0e0a, 0x953: 0x0e0e, 0x954: 0x0e22, 0x955: 0x0ea2, 0x956: 0x0eb2, 0x957: 0x0f0a, + 0x958: 0x0f56, 0x959: 0x0f4e, 0x95a: 0x0f62, 0x95b: 0x0f7e, 0x95c: 0x0fb6, 0x95d: 0x110e, + 0x95e: 0x0fda, 0x95f: 0x100e, 0x960: 0x101a, 0x961: 0x105a, 0x962: 0x1076, 0x963: 0x109a, + 0x964: 0x10be, 0x965: 0x10c2, 0x966: 0x10de, 0x967: 0x10e2, 0x968: 0x10f2, 0x969: 0x1106, + 0x96a: 0x1102, 0x96b: 0x1132, 0x96c: 0x11ae, 0x96d: 0x11c6, 0x96e: 0x11de, 0x96f: 0x1216, + 0x970: 0x122a, 0x971: 0x1246, 0x972: 0x1276, 0x973: 0x132a, 0x974: 0x1352, 0x975: 0x13c6, + 0x976: 0x140e, 0x977: 0x141a, 0x978: 0x1422, 0x979: 0x143a, 0x97a: 0x144e, 0x97b: 0x143e, + 0x97c: 0x1456, 0x97d: 0x1452, 0x97e: 0x144a, 0x97f: 0x145a, + // Block 0x26, offset 0x980 + 0x980: 0x1466, 0x981: 0x14a2, 0x982: 0x14de, 0x983: 0x150e, 0x984: 0x1546, 0x985: 0x1566, + 0x986: 0x15b2, 0x987: 0x15d6, 0x988: 0x15f6, 0x989: 0x160a, 0x98a: 0x161a, 0x98b: 0x1626, + 0x98c: 0x1632, 0x98d: 0x1686, 0x98e: 0x1726, 0x98f: 0x17e2, 0x990: 0x17dd, 0x991: 0x180f, + 0x992: 0x0702, 0x993: 0x072a, 0x994: 0x072e, 0x995: 0x1891, 0x996: 0x18be, 0x997: 0x1936, + 0x998: 0x1712, 0x999: 0x1722, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x07f6, 0x9c1: 0x07ee, 0x9c2: 0x07fe, 0x9c3: 0x1774, 0x9c4: 0x0842, 0x9c5: 0x0852, + 0x9c6: 0x0856, 0x9c7: 0x085e, 0x9c8: 0x0866, 0x9c9: 0x086a, 0x9ca: 0x0876, 0x9cb: 0x086e, + 0x9cc: 0x06ae, 0x9cd: 0x1788, 0x9ce: 0x088a, 0x9cf: 0x088e, 0x9d0: 0x0892, 0x9d1: 0x08ae, + 0x9d2: 0x1779, 0x9d3: 0x06b2, 0x9d4: 0x089a, 0x9d5: 0x08ba, 0x9d6: 0x1783, 0x9d7: 0x08ca, + 0x9d8: 0x08d2, 0x9d9: 0x0832, 0x9da: 0x08da, 0x9db: 0x08de, 0x9dc: 0x195e, 0x9dd: 0x08fa, + 0x9de: 0x0902, 0x9df: 0x06ba, 0x9e0: 0x091a, 0x9e1: 0x091e, 0x9e2: 0x0926, 0x9e3: 0x092a, + 0x9e4: 0x06be, 0x9e5: 0x0942, 0x9e6: 0x0946, 0x9e7: 0x0952, 0x9e8: 0x095e, 0x9e9: 0x0962, + 0x9ea: 0x0966, 0x9eb: 0x096e, 0x9ec: 0x098e, 0x9ed: 0x0992, 0x9ee: 0x099a, 0x9ef: 0x09aa, + 0x9f0: 0x09b2, 0x9f1: 0x09b6, 0x9f2: 0x09b6, 0x9f3: 0x09b6, 0x9f4: 0x1797, 0x9f5: 0x0f8e, + 0x9f6: 0x09ca, 0x9f7: 0x09d2, 0x9f8: 0x179c, 0x9f9: 0x09de, 0x9fa: 0x09e6, 0x9fb: 0x09ee, + 0x9fc: 0x0a16, 0x9fd: 0x0a02, 0x9fe: 0x0a0e, 0x9ff: 0x0a12, + // Block 0x28, offset 0xa00 + 0xa00: 0x0a1a, 0xa01: 0x0a22, 0xa02: 0x0a26, 0xa03: 0x0a2e, 0xa04: 0x0a36, 0xa05: 0x0a3a, + 0xa06: 0x0a3a, 0xa07: 0x0a42, 0xa08: 0x0a4a, 0xa09: 0x0a4e, 0xa0a: 0x0a5a, 0xa0b: 0x0a7e, + 0xa0c: 0x0a62, 0xa0d: 0x0a82, 0xa0e: 0x0a66, 0xa0f: 0x0a6e, 0xa10: 0x0906, 0xa11: 0x0aca, + 0xa12: 0x0a92, 0xa13: 0x0a96, 0xa14: 0x0a9a, 0xa15: 0x0a8e, 0xa16: 0x0aa2, 0xa17: 0x0a9e, + 0xa18: 0x0ab6, 0xa19: 0x17a1, 0xa1a: 0x0ad2, 0xa1b: 0x0ad6, 0xa1c: 0x0ade, 0xa1d: 0x0aea, + 0xa1e: 0x0af2, 0xa1f: 0x0b0e, 0xa20: 0x17a6, 0xa21: 0x17ab, 0xa22: 0x0b1a, 0xa23: 0x0b1e, + 0xa24: 0x0b22, 0xa25: 0x0b16, 0xa26: 0x0b2a, 0xa27: 0x06c2, 0xa28: 0x06c6, 0xa29: 0x0b32, + 0xa2a: 0x0b3a, 0xa2b: 0x0b3a, 0xa2c: 0x17b0, 0xa2d: 0x0b56, 0xa2e: 0x0b5a, 0xa2f: 0x0b5e, + 0xa30: 0x0b66, 0xa31: 0x17b5, 0xa32: 0x0b6e, 0xa33: 0x0b72, 0xa34: 0x0c4a, 0xa35: 0x0b7a, + 0xa36: 0x06ca, 0xa37: 0x0b86, 0xa38: 0x0b96, 0xa39: 0x0ba2, 0xa3a: 0x0b9e, 0xa3b: 0x17bf, + 0xa3c: 0x0baa, 0xa3d: 0x17c4, 0xa3e: 0x0bb6, 0xa3f: 0x0bb2, + // Block 0x29, offset 0xa40 + 0xa40: 0x0bba, 0xa41: 0x0bca, 0xa42: 0x0bce, 0xa43: 0x06ce, 0xa44: 0x0bde, 0xa45: 0x0be6, + 0xa46: 0x0bea, 0xa47: 0x0bee, 0xa48: 0x06d2, 0xa49: 0x17c9, 0xa4a: 0x06d6, 0xa4b: 0x0c0a, + 0xa4c: 0x0c0e, 0xa4d: 0x0c12, 0xa4e: 0x0c1a, 0xa4f: 0x1990, 0xa50: 0x0c32, 0xa51: 0x17d3, + 0xa52: 0x17d3, 0xa53: 0x12d2, 0xa54: 0x0c42, 0xa55: 0x0c42, 0xa56: 0x06da, 0xa57: 0x17f6, + 0xa58: 0x18c8, 0xa59: 0x0c52, 0xa5a: 0x0c5a, 0xa5b: 0x06de, 0xa5c: 0x0c6e, 0xa5d: 0x0c7e, + 0xa5e: 0x0c82, 0xa5f: 0x0c8a, 0xa60: 0x0c9a, 0xa61: 0x06e6, 0xa62: 0x06e2, 0xa63: 0x0c9e, + 0xa64: 0x17d8, 0xa65: 0x0ca2, 0xa66: 0x0cb6, 0xa67: 0x0cba, 0xa68: 0x0cbe, 0xa69: 0x0cba, + 0xa6a: 0x0cca, 0xa6b: 0x0cce, 0xa6c: 0x0cde, 0xa6d: 0x0cd6, 0xa6e: 0x0cda, 0xa6f: 0x0ce2, + 0xa70: 0x0ce6, 0xa71: 0x0cea, 0xa72: 0x0cf6, 0xa73: 0x0cfa, 0xa74: 0x0d12, 0xa75: 0x0d1a, + 0xa76: 0x0d2a, 0xa77: 0x0d3e, 0xa78: 0x17e7, 0xa79: 0x0d3a, 0xa7a: 0x0d2e, 0xa7b: 0x0d46, + 0xa7c: 0x0d4e, 0xa7d: 0x0d62, 0xa7e: 0x17ec, 0xa7f: 0x0d6a, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0d5e, 0xa81: 0x0d56, 0xa82: 0x06ea, 0xa83: 0x0d72, 0xa84: 0x0d7a, 0xa85: 0x0d82, + 0xa86: 0x0d76, 0xa87: 0x06ee, 0xa88: 0x0d92, 0xa89: 0x0d9a, 0xa8a: 0x17f1, 0xa8b: 0x0dc6, + 0xa8c: 0x0dfa, 0xa8d: 0x0dd6, 0xa8e: 0x06fa, 0xa8f: 0x0de2, 0xa90: 0x06f6, 0xa91: 0x06f2, + 0xa92: 0x08be, 0xa93: 0x08c2, 0xa94: 0x0dfe, 0xa95: 0x0de6, 0xa96: 0x12a6, 0xa97: 0x075e, + 0xa98: 0x0e0a, 0xa99: 0x0e0e, 0xa9a: 0x0e12, 0xa9b: 0x0e26, 0xa9c: 0x0e1e, 0xa9d: 0x180a, + 0xa9e: 0x06fe, 0xa9f: 0x0e3a, 0xaa0: 0x0e2e, 0xaa1: 0x0e4a, 0xaa2: 0x0e52, 0xaa3: 0x1814, + 0xaa4: 0x0e56, 0xaa5: 0x0e42, 0xaa6: 0x0e5e, 0xaa7: 0x0702, 0xaa8: 0x0e62, 0xaa9: 0x0e66, + 0xaaa: 0x0e6a, 0xaab: 0x0e76, 0xaac: 0x1819, 0xaad: 0x0e7e, 0xaae: 0x0706, 0xaaf: 0x0e8a, + 0xab0: 0x181e, 0xab1: 0x0e8e, 0xab2: 0x070a, 0xab3: 0x0e9a, 0xab4: 0x0ea6, 0xab5: 0x0eb2, + 0xab6: 0x0eb6, 0xab7: 0x1823, 0xab8: 0x17ba, 0xab9: 0x1828, 0xaba: 0x0ed6, 0xabb: 0x182d, + 0xabc: 0x0ee2, 0xabd: 0x0eea, 0xabe: 0x0eda, 0xabf: 0x0ef6, + // Block 0x2b, offset 0xac0 + 0xac0: 0x0f06, 0xac1: 0x0f16, 0xac2: 0x0f0a, 0xac3: 0x0f0e, 0xac4: 0x0f1a, 0xac5: 0x0f1e, + 0xac6: 0x1832, 0xac7: 0x0f02, 0xac8: 0x0f36, 0xac9: 0x0f3a, 0xaca: 0x070e, 0xacb: 0x0f4e, + 0xacc: 0x0f4a, 0xacd: 0x1837, 0xace: 0x0f2e, 0xacf: 0x0f6a, 0xad0: 0x183c, 0xad1: 0x1841, + 0xad2: 0x0f6e, 0xad3: 0x0f82, 0xad4: 0x0f7e, 0xad5: 0x0f7a, 0xad6: 0x0712, 0xad7: 0x0f86, + 0xad8: 0x0f96, 0xad9: 0x0f92, 0xada: 0x0f9e, 0xadb: 0x177e, 0xadc: 0x0fae, 0xadd: 0x1846, + 0xade: 0x0fba, 0xadf: 0x1850, 0xae0: 0x0fce, 0xae1: 0x0fda, 0xae2: 0x0fee, 0xae3: 0x1855, + 0xae4: 0x1002, 0xae5: 0x1006, 0xae6: 0x185a, 0xae7: 0x185f, 0xae8: 0x1022, 0xae9: 0x1032, + 0xaea: 0x0716, 0xaeb: 0x1036, 0xaec: 0x071a, 0xaed: 0x071a, 0xaee: 0x104e, 0xaef: 0x1052, + 0xaf0: 0x105a, 0xaf1: 0x105e, 0xaf2: 0x106a, 0xaf3: 0x071e, 0xaf4: 0x1082, 0xaf5: 0x1864, + 0xaf6: 0x109e, 0xaf7: 0x1869, 0xaf8: 0x10aa, 0xaf9: 0x17ce, 0xafa: 0x10ba, 0xafb: 0x186e, + 0xafc: 0x1873, 0xafd: 0x1878, 0xafe: 0x0722, 0xaff: 0x0726, + // Block 0x2c, offset 0xb00 + 0xb00: 0x10f2, 0xb01: 0x1882, 0xb02: 0x187d, 0xb03: 0x1887, 0xb04: 0x188c, 0xb05: 0x10fa, + 0xb06: 0x10fe, 0xb07: 0x10fe, 0xb08: 0x1106, 0xb09: 0x072e, 0xb0a: 0x110a, 0xb0b: 0x0732, + 0xb0c: 0x0736, 0xb0d: 0x1896, 0xb0e: 0x111e, 0xb0f: 0x1126, 0xb10: 0x1132, 0xb11: 0x073a, + 0xb12: 0x189b, 0xb13: 0x1156, 0xb14: 0x18a0, 0xb15: 0x18a5, 0xb16: 0x1176, 0xb17: 0x118e, + 0xb18: 0x073e, 0xb19: 0x1196, 0xb1a: 0x119a, 0xb1b: 0x119e, 0xb1c: 0x18aa, 0xb1d: 0x18af, + 0xb1e: 0x18af, 0xb1f: 0x11b6, 0xb20: 0x0742, 0xb21: 0x18b4, 0xb22: 0x11ca, 0xb23: 0x11ce, + 0xb24: 0x0746, 0xb25: 0x18b9, 0xb26: 0x11ea, 0xb27: 0x074a, 0xb28: 0x11fa, 0xb29: 0x11f2, + 0xb2a: 0x1202, 0xb2b: 0x18c3, 0xb2c: 0x121a, 0xb2d: 0x074e, 0xb2e: 0x1226, 0xb2f: 0x122e, + 0xb30: 0x123e, 0xb31: 0x0752, 0xb32: 0x18cd, 0xb33: 0x18d2, 0xb34: 0x0756, 0xb35: 0x18d7, + 0xb36: 0x1256, 0xb37: 0x18dc, 0xb38: 0x1262, 0xb39: 0x126e, 0xb3a: 0x1276, 0xb3b: 0x18e1, + 0xb3c: 0x18e6, 0xb3d: 0x128a, 0xb3e: 0x18eb, 0xb3f: 0x1292, + // Block 0x2d, offset 0xb40 + 0xb40: 0x17fb, 0xb41: 0x075a, 0xb42: 0x12aa, 0xb43: 0x12ae, 0xb44: 0x0762, 0xb45: 0x12b2, + 0xb46: 0x0b2e, 0xb47: 0x18f0, 0xb48: 0x18f5, 0xb49: 0x1800, 0xb4a: 0x1805, 0xb4b: 0x12d2, + 0xb4c: 0x12d6, 0xb4d: 0x14ee, 0xb4e: 0x0766, 0xb4f: 0x1302, 0xb50: 0x12fe, 0xb51: 0x1306, + 0xb52: 0x093a, 0xb53: 0x130a, 0xb54: 0x130e, 0xb55: 0x1312, 0xb56: 0x131a, 0xb57: 0x18fa, + 0xb58: 0x1316, 0xb59: 0x131e, 0xb5a: 0x1332, 0xb5b: 0x1336, 0xb5c: 0x1322, 0xb5d: 0x133a, + 0xb5e: 0x134e, 0xb5f: 0x1362, 0xb60: 0x132e, 0xb61: 0x1342, 0xb62: 0x1346, 0xb63: 0x134a, + 0xb64: 0x18ff, 0xb65: 0x1909, 0xb66: 0x1904, 0xb67: 0x076a, 0xb68: 0x136a, 0xb69: 0x136e, + 0xb6a: 0x1376, 0xb6b: 0x191d, 0xb6c: 0x137a, 0xb6d: 0x190e, 0xb6e: 0x076e, 0xb6f: 0x0772, + 0xb70: 0x1913, 0xb71: 0x1918, 0xb72: 0x0776, 0xb73: 0x139a, 0xb74: 0x139e, 0xb75: 0x13a2, + 0xb76: 0x13a6, 0xb77: 0x13b2, 0xb78: 0x13ae, 0xb79: 0x13ba, 0xb7a: 0x13b6, 0xb7b: 0x13c6, + 0xb7c: 0x13be, 0xb7d: 0x13c2, 0xb7e: 0x13ca, 0xb7f: 0x077a, + // Block 0x2e, offset 0xb80 + 0xb80: 0x13d2, 0xb81: 0x13d6, 0xb82: 0x077e, 0xb83: 0x13e6, 0xb84: 0x13ea, 0xb85: 0x1922, + 0xb86: 0x13f6, 0xb87: 0x13fa, 0xb88: 0x0782, 0xb89: 0x1406, 0xb8a: 0x06b6, 0xb8b: 0x1927, + 0xb8c: 0x192c, 0xb8d: 0x0786, 0xb8e: 0x078a, 0xb8f: 0x1432, 0xb90: 0x144a, 0xb91: 0x1466, + 0xb92: 0x1476, 0xb93: 0x1931, 0xb94: 0x148a, 0xb95: 0x148e, 0xb96: 0x14a6, 0xb97: 0x14b2, + 0xb98: 0x193b, 0xb99: 0x178d, 0xb9a: 0x14be, 0xb9b: 0x14ba, 0xb9c: 0x14c6, 0xb9d: 0x1792, + 0xb9e: 0x14d2, 0xb9f: 0x14de, 0xba0: 0x1940, 0xba1: 0x1945, 0xba2: 0x151e, 0xba3: 0x152a, + 0xba4: 0x1532, 0xba5: 0x194a, 0xba6: 0x1536, 0xba7: 0x1562, 0xba8: 0x156e, 0xba9: 0x1572, + 0xbaa: 0x156a, 0xbab: 0x157e, 0xbac: 0x1582, 0xbad: 0x194f, 0xbae: 0x158e, 0xbaf: 0x078e, + 0xbb0: 0x1596, 0xbb1: 0x1954, 0xbb2: 0x0792, 0xbb3: 0x15ce, 0xbb4: 0x0bbe, 0xbb5: 0x15e6, + 0xbb6: 0x1959, 0xbb7: 0x1963, 0xbb8: 0x0796, 0xbb9: 0x079a, 0xbba: 0x160e, 0xbbb: 0x1968, + 0xbbc: 0x079e, 0xbbd: 0x196d, 0xbbe: 0x1626, 0xbbf: 0x1626, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x162e, 0xbc1: 0x1972, 0xbc2: 0x1646, 0xbc3: 0x07a2, 0xbc4: 0x1656, 0xbc5: 0x1662, + 0xbc6: 0x166a, 0xbc7: 0x1672, 0xbc8: 0x07a6, 0xbc9: 0x1977, 0xbca: 0x1686, 0xbcb: 0x16a2, + 0xbcc: 0x16ae, 0xbcd: 0x07aa, 0xbce: 0x07ae, 0xbcf: 0x16b2, 0xbd0: 0x197c, 0xbd1: 0x07b2, + 0xbd2: 0x1981, 0xbd3: 0x1986, 0xbd4: 0x198b, 0xbd5: 0x16d6, 0xbd6: 0x07b6, 0xbd7: 0x16ea, + 0xbd8: 0x16f2, 0xbd9: 0x16f6, 0xbda: 0x16fe, 0xbdb: 0x1706, 0xbdc: 0x170e, 0xbdd: 0x1995, +} + +// nfcIndex: 22 blocks, 1408 entries, 1408 bytes +// Block 0 is the zero block. +var nfcIndex = [1408]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32, + 0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35, + 0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x3b, 0x121: 0x3c, 0x122: 0x3d, 0x123: 0x0d, 0x124: 0x3e, 0x125: 0x3f, 0x126: 0x40, 0x127: 0x41, + 0x128: 0x42, 0x129: 0x43, 0x12a: 0x44, 0x12b: 0x45, 0x12c: 0x40, 0x12d: 0x46, 0x12e: 0x47, 0x12f: 0x48, + 0x130: 0x44, 0x131: 0x49, 0x132: 0x4a, 0x133: 0x4b, 0x134: 0x4c, 0x135: 0x4d, 0x137: 0x4e, + 0x138: 0x4f, 0x139: 0x50, 0x13a: 0x51, 0x13b: 0x52, 0x13c: 0x53, 0x13d: 0x54, 0x13e: 0x55, 0x13f: 0x56, + // Block 0x5, offset 0x140 + 0x140: 0x57, 0x142: 0x58, 0x144: 0x59, 0x145: 0x5a, 0x146: 0x5b, 0x147: 0x5c, + 0x14d: 0x5d, + 0x15c: 0x5e, 0x15f: 0x5f, + 0x162: 0x60, 0x164: 0x61, + 0x168: 0x62, 0x169: 0x63, 0x16a: 0x64, 0x16b: 0x65, 0x16c: 0x0e, 0x16d: 0x66, 0x16e: 0x67, 0x16f: 0x68, + 0x170: 0x69, 0x173: 0x6a, 0x177: 0x0f, + 0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17, + // Block 0x6, offset 0x180 + 0x180: 0x6b, 0x183: 0x6c, 0x184: 0x6d, 0x186: 0x6e, 0x187: 0x6f, + 0x188: 0x70, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x71, 0x18c: 0x72, + 0x1ab: 0x73, + 0x1b3: 0x74, 0x1b5: 0x75, 0x1b7: 0x76, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x77, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x78, 0x1c5: 0x79, + 0x1c9: 0x7a, 0x1cc: 0x7b, 0x1cd: 0x7c, + // Block 0x8, offset 0x200 + 0x219: 0x7d, 0x21a: 0x7e, 0x21b: 0x7f, + 0x220: 0x80, 0x223: 0x81, 0x224: 0x82, 0x225: 0x83, 0x226: 0x84, 0x227: 0x85, + 0x22a: 0x86, 0x22b: 0x87, 0x22f: 0x88, + 0x230: 0x89, 0x231: 0x8a, 0x232: 0x8b, 0x233: 0x8c, 0x234: 0x8d, 0x235: 0x8e, 0x236: 0x8f, 0x237: 0x89, + 0x238: 0x8a, 0x239: 0x8b, 0x23a: 0x8c, 0x23b: 0x8d, 0x23c: 0x8e, 0x23d: 0x8f, 0x23e: 0x89, 0x23f: 0x8a, + // Block 0x9, offset 0x240 + 0x240: 0x8b, 0x241: 0x8c, 0x242: 0x8d, 0x243: 0x8e, 0x244: 0x8f, 0x245: 0x89, 0x246: 0x8a, 0x247: 0x8b, + 0x248: 0x8c, 0x249: 0x8d, 0x24a: 0x8e, 0x24b: 0x8f, 0x24c: 0x89, 0x24d: 0x8a, 0x24e: 0x8b, 0x24f: 0x8c, + 0x250: 0x8d, 0x251: 0x8e, 0x252: 0x8f, 0x253: 0x89, 0x254: 0x8a, 0x255: 0x8b, 0x256: 0x8c, 0x257: 0x8d, + 0x258: 0x8e, 0x259: 0x8f, 0x25a: 0x89, 0x25b: 0x8a, 0x25c: 0x8b, 0x25d: 0x8c, 0x25e: 0x8d, 0x25f: 0x8e, + 0x260: 0x8f, 0x261: 0x89, 0x262: 0x8a, 0x263: 0x8b, 0x264: 0x8c, 0x265: 0x8d, 0x266: 0x8e, 0x267: 0x8f, + 0x268: 0x89, 0x269: 0x8a, 0x26a: 0x8b, 0x26b: 0x8c, 0x26c: 0x8d, 0x26d: 0x8e, 0x26e: 0x8f, 0x26f: 0x89, + 0x270: 0x8a, 0x271: 0x8b, 0x272: 0x8c, 0x273: 0x8d, 0x274: 0x8e, 0x275: 0x8f, 0x276: 0x89, 0x277: 0x8a, + 0x278: 0x8b, 0x279: 0x8c, 0x27a: 0x8d, 0x27b: 0x8e, 0x27c: 0x8f, 0x27d: 0x89, 0x27e: 0x8a, 0x27f: 0x8b, + // Block 0xa, offset 0x280 + 0x280: 0x8c, 0x281: 0x8d, 0x282: 0x8e, 0x283: 0x8f, 0x284: 0x89, 0x285: 0x8a, 0x286: 0x8b, 0x287: 0x8c, + 0x288: 0x8d, 0x289: 0x8e, 0x28a: 0x8f, 0x28b: 0x89, 0x28c: 0x8a, 0x28d: 0x8b, 0x28e: 0x8c, 0x28f: 0x8d, + 0x290: 0x8e, 0x291: 0x8f, 0x292: 0x89, 0x293: 0x8a, 0x294: 0x8b, 0x295: 0x8c, 0x296: 0x8d, 0x297: 0x8e, + 0x298: 0x8f, 0x299: 0x89, 0x29a: 0x8a, 0x29b: 0x8b, 0x29c: 0x8c, 0x29d: 0x8d, 0x29e: 0x8e, 0x29f: 0x8f, + 0x2a0: 0x89, 0x2a1: 0x8a, 0x2a2: 0x8b, 0x2a3: 0x8c, 0x2a4: 0x8d, 0x2a5: 0x8e, 0x2a6: 0x8f, 0x2a7: 0x89, + 0x2a8: 0x8a, 0x2a9: 0x8b, 0x2aa: 0x8c, 0x2ab: 0x8d, 0x2ac: 0x8e, 0x2ad: 0x8f, 0x2ae: 0x89, 0x2af: 0x8a, + 0x2b0: 0x8b, 0x2b1: 0x8c, 0x2b2: 0x8d, 0x2b3: 0x8e, 0x2b4: 0x8f, 0x2b5: 0x89, 0x2b6: 0x8a, 0x2b7: 0x8b, + 0x2b8: 0x8c, 0x2b9: 0x8d, 0x2ba: 0x8e, 0x2bb: 0x8f, 0x2bc: 0x89, 0x2bd: 0x8a, 0x2be: 0x8b, 0x2bf: 0x8c, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x8d, 0x2c1: 0x8e, 0x2c2: 0x8f, 0x2c3: 0x89, 0x2c4: 0x8a, 0x2c5: 0x8b, 0x2c6: 0x8c, 0x2c7: 0x8d, + 0x2c8: 0x8e, 0x2c9: 0x8f, 0x2ca: 0x89, 0x2cb: 0x8a, 0x2cc: 0x8b, 0x2cd: 0x8c, 0x2ce: 0x8d, 0x2cf: 0x8e, + 0x2d0: 0x8f, 0x2d1: 0x89, 0x2d2: 0x8a, 0x2d3: 0x8b, 0x2d4: 0x8c, 0x2d5: 0x8d, 0x2d6: 0x8e, 0x2d7: 0x8f, + 0x2d8: 0x89, 0x2d9: 0x8a, 0x2da: 0x8b, 0x2db: 0x8c, 0x2dc: 0x8d, 0x2dd: 0x8e, 0x2de: 0x90, + // Block 0xc, offset 0x300 + 0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20, + 0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x91, 0x32d: 0x92, 0x32e: 0x93, + 0x331: 0x94, 0x332: 0x95, 0x333: 0x96, 0x334: 0x97, + 0x338: 0x98, 0x339: 0x99, 0x33a: 0x9a, 0x33b: 0x9b, 0x33e: 0x9c, 0x33f: 0x9d, + // Block 0xd, offset 0x340 + 0x347: 0x9e, + 0x34b: 0x9f, 0x34d: 0xa0, + 0x368: 0xa1, 0x36b: 0xa2, + 0x374: 0xa3, + 0x37a: 0xa4, 0x37b: 0xa5, 0x37d: 0xa6, 0x37e: 0xa7, + // Block 0xe, offset 0x380 + 0x381: 0xa8, 0x382: 0xa9, 0x384: 0xaa, 0x385: 0x84, 0x387: 0xab, + 0x388: 0xac, 0x38b: 0xad, 0x38c: 0xae, 0x38d: 0xaf, + 0x391: 0xb0, 0x392: 0xb1, 0x393: 0xb2, 0x396: 0xb3, 0x397: 0xb4, + 0x398: 0x75, 0x39a: 0xb5, 0x39c: 0xb6, + 0x3a0: 0xb7, 0x3a4: 0xb8, 0x3a5: 0xb9, 0x3a7: 0xba, + 0x3a8: 0xbb, 0x3a9: 0xbc, 0x3aa: 0xbd, + 0x3b0: 0x75, 0x3b5: 0xbe, 0x3b6: 0xbf, + 0x3bd: 0xc0, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xc1, 0x3ec: 0xc2, + 0x3ff: 0xc3, + // Block 0x10, offset 0x400 + 0x432: 0xc4, + // Block 0x11, offset 0x440 + 0x445: 0xc5, 0x446: 0xc6, 0x447: 0xc7, + 0x449: 0xc8, + // Block 0x12, offset 0x480 + 0x480: 0xc9, 0x482: 0xca, 0x484: 0xc2, + 0x48a: 0xcb, 0x48b: 0xcc, + 0x493: 0xcd, + 0x4a3: 0xce, 0x4a5: 0xcf, + // Block 0x13, offset 0x4c0 + 0x4c8: 0xd0, + // Block 0x14, offset 0x500 + 0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c, + 0x528: 0x2d, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfcSparseOffset: 163 entries, 326 bytes +var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x6e, 0x76, 0x7d, 0x80, 0x88, 0x8c, 0x90, 0x92, 0x94, 0x9d, 0xa1, 0xa8, 0xad, 0xb0, 0xba, 0xbd, 0xc4, 0xcc, 0xcf, 0xd1, 0xd4, 0xd6, 0xdb, 0xec, 0xf8, 0xfa, 0x100, 0x102, 0x104, 0x106, 0x108, 0x10a, 0x10c, 0x10f, 0x112, 0x114, 0x117, 0x11a, 0x11e, 0x124, 0x12b, 0x134, 0x136, 0x139, 0x13b, 0x146, 0x14a, 0x158, 0x15b, 0x161, 0x167, 0x172, 0x176, 0x178, 0x17a, 0x17c, 0x17e, 0x180, 0x186, 0x18a, 0x18c, 0x18e, 0x196, 0x19a, 0x19d, 0x19f, 0x1a1, 0x1a4, 0x1a7, 0x1a9, 0x1ab, 0x1ad, 0x1af, 0x1b5, 0x1b8, 0x1ba, 0x1c1, 0x1c7, 0x1cd, 0x1d5, 0x1db, 0x1e1, 0x1e7, 0x1eb, 0x1f9, 0x202, 0x205, 0x208, 0x20a, 0x20d, 0x20f, 0x213, 0x218, 0x21a, 0x21c, 0x221, 0x227, 0x229, 0x22b, 0x22d, 0x233, 0x236, 0x238, 0x23a, 0x23c, 0x242, 0x246, 0x24a, 0x252, 0x259, 0x25c, 0x25f, 0x261, 0x264, 0x26c, 0x270, 0x277, 0x27a, 0x280, 0x282, 0x285, 0x287, 0x28a, 0x28f, 0x291, 0x293, 0x295, 0x297, 0x299, 0x29c, 0x29e, 0x2a0, 0x2a2, 0x2a4, 0x2a6, 0x2a8, 0x2b5, 0x2bf, 0x2c1, 0x2c3, 0x2c9, 0x2cb, 0x2cd, 0x2cf, 0x2d3, 0x2d5, 0x2d8} + +// nfcSparseValues: 730 entries, 2920 bytes +var nfcSparseValues = [730]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x04}, + {value: 0xa100, lo: 0xa8, hi: 0xa8}, + {value: 0x8100, lo: 0xaf, hi: 0xaf}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb8, hi: 0xb8}, + // Block 0x1, offset 0x5 + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x9 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + // Block 0x3, offset 0xb + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x98, hi: 0x9d}, + // Block 0x4, offset 0xd + {value: 0x0006, lo: 0x0a}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x85, hi: 0x85}, + {value: 0xa000, lo: 0x89, hi: 0x89}, + {value: 0x4981, lo: 0x8a, hi: 0x8a}, + {value: 0x499f, lo: 0x8b, hi: 0x8b}, + {value: 0x3808, lo: 0x8c, hi: 0x8c}, + {value: 0x3820, lo: 0x8d, hi: 0x8d}, + {value: 0x49b7, lo: 0x8e, hi: 0x8e}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x383e, lo: 0x93, hi: 0x94}, + // Block 0x5, offset 0x18 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x6, offset 0x28 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x7, offset 0x2a + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x8, offset 0x2f + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x9, offset 0x3a + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0xa, offset 0x49 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xb, offset 0x56 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xc, offset 0x5e + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xd, offset 0x63 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xe, offset 0x68 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xf, offset 0x6a + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0x10, offset 0x6e + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x11, offset 0x76 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x12, offset 0x7d + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x80 + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x14, offset 0x88 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x15, offset 0x8c + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x16, offset 0x90 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x17, offset 0x92 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x18, offset 0x94 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x19, offset 0x9d + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1a, offset 0xa1 + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1b, offset 0xa8 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1c, offset 0xad + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1d, offset 0xb0 + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1e, offset 0xba + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1f, offset 0xbd + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x20, offset 0xc4 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x21, offset 0xcc + {value: 0x0000, lo: 0x02}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x22, offset 0xcf + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x23, offset 0xd1 + {value: 0x0000, lo: 0x02}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x24, offset 0xd4 + {value: 0x0000, lo: 0x01}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + // Block 0x25, offset 0xd6 + {value: 0x0000, lo: 0x04}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x26, offset 0xdb + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x8200, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x8200, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x27, offset 0xec + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x28, offset 0xf8 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x29, offset 0xfa + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x2a, offset 0x100 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2b, offset 0x102 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x104 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x106 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x108 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x10a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x10c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x10f + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x112 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x114 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x117 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x11a + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x11e + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x124 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x12b + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x134 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x136 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x139 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x13b + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x146 + {value: 0x0004, lo: 0x03}, + {value: 0x052a, lo: 0x80, hi: 0x81}, + {value: 0x8100, lo: 0x97, hi: 0x97}, + {value: 0x8100, lo: 0xbe, hi: 0xbe}, + // Block 0x3e, offset 0x14a + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x3f, offset 0x158 + {value: 0x43bc, lo: 0x02}, + {value: 0x023c, lo: 0xa6, hi: 0xa6}, + {value: 0x0057, lo: 0xaa, hi: 0xab}, + // Block 0x40, offset 0x15b + {value: 0x0007, lo: 0x05}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x41, offset 0x161 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x42, offset 0x167 + {value: 0x62c7, lo: 0x0a}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x43, offset 0x172 + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x44, offset 0x176 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x45, offset 0x178 + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x46, offset 0x17a + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x47, offset 0x17c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x48, offset 0x17e + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x180 + {value: 0x0000, lo: 0x05}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xaf}, + // Block 0x4a, offset 0x186 + {value: 0x0000, lo: 0x03}, + {value: 0x4be0, lo: 0xb3, hi: 0xb3}, + {value: 0x4be0, lo: 0xb5, hi: 0xb6}, + {value: 0x4be0, lo: 0xba, hi: 0xbf}, + // Block 0x4b, offset 0x18a + {value: 0x0000, lo: 0x01}, + {value: 0x4be0, lo: 0x8f, hi: 0xa3}, + // Block 0x4c, offset 0x18c + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xae, hi: 0xbe}, + // Block 0x4d, offset 0x18e + {value: 0x0000, lo: 0x07}, + {value: 0x8100, lo: 0x84, hi: 0x84}, + {value: 0x8100, lo: 0x87, hi: 0x87}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + {value: 0x8100, lo: 0x9e, hi: 0x9e}, + {value: 0x8100, lo: 0xa1, hi: 0xa1}, + {value: 0x8100, lo: 0xb2, hi: 0xb2}, + {value: 0x8100, lo: 0xbb, hi: 0xbb}, + // Block 0x4e, offset 0x196 + {value: 0x0000, lo: 0x03}, + {value: 0x8100, lo: 0x80, hi: 0x80}, + {value: 0x8100, lo: 0x8b, hi: 0x8b}, + {value: 0x8100, lo: 0x8e, hi: 0x8e}, + // Block 0x4f, offset 0x19a + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x50, offset 0x19d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x51, offset 0x19f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x52, offset 0x1a1 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x53, offset 0x1a4 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x54, offset 0x1a7 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x55, offset 0x1a9 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x56, offset 0x1ab + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x57, offset 0x1ad + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x58, offset 0x1af + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x59, offset 0x1b5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x5a, offset 0x1b8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x5b, offset 0x1ba + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x5c, offset 0x1c1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x5d, offset 0x1c7 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x5e, offset 0x1cd + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x5f, offset 0x1d5 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x60, offset 0x1db + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x61, offset 0x1e1 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x62, offset 0x1e7 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x63, offset 0x1eb + {value: 0x0006, lo: 0x0d}, + {value: 0x44d1, lo: 0x9d, hi: 0x9d}, + {value: 0x8116, lo: 0x9e, hi: 0x9e}, + {value: 0x4543, lo: 0x9f, hi: 0x9f}, + {value: 0x4531, lo: 0xaa, hi: 0xab}, + {value: 0x4635, lo: 0xac, hi: 0xac}, + {value: 0x463d, lo: 0xad, hi: 0xad}, + {value: 0x4489, lo: 0xae, hi: 0xb1}, + {value: 0x44a7, lo: 0xb2, hi: 0xb4}, + {value: 0x44bf, lo: 0xb5, hi: 0xb6}, + {value: 0x44cb, lo: 0xb8, hi: 0xb8}, + {value: 0x44d7, lo: 0xb9, hi: 0xbb}, + {value: 0x44ef, lo: 0xbc, hi: 0xbc}, + {value: 0x44f5, lo: 0xbe, hi: 0xbe}, + // Block 0x64, offset 0x1f9 + {value: 0x0006, lo: 0x08}, + {value: 0x44fb, lo: 0x80, hi: 0x81}, + {value: 0x4507, lo: 0x83, hi: 0x84}, + {value: 0x4519, lo: 0x86, hi: 0x89}, + {value: 0x453d, lo: 0x8a, hi: 0x8a}, + {value: 0x44b9, lo: 0x8b, hi: 0x8b}, + {value: 0x44a1, lo: 0x8c, hi: 0x8c}, + {value: 0x44e9, lo: 0x8d, hi: 0x8d}, + {value: 0x4513, lo: 0x8e, hi: 0x8e}, + // Block 0x65, offset 0x202 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0xa4, hi: 0xa5}, + {value: 0x8100, lo: 0xb0, hi: 0xb1}, + // Block 0x66, offset 0x205 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x9b, hi: 0x9d}, + {value: 0x8200, lo: 0x9e, hi: 0xa3}, + // Block 0x67, offset 0x208 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + // Block 0x68, offset 0x20a + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x99, hi: 0x99}, + {value: 0x8200, lo: 0xb2, hi: 0xb4}, + // Block 0x69, offset 0x20d + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xbc, hi: 0xbd}, + // Block 0x6a, offset 0x20f + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0xa0, hi: 0xa6}, + {value: 0x812e, lo: 0xa7, hi: 0xad}, + {value: 0x8133, lo: 0xae, hi: 0xaf}, + // Block 0x6b, offset 0x213 + {value: 0x0000, lo: 0x04}, + {value: 0x8100, lo: 0x89, hi: 0x8c}, + {value: 0x8100, lo: 0xb0, hi: 0xb2}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb6, hi: 0xbf}, + // Block 0x6c, offset 0x218 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x81, hi: 0x8c}, + // Block 0x6d, offset 0x21a + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xb5, hi: 0xba}, + // Block 0x6e, offset 0x21c + {value: 0x0000, lo: 0x04}, + {value: 0x4be0, lo: 0x9e, hi: 0x9f}, + {value: 0x4be0, lo: 0xa3, hi: 0xa3}, + {value: 0x4be0, lo: 0xa5, hi: 0xa6}, + {value: 0x4be0, lo: 0xaa, hi: 0xaf}, + // Block 0x6f, offset 0x221 + {value: 0x0000, lo: 0x05}, + {value: 0x4be0, lo: 0x82, hi: 0x87}, + {value: 0x4be0, lo: 0x8a, hi: 0x8f}, + {value: 0x4be0, lo: 0x92, hi: 0x97}, + {value: 0x4be0, lo: 0x9a, hi: 0x9c}, + {value: 0x8100, lo: 0xa3, hi: 0xa3}, + // Block 0x70, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x71, offset 0x229 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x72, offset 0x22b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x73, offset 0x22d + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x74, offset 0x233 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x75, offset 0x236 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x76, offset 0x238 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x77, offset 0x23a + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x78, offset 0x23c + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x79, offset 0x242 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x7a, offset 0x246 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x24a + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x7c, offset 0x252 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x7d, offset 0x259 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7e, offset 0x25c + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7f, offset 0x25f + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x80, offset 0x261 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x81, offset 0x264 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x82, offset 0x26c + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x83, offset 0x270 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x84, offset 0x277 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x85, offset 0x27a + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x86, offset 0x280 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x87, offset 0x282 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x88, offset 0x285 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x89, offset 0x287 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x8a, offset 0x28a + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x8b, offset 0x28f + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x8c, offset 0x291 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8d, offset 0x293 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8e, offset 0x295 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8f, offset 0x297 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x90, offset 0x299 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x91, offset 0x29c + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x92, offset 0x29e + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x93, offset 0x2a0 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x94, offset 0x2a2 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x95, offset 0x2a4 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x96, offset 0x2a6 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x97, offset 0x2a8 + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x98, offset 0x2b5 + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x2bf + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x9a, offset 0x2c1 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x9b, offset 0x2c3 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0x80, hi: 0x86}, + {value: 0x8133, lo: 0x88, hi: 0x98}, + {value: 0x8133, lo: 0x9b, hi: 0xa1}, + {value: 0x8133, lo: 0xa3, hi: 0xa4}, + {value: 0x8133, lo: 0xa6, hi: 0xaa}, + // Block 0x9c, offset 0x2c9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0x9d, offset 0x2cb + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0x9e, offset 0x2cd + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0x9f, offset 0x2cf + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xa0, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xa1, offset 0x2d5 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xa2, offset 0x2d8 + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x93, hi: 0x93}, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfkcTrie. Total size: 19260 bytes (18.81 KiB). Checksum: 1a0bbc4c8c24da49. +type nfkcTrie struct{} + +func newNfkcTrie(i int) *nfkcTrie { + return &nfkcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 95: + return uint16(nfkcValues[n<<6+uint32(b)]) + default: + n -= 95 + return uint16(nfkcSparse.lookup(n, b)) + } +} + +// nfkcValues: 97 blocks, 6208 entries, 12416 bytes +// The third block is the zero block. +var nfkcValues = [6208]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd, + 0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c, + 0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245, + 0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e, + 0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376, + 0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6, + 0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434, + 0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891, + 0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0, + 0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614, + 0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa, + // Block 0x4, offset 0x100 + 0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9, + 0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407, + 0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416, + 0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443, + 0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a, + 0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493, + 0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf, + 0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7, + 0x130: 0x31cd, 0x132: 0x1a8a, 0x133: 0x1b17, 0x134: 0x31f5, 0x135: 0x3501, + 0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d, + 0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, 0x13f: 0x1cdc, + // Block 0x5, offset 0x140 + 0x140: 0x1d64, 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259, + 0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, 0x149: 0x1d8c, + 0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d, + 0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4, + 0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce, + 0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb, + 0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7, + 0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623, + 0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669, + 0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8, + 0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0x00a7, + // Block 0x6, offset 0x180 + 0x184: 0x2f2f, 0x185: 0x2f35, + 0x186: 0x2f3b, 0x187: 0x1a9f, 0x188: 0x1aa2, 0x189: 0x1b38, 0x18a: 0x1ab7, 0x18b: 0x1aba, + 0x18c: 0x1b6e, 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281, + 0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09, + 0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91, + 0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706, + 0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510, + 0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e, + 0x1b0: 0x3506, 0x1b1: 0x1a6f, 0x1b2: 0x1a72, 0x1b3: 0x1aff, 0x1b4: 0x3169, 0x1b5: 0x3475, + 0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87, + 0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457, + 0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed, + 0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba, + 0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637, + 0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6, + 0x1de: 0x319b, 0x1df: 0x34a7, + 0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c, + 0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa, + 0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0, + // Block 0x8, offset 0x200 + 0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133, + 0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933, + 0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933, + 0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e, + 0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e, + 0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e, + 0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e, + 0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e, + 0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e, + 0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133, + // Block 0x9, offset 0x240 + 0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937, + 0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133, + 0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133, + 0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133, + 0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136, + 0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133, + 0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133, + 0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133, + 0x274: 0x01ee, + 0x27a: 0x43e6, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x439b, 0x285: 0x45bc, + 0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766, + 0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea, + 0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c1: 0xa000, 0x2c5: 0xa000, + 0x2c9: 0xa000, 0x2ca: 0x4981, 0x2cb: 0x499f, + 0x2cc: 0x3808, 0x2cd: 0x3820, 0x2ce: 0x49b7, 0x2d0: 0x0242, 0x2d1: 0x0254, + 0x2d2: 0x0230, 0x2d3: 0x444d, 0x2d4: 0x4453, 0x2d5: 0x027e, 0x2d6: 0x026c, + 0x2f0: 0x025a, 0x2f1: 0x026f, 0x2f2: 0x0272, 0x2f4: 0x020c, 0x2f5: 0x024b, + 0x2f9: 0x022a, + // Block 0xc, offset 0x300 + 0x300: 0x3862, 0x301: 0x386e, 0x303: 0x385c, + 0x306: 0xa000, 0x307: 0x384a, + 0x30c: 0x389e, 0x30d: 0x3886, 0x30e: 0x38b0, 0x310: 0xa000, + 0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000, + 0x318: 0xa000, 0x319: 0x3892, 0x31a: 0xa000, + 0x31e: 0xa000, 0x323: 0xa000, + 0x327: 0xa000, + 0x32b: 0xa000, 0x32d: 0xa000, + 0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000, + 0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x3916, 0x33a: 0xa000, + 0x33e: 0xa000, + // Block 0xd, offset 0x340 + 0x341: 0x3874, 0x342: 0x38f8, + 0x350: 0x3850, 0x351: 0x38d4, + 0x352: 0x3856, 0x353: 0x38da, 0x356: 0x3868, 0x357: 0x38ec, + 0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x396a, 0x35b: 0x3970, 0x35c: 0x387a, 0x35d: 0x38fe, + 0x35e: 0x3880, 0x35f: 0x3904, 0x362: 0x388c, 0x363: 0x3910, + 0x364: 0x3898, 0x365: 0x391c, 0x366: 0x38a4, 0x367: 0x3928, 0x368: 0xa000, 0x369: 0xa000, + 0x36a: 0x3976, 0x36b: 0x397c, 0x36c: 0x38ce, 0x36d: 0x3952, 0x36e: 0x38aa, 0x36f: 0x392e, + 0x370: 0x38b6, 0x371: 0x393a, 0x372: 0x38bc, 0x373: 0x3940, 0x374: 0x38c2, 0x375: 0x3946, + 0x378: 0x38c8, 0x379: 0x394c, + // Block 0xe, offset 0x380 + 0x387: 0x1e91, + 0x391: 0x812e, + 0x392: 0x8133, 0x393: 0x8133, 0x394: 0x8133, 0x395: 0x8133, 0x396: 0x812e, 0x397: 0x8133, + 0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x812f, 0x39b: 0x812e, 0x39c: 0x8133, 0x39d: 0x8133, + 0x39e: 0x8133, 0x39f: 0x8133, 0x3a0: 0x8133, 0x3a1: 0x8133, 0x3a2: 0x812e, 0x3a3: 0x812e, + 0x3a4: 0x812e, 0x3a5: 0x812e, 0x3a6: 0x812e, 0x3a7: 0x812e, 0x3a8: 0x8133, 0x3a9: 0x8133, + 0x3aa: 0x812e, 0x3ab: 0x8133, 0x3ac: 0x8133, 0x3ad: 0x812f, 0x3ae: 0x8132, 0x3af: 0x8133, + 0x3b0: 0x8106, 0x3b1: 0x8107, 0x3b2: 0x8108, 0x3b3: 0x8109, 0x3b4: 0x810a, 0x3b5: 0x810b, + 0x3b6: 0x810c, 0x3b7: 0x810d, 0x3b8: 0x810e, 0x3b9: 0x810f, 0x3ba: 0x810f, 0x3bb: 0x8110, + 0x3bc: 0x8111, 0x3bd: 0x8112, 0x3bf: 0x8113, + // Block 0xf, offset 0x3c0 + 0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8117, + 0x3cc: 0x8118, 0x3cd: 0x8119, 0x3ce: 0x811a, 0x3cf: 0x811b, 0x3d0: 0x811c, 0x3d1: 0x811d, + 0x3d2: 0x811e, 0x3d3: 0x9933, 0x3d4: 0x9933, 0x3d5: 0x992e, 0x3d6: 0x812e, 0x3d7: 0x8133, + 0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x812e, 0x3dd: 0x8133, + 0x3de: 0x8133, 0x3df: 0x812e, + 0x3f0: 0x811f, 0x3f5: 0x1eb4, + 0x3f6: 0x2143, 0x3f7: 0x217f, 0x3f8: 0x217a, + // Block 0x10, offset 0x400 + 0x40a: 0x8133, 0x40b: 0x8133, + 0x40c: 0x8133, 0x40d: 0x8133, 0x40e: 0x8133, 0x40f: 0x812e, 0x410: 0x812e, 0x411: 0x812e, + 0x412: 0x812e, 0x413: 0x812e, 0x414: 0x8133, 0x415: 0x8133, 0x416: 0x8133, 0x417: 0x8133, + 0x418: 0x8133, 0x419: 0x8133, 0x41a: 0x8133, 0x41b: 0x8133, 0x41c: 0x8133, 0x41d: 0x8133, + 0x41e: 0x8133, 0x41f: 0x8133, 0x420: 0x8133, 0x421: 0x8133, 0x423: 0x812e, + 0x424: 0x8133, 0x425: 0x8133, 0x426: 0x812e, 0x427: 0x8133, 0x428: 0x8133, 0x429: 0x812e, + 0x42a: 0x8133, 0x42b: 0x8133, 0x42c: 0x8133, 0x42d: 0x812e, 0x42e: 0x812e, 0x42f: 0x812e, + 0x430: 0x8117, 0x431: 0x8118, 0x432: 0x8119, 0x433: 0x8133, 0x434: 0x8133, 0x435: 0x8133, + 0x436: 0x812e, 0x437: 0x8133, 0x438: 0x8133, 0x439: 0x812e, 0x43a: 0x812e, 0x43b: 0x8133, + 0x43c: 0x8133, 0x43d: 0x8133, 0x43e: 0x8133, 0x43f: 0x8133, + // Block 0x11, offset 0x440 + 0x445: 0xa000, + 0x446: 0x2e5d, 0x447: 0xa000, 0x448: 0x2e65, 0x449: 0xa000, 0x44a: 0x2e6d, 0x44b: 0xa000, + 0x44c: 0x2e75, 0x44d: 0xa000, 0x44e: 0x2e7d, 0x451: 0xa000, + 0x452: 0x2e85, + 0x474: 0x8103, 0x475: 0x9900, + 0x47a: 0xa000, 0x47b: 0x2e8d, + 0x47c: 0xa000, 0x47d: 0x2e95, 0x47e: 0xa000, 0x47f: 0xa000, + // Block 0x12, offset 0x480 + 0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x0104, 0x485: 0x0107, + 0x486: 0x0506, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x011f, 0x48b: 0x0122, + 0x48c: 0x0125, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e6, + 0x492: 0x009f, 0x493: 0x0110, 0x494: 0x050a, 0x495: 0x050e, 0x496: 0x00a1, 0x497: 0x00a9, + 0x498: 0x00ab, 0x499: 0x0516, 0x49a: 0x015b, 0x49b: 0x00ad, 0x49c: 0x051a, 0x49d: 0x0242, + 0x49e: 0x0245, 0x49f: 0x0248, 0x4a0: 0x027e, 0x4a1: 0x0281, 0x4a2: 0x0093, 0x4a3: 0x00a5, + 0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x0242, 0x4a7: 0x0245, 0x4a8: 0x026f, 0x4a9: 0x027e, + 0x4aa: 0x0281, + 0x4b8: 0x02b4, + // Block 0x13, offset 0x4c0 + 0x4db: 0x010a, 0x4dc: 0x0087, 0x4dd: 0x0113, + 0x4de: 0x00d7, 0x4df: 0x0125, 0x4e0: 0x008d, 0x4e1: 0x012b, 0x4e2: 0x0131, 0x4e3: 0x013d, + 0x4e4: 0x0146, 0x4e5: 0x0149, 0x4e6: 0x014c, 0x4e7: 0x051e, 0x4e8: 0x01c7, 0x4e9: 0x0155, + 0x4ea: 0x0522, 0x4eb: 0x01ca, 0x4ec: 0x0161, 0x4ed: 0x015e, 0x4ee: 0x0164, 0x4ef: 0x0167, + 0x4f0: 0x016a, 0x4f1: 0x016d, 0x4f2: 0x0176, 0x4f3: 0x018e, 0x4f4: 0x0191, 0x4f5: 0x00f2, + 0x4f6: 0x019a, 0x4f7: 0x019d, 0x4f8: 0x0512, 0x4f9: 0x01a0, 0x4fa: 0x01a3, 0x4fb: 0x00b5, + 0x4fc: 0x01af, 0x4fd: 0x01b2, 0x4fe: 0x01b5, 0x4ff: 0x0254, + // Block 0x14, offset 0x500 + 0x500: 0x8133, 0x501: 0x8133, 0x502: 0x812e, 0x503: 0x8133, 0x504: 0x8133, 0x505: 0x8133, + 0x506: 0x8133, 0x507: 0x8133, 0x508: 0x8133, 0x509: 0x8133, 0x50a: 0x812e, 0x50b: 0x8133, + 0x50c: 0x8133, 0x50d: 0x8136, 0x50e: 0x812b, 0x50f: 0x812e, 0x510: 0x812a, 0x511: 0x8133, + 0x512: 0x8133, 0x513: 0x8133, 0x514: 0x8133, 0x515: 0x8133, 0x516: 0x8133, 0x517: 0x8133, + 0x518: 0x8133, 0x519: 0x8133, 0x51a: 0x8133, 0x51b: 0x8133, 0x51c: 0x8133, 0x51d: 0x8133, + 0x51e: 0x8133, 0x51f: 0x8133, 0x520: 0x8133, 0x521: 0x8133, 0x522: 0x8133, 0x523: 0x8133, + 0x524: 0x8133, 0x525: 0x8133, 0x526: 0x8133, 0x527: 0x8133, 0x528: 0x8133, 0x529: 0x8133, + 0x52a: 0x8133, 0x52b: 0x8133, 0x52c: 0x8133, 0x52d: 0x8133, 0x52e: 0x8133, 0x52f: 0x8133, + 0x530: 0x8133, 0x531: 0x8133, 0x532: 0x8133, 0x533: 0x8133, 0x534: 0x8133, 0x535: 0x8133, + 0x536: 0x8134, 0x537: 0x8132, 0x538: 0x8132, 0x539: 0x812e, 0x53a: 0x812d, 0x53b: 0x8133, + 0x53c: 0x8135, 0x53d: 0x812e, 0x53e: 0x8133, 0x53f: 0x812e, + // Block 0x15, offset 0x540 + 0x540: 0x30d8, 0x541: 0x33e4, 0x542: 0x30e2, 0x543: 0x33ee, 0x544: 0x30e7, 0x545: 0x33f3, + 0x546: 0x30ec, 0x547: 0x33f8, 0x548: 0x3a0d, 0x549: 0x3b9c, 0x54a: 0x3105, 0x54b: 0x3411, + 0x54c: 0x310f, 0x54d: 0x341b, 0x54e: 0x311e, 0x54f: 0x342a, 0x550: 0x3114, 0x551: 0x3420, + 0x552: 0x3119, 0x553: 0x3425, 0x554: 0x3a30, 0x555: 0x3bbf, 0x556: 0x3a37, 0x557: 0x3bc6, + 0x558: 0x315a, 0x559: 0x3466, 0x55a: 0x315f, 0x55b: 0x346b, 0x55c: 0x3a45, 0x55d: 0x3bd4, + 0x55e: 0x3164, 0x55f: 0x3470, 0x560: 0x3173, 0x561: 0x347f, 0x562: 0x3191, 0x563: 0x349d, + 0x564: 0x31a0, 0x565: 0x34ac, 0x566: 0x3196, 0x567: 0x34a2, 0x568: 0x31a5, 0x569: 0x34b1, + 0x56a: 0x31aa, 0x56b: 0x34b6, 0x56c: 0x31f0, 0x56d: 0x34fc, 0x56e: 0x3a4c, 0x56f: 0x3bdb, + 0x570: 0x31fa, 0x571: 0x350b, 0x572: 0x3204, 0x573: 0x3515, 0x574: 0x320e, 0x575: 0x351f, + 0x576: 0x4805, 0x577: 0x4896, 0x578: 0x3a53, 0x579: 0x3be2, 0x57a: 0x3227, 0x57b: 0x3538, + 0x57c: 0x3222, 0x57d: 0x3533, 0x57e: 0x322c, 0x57f: 0x353d, + // Block 0x16, offset 0x580 + 0x580: 0x3231, 0x581: 0x3542, 0x582: 0x3236, 0x583: 0x3547, 0x584: 0x324a, 0x585: 0x355b, + 0x586: 0x3254, 0x587: 0x3565, 0x588: 0x3263, 0x589: 0x3574, 0x58a: 0x325e, 0x58b: 0x356f, + 0x58c: 0x3a76, 0x58d: 0x3c05, 0x58e: 0x3a84, 0x58f: 0x3c13, 0x590: 0x3a8b, 0x591: 0x3c1a, + 0x592: 0x3a92, 0x593: 0x3c21, 0x594: 0x3290, 0x595: 0x35a1, 0x596: 0x3295, 0x597: 0x35a6, + 0x598: 0x329f, 0x599: 0x35b0, 0x59a: 0x4832, 0x59b: 0x48c3, 0x59c: 0x3ad8, 0x59d: 0x3c67, + 0x59e: 0x32b8, 0x59f: 0x35c9, 0x5a0: 0x32c2, 0x5a1: 0x35d3, 0x5a2: 0x4841, 0x5a3: 0x48d2, + 0x5a4: 0x3adf, 0x5a5: 0x3c6e, 0x5a6: 0x3ae6, 0x5a7: 0x3c75, 0x5a8: 0x3aed, 0x5a9: 0x3c7c, + 0x5aa: 0x32d1, 0x5ab: 0x35e2, 0x5ac: 0x32db, 0x5ad: 0x35f1, 0x5ae: 0x32ef, 0x5af: 0x3605, + 0x5b0: 0x32ea, 0x5b1: 0x3600, 0x5b2: 0x332b, 0x5b3: 0x3641, 0x5b4: 0x333a, 0x5b5: 0x3650, + 0x5b6: 0x3335, 0x5b7: 0x364b, 0x5b8: 0x3af4, 0x5b9: 0x3c83, 0x5ba: 0x3afb, 0x5bb: 0x3c8a, + 0x5bc: 0x333f, 0x5bd: 0x3655, 0x5be: 0x3344, 0x5bf: 0x365a, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x3349, 0x5c1: 0x365f, 0x5c2: 0x334e, 0x5c3: 0x3664, 0x5c4: 0x335d, 0x5c5: 0x3673, + 0x5c6: 0x3358, 0x5c7: 0x366e, 0x5c8: 0x3362, 0x5c9: 0x367d, 0x5ca: 0x3367, 0x5cb: 0x3682, + 0x5cc: 0x336c, 0x5cd: 0x3687, 0x5ce: 0x338a, 0x5cf: 0x36a5, 0x5d0: 0x33a3, 0x5d1: 0x36c3, + 0x5d2: 0x33b2, 0x5d3: 0x36d2, 0x5d4: 0x33b7, 0x5d5: 0x36d7, 0x5d6: 0x34bb, 0x5d7: 0x35e7, + 0x5d8: 0x3678, 0x5d9: 0x36b4, 0x5da: 0x1d10, 0x5db: 0x4418, + 0x5e0: 0x47e2, 0x5e1: 0x4873, 0x5e2: 0x30c4, 0x5e3: 0x33d0, + 0x5e4: 0x39b9, 0x5e5: 0x3b48, 0x5e6: 0x39b2, 0x5e7: 0x3b41, 0x5e8: 0x39c7, 0x5e9: 0x3b56, + 0x5ea: 0x39c0, 0x5eb: 0x3b4f, 0x5ec: 0x39ff, 0x5ed: 0x3b8e, 0x5ee: 0x39d5, 0x5ef: 0x3b64, + 0x5f0: 0x39ce, 0x5f1: 0x3b5d, 0x5f2: 0x39e3, 0x5f3: 0x3b72, 0x5f4: 0x39dc, 0x5f5: 0x3b6b, + 0x5f6: 0x3a06, 0x5f7: 0x3b95, 0x5f8: 0x47f6, 0x5f9: 0x4887, 0x5fa: 0x3141, 0x5fb: 0x344d, + 0x5fc: 0x312d, 0x5fd: 0x3439, 0x5fe: 0x3a1b, 0x5ff: 0x3baa, + // Block 0x18, offset 0x600 + 0x600: 0x3a14, 0x601: 0x3ba3, 0x602: 0x3a29, 0x603: 0x3bb8, 0x604: 0x3a22, 0x605: 0x3bb1, + 0x606: 0x3a3e, 0x607: 0x3bcd, 0x608: 0x31d2, 0x609: 0x34de, 0x60a: 0x31e6, 0x60b: 0x34f2, + 0x60c: 0x4828, 0x60d: 0x48b9, 0x60e: 0x3277, 0x60f: 0x3588, 0x610: 0x3a61, 0x611: 0x3bf0, + 0x612: 0x3a5a, 0x613: 0x3be9, 0x614: 0x3a6f, 0x615: 0x3bfe, 0x616: 0x3a68, 0x617: 0x3bf7, + 0x618: 0x3aca, 0x619: 0x3c59, 0x61a: 0x3aae, 0x61b: 0x3c3d, 0x61c: 0x3aa7, 0x61d: 0x3c36, + 0x61e: 0x3abc, 0x61f: 0x3c4b, 0x620: 0x3ab5, 0x621: 0x3c44, 0x622: 0x3ac3, 0x623: 0x3c52, + 0x624: 0x3326, 0x625: 0x363c, 0x626: 0x3308, 0x627: 0x361e, 0x628: 0x3b25, 0x629: 0x3cb4, + 0x62a: 0x3b1e, 0x62b: 0x3cad, 0x62c: 0x3b33, 0x62d: 0x3cc2, 0x62e: 0x3b2c, 0x62f: 0x3cbb, + 0x630: 0x3b3a, 0x631: 0x3cc9, 0x632: 0x3371, 0x633: 0x368c, 0x634: 0x3399, 0x635: 0x36b9, + 0x636: 0x3394, 0x637: 0x36af, 0x638: 0x3380, 0x639: 0x369b, + // Block 0x19, offset 0x640 + 0x640: 0x4945, 0x641: 0x494b, 0x642: 0x4a5f, 0x643: 0x4a77, 0x644: 0x4a67, 0x645: 0x4a7f, + 0x646: 0x4a6f, 0x647: 0x4a87, 0x648: 0x48eb, 0x649: 0x48f1, 0x64a: 0x49cf, 0x64b: 0x49e7, + 0x64c: 0x49d7, 0x64d: 0x49ef, 0x64e: 0x49df, 0x64f: 0x49f7, 0x650: 0x4957, 0x651: 0x495d, + 0x652: 0x3ef9, 0x653: 0x3f09, 0x654: 0x3f01, 0x655: 0x3f11, + 0x658: 0x48f7, 0x659: 0x48fd, 0x65a: 0x3e29, 0x65b: 0x3e39, 0x65c: 0x3e31, 0x65d: 0x3e41, + 0x660: 0x496f, 0x661: 0x4975, 0x662: 0x4a8f, 0x663: 0x4aa7, + 0x664: 0x4a97, 0x665: 0x4aaf, 0x666: 0x4a9f, 0x667: 0x4ab7, 0x668: 0x4903, 0x669: 0x4909, + 0x66a: 0x49ff, 0x66b: 0x4a17, 0x66c: 0x4a07, 0x66d: 0x4a1f, 0x66e: 0x4a0f, 0x66f: 0x4a27, + 0x670: 0x4987, 0x671: 0x498d, 0x672: 0x3f59, 0x673: 0x3f71, 0x674: 0x3f61, 0x675: 0x3f79, + 0x676: 0x3f69, 0x677: 0x3f81, 0x678: 0x490f, 0x679: 0x4915, 0x67a: 0x3e59, 0x67b: 0x3e71, + 0x67c: 0x3e61, 0x67d: 0x3e79, 0x67e: 0x3e69, 0x67f: 0x3e81, + // Block 0x1a, offset 0x680 + 0x680: 0x4993, 0x681: 0x4999, 0x682: 0x3f89, 0x683: 0x3f99, 0x684: 0x3f91, 0x685: 0x3fa1, + 0x688: 0x491b, 0x689: 0x4921, 0x68a: 0x3e89, 0x68b: 0x3e99, + 0x68c: 0x3e91, 0x68d: 0x3ea1, 0x690: 0x49a5, 0x691: 0x49ab, + 0x692: 0x3fc1, 0x693: 0x3fd9, 0x694: 0x3fc9, 0x695: 0x3fe1, 0x696: 0x3fd1, 0x697: 0x3fe9, + 0x699: 0x4927, 0x69b: 0x3ea9, 0x69d: 0x3eb1, + 0x69f: 0x3eb9, 0x6a0: 0x49bd, 0x6a1: 0x49c3, 0x6a2: 0x4abf, 0x6a3: 0x4ad7, + 0x6a4: 0x4ac7, 0x6a5: 0x4adf, 0x6a6: 0x4acf, 0x6a7: 0x4ae7, 0x6a8: 0x492d, 0x6a9: 0x4933, + 0x6aa: 0x4a2f, 0x6ab: 0x4a47, 0x6ac: 0x4a37, 0x6ad: 0x4a4f, 0x6ae: 0x4a3f, 0x6af: 0x4a57, + 0x6b0: 0x4939, 0x6b1: 0x445f, 0x6b2: 0x37d2, 0x6b3: 0x4465, 0x6b4: 0x4963, 0x6b5: 0x446b, + 0x6b6: 0x37e4, 0x6b7: 0x4471, 0x6b8: 0x3802, 0x6b9: 0x4477, 0x6ba: 0x381a, 0x6bb: 0x447d, + 0x6bc: 0x49b1, 0x6bd: 0x4483, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3ee1, 0x6c1: 0x3ee9, 0x6c2: 0x42c5, 0x6c3: 0x42e3, 0x6c4: 0x42cf, 0x6c5: 0x42ed, + 0x6c6: 0x42d9, 0x6c7: 0x42f7, 0x6c8: 0x3e19, 0x6c9: 0x3e21, 0x6ca: 0x4211, 0x6cb: 0x422f, + 0x6cc: 0x421b, 0x6cd: 0x4239, 0x6ce: 0x4225, 0x6cf: 0x4243, 0x6d0: 0x3f29, 0x6d1: 0x3f31, + 0x6d2: 0x4301, 0x6d3: 0x431f, 0x6d4: 0x430b, 0x6d5: 0x4329, 0x6d6: 0x4315, 0x6d7: 0x4333, + 0x6d8: 0x3e49, 0x6d9: 0x3e51, 0x6da: 0x424d, 0x6db: 0x426b, 0x6dc: 0x4257, 0x6dd: 0x4275, + 0x6de: 0x4261, 0x6df: 0x427f, 0x6e0: 0x4001, 0x6e1: 0x4009, 0x6e2: 0x433d, 0x6e3: 0x435b, + 0x6e4: 0x4347, 0x6e5: 0x4365, 0x6e6: 0x4351, 0x6e7: 0x436f, 0x6e8: 0x3ec1, 0x6e9: 0x3ec9, + 0x6ea: 0x4289, 0x6eb: 0x42a7, 0x6ec: 0x4293, 0x6ed: 0x42b1, 0x6ee: 0x429d, 0x6ef: 0x42bb, + 0x6f0: 0x37c6, 0x6f1: 0x37c0, 0x6f2: 0x3ed1, 0x6f3: 0x37cc, 0x6f4: 0x3ed9, + 0x6f6: 0x4951, 0x6f7: 0x3ef1, 0x6f8: 0x3736, 0x6f9: 0x3730, 0x6fa: 0x3724, 0x6fb: 0x442f, + 0x6fc: 0x373c, 0x6fd: 0x43c8, 0x6fe: 0x0257, 0x6ff: 0x43c8, + // Block 0x1c, offset 0x700 + 0x700: 0x43e1, 0x701: 0x45c3, 0x702: 0x3f19, 0x703: 0x37de, 0x704: 0x3f21, + 0x706: 0x497b, 0x707: 0x3f39, 0x708: 0x3742, 0x709: 0x4435, 0x70a: 0x374e, 0x70b: 0x443b, + 0x70c: 0x375a, 0x70d: 0x45ca, 0x70e: 0x45d1, 0x70f: 0x45d8, 0x710: 0x37f6, 0x711: 0x37f0, + 0x712: 0x3f41, 0x713: 0x4625, 0x716: 0x37fc, 0x717: 0x3f51, + 0x718: 0x3772, 0x719: 0x376c, 0x71a: 0x3760, 0x71b: 0x4441, 0x71d: 0x45df, + 0x71e: 0x45e6, 0x71f: 0x45ed, 0x720: 0x382c, 0x721: 0x3826, 0x722: 0x3fa9, 0x723: 0x462d, + 0x724: 0x380e, 0x725: 0x3814, 0x726: 0x3832, 0x727: 0x3fb9, 0x728: 0x37a2, 0x729: 0x379c, + 0x72a: 0x3790, 0x72b: 0x444d, 0x72c: 0x378a, 0x72d: 0x45b5, 0x72e: 0x45bc, 0x72f: 0x0081, + 0x732: 0x3ff1, 0x733: 0x3838, 0x734: 0x3ff9, + 0x736: 0x49c9, 0x737: 0x4011, 0x738: 0x377e, 0x739: 0x4447, 0x73a: 0x37ae, 0x73b: 0x4459, + 0x73c: 0x37ba, 0x73d: 0x439b, 0x73e: 0x43cd, + // Block 0x1d, offset 0x740 + 0x740: 0x1d08, 0x741: 0x1d0c, 0x742: 0x0047, 0x743: 0x1d84, 0x745: 0x1d18, + 0x746: 0x1d1c, 0x747: 0x00ef, 0x749: 0x1d88, 0x74a: 0x008f, 0x74b: 0x0051, + 0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00e0, 0x750: 0x0053, 0x751: 0x0053, + 0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x1abd, + 0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065, + 0x760: 0x1acf, 0x761: 0x1cf8, 0x762: 0x1ad8, + 0x764: 0x0075, 0x766: 0x023c, 0x768: 0x0075, + 0x76a: 0x0057, 0x76b: 0x4413, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b, + 0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0308, + 0x776: 0x030b, 0x777: 0x030e, 0x778: 0x0311, 0x779: 0x0093, 0x77b: 0x1cc8, + 0x77c: 0x026c, 0x77d: 0x0245, 0x77e: 0x01fd, 0x77f: 0x0224, + // Block 0x1e, offset 0x780 + 0x780: 0x055a, 0x785: 0x0049, + 0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095, + 0x790: 0x235e, 0x791: 0x236a, + 0x792: 0x241e, 0x793: 0x2346, 0x794: 0x23ca, 0x795: 0x2352, 0x796: 0x23d0, 0x797: 0x23e8, + 0x798: 0x23f4, 0x799: 0x2358, 0x79a: 0x23fa, 0x79b: 0x2364, 0x79c: 0x23ee, 0x79d: 0x2400, + 0x79e: 0x2406, 0x79f: 0x1dec, 0x7a0: 0x0053, 0x7a1: 0x1a87, 0x7a2: 0x1cd4, 0x7a3: 0x1a90, + 0x7a4: 0x006d, 0x7a5: 0x1adb, 0x7a6: 0x1d00, 0x7a7: 0x1e78, 0x7a8: 0x1a93, 0x7a9: 0x0071, + 0x7aa: 0x1ae7, 0x7ab: 0x1d04, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b, + 0x7b0: 0x0093, 0x7b1: 0x1b14, 0x7b2: 0x1d48, 0x7b3: 0x1b1d, 0x7b4: 0x00ad, 0x7b5: 0x1b92, + 0x7b6: 0x1d7c, 0x7b7: 0x1e8c, 0x7b8: 0x1b20, 0x7b9: 0x00b1, 0x7ba: 0x1b95, 0x7bb: 0x1d80, + 0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x3d47, 0x7c3: 0xa000, 0x7c4: 0x3d4e, 0x7c5: 0xa000, + 0x7c7: 0x3d55, 0x7c8: 0xa000, 0x7c9: 0x3d5c, + 0x7cd: 0xa000, + 0x7e0: 0x30a6, 0x7e1: 0xa000, 0x7e2: 0x3d6a, + 0x7e4: 0xa000, 0x7e5: 0xa000, + 0x7ed: 0x3d63, 0x7ee: 0x30a1, 0x7ef: 0x30ab, + 0x7f0: 0x3d71, 0x7f1: 0x3d78, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3d7f, 0x7f5: 0x3d86, + 0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3d8d, 0x7f9: 0x3d94, 0x7fa: 0xa000, 0x7fb: 0xa000, + 0x7fc: 0xa000, 0x7fd: 0xa000, + // Block 0x20, offset 0x800 + 0x800: 0x3d9b, 0x801: 0x3da2, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3db7, 0x805: 0x3dbe, + 0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3dc5, 0x809: 0x3dcc, + 0x811: 0xa000, + 0x812: 0xa000, + 0x822: 0xa000, + 0x828: 0xa000, 0x829: 0xa000, + 0x82b: 0xa000, 0x82c: 0x3de1, 0x82d: 0x3de8, 0x82e: 0x3def, 0x82f: 0x3df6, + 0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000, + // Block 0x21, offset 0x840 + 0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029, + 0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x19af, + 0x86a: 0x19b2, 0x86b: 0x19b5, 0x86c: 0x19b8, 0x86d: 0x19bb, 0x86e: 0x19be, 0x86f: 0x19c1, + 0x870: 0x19c4, 0x871: 0x19c7, 0x872: 0x19ca, 0x873: 0x19d3, 0x874: 0x1b98, 0x875: 0x1b9c, + 0x876: 0x1ba0, 0x877: 0x1ba4, 0x878: 0x1ba8, 0x879: 0x1bac, 0x87a: 0x1bb0, 0x87b: 0x1bb4, + 0x87c: 0x1bb8, 0x87d: 0x1db0, 0x87e: 0x1db5, 0x87f: 0x1dba, + // Block 0x22, offset 0x880 + 0x880: 0x1dbf, 0x881: 0x1dc4, 0x882: 0x1dc9, 0x883: 0x1dce, 0x884: 0x1dd3, 0x885: 0x1dd8, + 0x886: 0x1ddd, 0x887: 0x1de2, 0x888: 0x19ac, 0x889: 0x19d0, 0x88a: 0x19f4, 0x88b: 0x1a18, + 0x88c: 0x1a3c, 0x88d: 0x1a45, 0x88e: 0x1a4b, 0x88f: 0x1a51, 0x890: 0x1a57, 0x891: 0x1c90, + 0x892: 0x1c94, 0x893: 0x1c98, 0x894: 0x1c9c, 0x895: 0x1ca0, 0x896: 0x1ca4, 0x897: 0x1ca8, + 0x898: 0x1cac, 0x899: 0x1cb0, 0x89a: 0x1cb4, 0x89b: 0x1cb8, 0x89c: 0x1c24, 0x89d: 0x1c28, + 0x89e: 0x1c2c, 0x89f: 0x1c30, 0x8a0: 0x1c34, 0x8a1: 0x1c38, 0x8a2: 0x1c3c, 0x8a3: 0x1c40, + 0x8a4: 0x1c44, 0x8a5: 0x1c48, 0x8a6: 0x1c4c, 0x8a7: 0x1c50, 0x8a8: 0x1c54, 0x8a9: 0x1c58, + 0x8aa: 0x1c5c, 0x8ab: 0x1c60, 0x8ac: 0x1c64, 0x8ad: 0x1c68, 0x8ae: 0x1c6c, 0x8af: 0x1c70, + 0x8b0: 0x1c74, 0x8b1: 0x1c78, 0x8b2: 0x1c7c, 0x8b3: 0x1c80, 0x8b4: 0x1c84, 0x8b5: 0x1c88, + 0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d, + 0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x07ba, 0x8c1: 0x07de, 0x8c2: 0x07ea, 0x8c3: 0x07fa, 0x8c4: 0x0802, 0x8c5: 0x080e, + 0x8c6: 0x0816, 0x8c7: 0x081e, 0x8c8: 0x082a, 0x8c9: 0x087e, 0x8ca: 0x0896, 0x8cb: 0x08a6, + 0x8cc: 0x08b6, 0x8cd: 0x08c6, 0x8ce: 0x08d6, 0x8cf: 0x08f6, 0x8d0: 0x08fa, 0x8d1: 0x08fe, + 0x8d2: 0x0932, 0x8d3: 0x095a, 0x8d4: 0x096a, 0x8d5: 0x0972, 0x8d6: 0x0976, 0x8d7: 0x0982, + 0x8d8: 0x099e, 0x8d9: 0x09a2, 0x8da: 0x09ba, 0x8db: 0x09be, 0x8dc: 0x09c6, 0x8dd: 0x09d6, + 0x8de: 0x0a72, 0x8df: 0x0a86, 0x8e0: 0x0ac6, 0x8e1: 0x0ada, 0x8e2: 0x0ae2, 0x8e3: 0x0ae6, + 0x8e4: 0x0af6, 0x8e5: 0x0b12, 0x8e6: 0x0b3e, 0x8e7: 0x0b4a, 0x8e8: 0x0b6a, 0x8e9: 0x0b76, + 0x8ea: 0x0b7a, 0x8eb: 0x0b7e, 0x8ec: 0x0b96, 0x8ed: 0x0b9a, 0x8ee: 0x0bc6, 0x8ef: 0x0bd2, + 0x8f0: 0x0bda, 0x8f1: 0x0be2, 0x8f2: 0x0bf2, 0x8f3: 0x0bfa, 0x8f4: 0x0c02, 0x8f5: 0x0c2e, + 0x8f6: 0x0c32, 0x8f7: 0x0c3a, 0x8f8: 0x0c3e, 0x8f9: 0x0c46, 0x8fa: 0x0c4e, 0x8fb: 0x0c5e, + 0x8fc: 0x0c7a, 0x8fd: 0x0cf2, 0x8fe: 0x0d06, 0x8ff: 0x0d0a, + // Block 0x24, offset 0x900 + 0x900: 0x0d8a, 0x901: 0x0d8e, 0x902: 0x0da2, 0x903: 0x0da6, 0x904: 0x0dae, 0x905: 0x0db6, + 0x906: 0x0dbe, 0x907: 0x0dca, 0x908: 0x0df2, 0x909: 0x0e02, 0x90a: 0x0e16, 0x90b: 0x0e86, + 0x90c: 0x0e92, 0x90d: 0x0ea2, 0x90e: 0x0eae, 0x90f: 0x0eba, 0x910: 0x0ec2, 0x911: 0x0ec6, + 0x912: 0x0eca, 0x913: 0x0ece, 0x914: 0x0ed2, 0x915: 0x0f8a, 0x916: 0x0fd2, 0x917: 0x0fde, + 0x918: 0x0fe2, 0x919: 0x0fe6, 0x91a: 0x0fea, 0x91b: 0x0ff2, 0x91c: 0x0ff6, 0x91d: 0x100a, + 0x91e: 0x1026, 0x91f: 0x102e, 0x920: 0x106e, 0x921: 0x1072, 0x922: 0x107a, 0x923: 0x107e, + 0x924: 0x1086, 0x925: 0x108a, 0x926: 0x10ae, 0x927: 0x10b2, 0x928: 0x10ce, 0x929: 0x10d2, + 0x92a: 0x10d6, 0x92b: 0x10da, 0x92c: 0x10ee, 0x92d: 0x1112, 0x92e: 0x1116, 0x92f: 0x111a, + 0x930: 0x113e, 0x931: 0x117e, 0x932: 0x1182, 0x933: 0x11a2, 0x934: 0x11b2, 0x935: 0x11ba, + 0x936: 0x11da, 0x937: 0x11fe, 0x938: 0x1242, 0x939: 0x124a, 0x93a: 0x125e, 0x93b: 0x126a, + 0x93c: 0x1272, 0x93d: 0x127a, 0x93e: 0x127e, 0x93f: 0x1282, + // Block 0x25, offset 0x940 + 0x940: 0x129a, 0x941: 0x129e, 0x942: 0x12ba, 0x943: 0x12c2, 0x944: 0x12ca, 0x945: 0x12ce, + 0x946: 0x12da, 0x947: 0x12e2, 0x948: 0x12e6, 0x949: 0x12ea, 0x94a: 0x12f2, 0x94b: 0x12f6, + 0x94c: 0x1396, 0x94d: 0x13aa, 0x94e: 0x13de, 0x94f: 0x13e2, 0x950: 0x13ea, 0x951: 0x1416, + 0x952: 0x141e, 0x953: 0x1426, 0x954: 0x142e, 0x955: 0x146a, 0x956: 0x146e, 0x957: 0x1476, + 0x958: 0x147a, 0x959: 0x147e, 0x95a: 0x14aa, 0x95b: 0x14ae, 0x95c: 0x14b6, 0x95d: 0x14ca, + 0x95e: 0x14ce, 0x95f: 0x14ea, 0x960: 0x14f2, 0x961: 0x14f6, 0x962: 0x151a, 0x963: 0x153a, + 0x964: 0x154e, 0x965: 0x1552, 0x966: 0x155a, 0x967: 0x1586, 0x968: 0x158a, 0x969: 0x159a, + 0x96a: 0x15be, 0x96b: 0x15ca, 0x96c: 0x15da, 0x96d: 0x15f2, 0x96e: 0x15fa, 0x96f: 0x15fe, + 0x970: 0x1602, 0x971: 0x1606, 0x972: 0x1612, 0x973: 0x1616, 0x974: 0x161e, 0x975: 0x163a, + 0x976: 0x163e, 0x977: 0x1642, 0x978: 0x165a, 0x979: 0x165e, 0x97a: 0x1666, 0x97b: 0x167a, + 0x97c: 0x167e, 0x97d: 0x1682, 0x97e: 0x168a, 0x97f: 0x168e, + // Block 0x26, offset 0x980 + 0x986: 0xa000, 0x98b: 0xa000, + 0x98c: 0x4049, 0x98d: 0xa000, 0x98e: 0x4051, 0x98f: 0xa000, 0x990: 0x4059, 0x991: 0xa000, + 0x992: 0x4061, 0x993: 0xa000, 0x994: 0x4069, 0x995: 0xa000, 0x996: 0x4071, 0x997: 0xa000, + 0x998: 0x4079, 0x999: 0xa000, 0x99a: 0x4081, 0x99b: 0xa000, 0x99c: 0x4089, 0x99d: 0xa000, + 0x99e: 0x4091, 0x99f: 0xa000, 0x9a0: 0x4099, 0x9a1: 0xa000, 0x9a2: 0x40a1, + 0x9a4: 0xa000, 0x9a5: 0x40a9, 0x9a6: 0xa000, 0x9a7: 0x40b1, 0x9a8: 0xa000, 0x9a9: 0x40b9, + 0x9af: 0xa000, + 0x9b0: 0x40c1, 0x9b1: 0x40c9, 0x9b2: 0xa000, 0x9b3: 0x40d1, 0x9b4: 0x40d9, 0x9b5: 0xa000, + 0x9b6: 0x40e1, 0x9b7: 0x40e9, 0x9b8: 0xa000, 0x9b9: 0x40f1, 0x9ba: 0x40f9, 0x9bb: 0xa000, + 0x9bc: 0x4101, 0x9bd: 0x4109, + // Block 0x27, offset 0x9c0 + 0x9d4: 0x4041, + 0x9d9: 0x9904, 0x9da: 0x9904, 0x9db: 0x441d, 0x9dc: 0x4423, 0x9dd: 0xa000, + 0x9de: 0x4111, 0x9df: 0x27e4, + 0x9e6: 0xa000, + 0x9eb: 0xa000, 0x9ec: 0x4121, 0x9ed: 0xa000, 0x9ee: 0x4129, 0x9ef: 0xa000, + 0x9f0: 0x4131, 0x9f1: 0xa000, 0x9f2: 0x4139, 0x9f3: 0xa000, 0x9f4: 0x4141, 0x9f5: 0xa000, + 0x9f6: 0x4149, 0x9f7: 0xa000, 0x9f8: 0x4151, 0x9f9: 0xa000, 0x9fa: 0x4159, 0x9fb: 0xa000, + 0x9fc: 0x4161, 0x9fd: 0xa000, 0x9fe: 0x4169, 0x9ff: 0xa000, + // Block 0x28, offset 0xa00 + 0xa00: 0x4171, 0xa01: 0xa000, 0xa02: 0x4179, 0xa04: 0xa000, 0xa05: 0x4181, + 0xa06: 0xa000, 0xa07: 0x4189, 0xa08: 0xa000, 0xa09: 0x4191, + 0xa0f: 0xa000, 0xa10: 0x4199, 0xa11: 0x41a1, + 0xa12: 0xa000, 0xa13: 0x41a9, 0xa14: 0x41b1, 0xa15: 0xa000, 0xa16: 0x41b9, 0xa17: 0x41c1, + 0xa18: 0xa000, 0xa19: 0x41c9, 0xa1a: 0x41d1, 0xa1b: 0xa000, 0xa1c: 0x41d9, 0xa1d: 0x41e1, + 0xa2f: 0xa000, + 0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x4119, + 0xa37: 0x41e9, 0xa38: 0x41f1, 0xa39: 0x41f9, 0xa3a: 0x4201, + 0xa3d: 0xa000, 0xa3e: 0x4209, 0xa3f: 0x27f9, + // Block 0x29, offset 0xa40 + 0xa40: 0x045a, 0xa41: 0x041e, 0xa42: 0x0422, 0xa43: 0x0426, 0xa44: 0x046e, 0xa45: 0x042a, + 0xa46: 0x042e, 0xa47: 0x0432, 0xa48: 0x0436, 0xa49: 0x043a, 0xa4a: 0x043e, 0xa4b: 0x0442, + 0xa4c: 0x0446, 0xa4d: 0x044a, 0xa4e: 0x044e, 0xa4f: 0x4afe, 0xa50: 0x4b04, 0xa51: 0x4b0a, + 0xa52: 0x4b10, 0xa53: 0x4b16, 0xa54: 0x4b1c, 0xa55: 0x4b22, 0xa56: 0x4b28, 0xa57: 0x4b2e, + 0xa58: 0x4b34, 0xa59: 0x4b3a, 0xa5a: 0x4b40, 0xa5b: 0x4b46, 0xa5c: 0x4b4c, 0xa5d: 0x4b52, + 0xa5e: 0x4b58, 0xa5f: 0x4b5e, 0xa60: 0x4b64, 0xa61: 0x4b6a, 0xa62: 0x4b70, 0xa63: 0x4b76, + 0xa64: 0x04b6, 0xa65: 0x0452, 0xa66: 0x0456, 0xa67: 0x04da, 0xa68: 0x04de, 0xa69: 0x04e2, + 0xa6a: 0x04e6, 0xa6b: 0x04ea, 0xa6c: 0x04ee, 0xa6d: 0x04f2, 0xa6e: 0x045e, 0xa6f: 0x04f6, + 0xa70: 0x04fa, 0xa71: 0x0462, 0xa72: 0x0466, 0xa73: 0x046a, 0xa74: 0x0472, 0xa75: 0x0476, + 0xa76: 0x047a, 0xa77: 0x047e, 0xa78: 0x0482, 0xa79: 0x0486, 0xa7a: 0x048a, 0xa7b: 0x048e, + 0xa7c: 0x0492, 0xa7d: 0x0496, 0xa7e: 0x049a, 0xa7f: 0x049e, + // Block 0x2a, offset 0xa80 + 0xa80: 0x04a2, 0xa81: 0x04a6, 0xa82: 0x04fe, 0xa83: 0x0502, 0xa84: 0x04aa, 0xa85: 0x04ae, + 0xa86: 0x04b2, 0xa87: 0x04ba, 0xa88: 0x04be, 0xa89: 0x04c2, 0xa8a: 0x04c6, 0xa8b: 0x04ca, + 0xa8c: 0x04ce, 0xa8d: 0x04d2, 0xa8e: 0x04d6, + 0xa92: 0x07ba, 0xa93: 0x0816, 0xa94: 0x07c6, 0xa95: 0x0a76, 0xa96: 0x07ca, 0xa97: 0x07e2, + 0xa98: 0x07ce, 0xa99: 0x108e, 0xa9a: 0x0802, 0xa9b: 0x07d6, 0xa9c: 0x07be, 0xa9d: 0x0afa, + 0xa9e: 0x0a8a, 0xa9f: 0x082a, + // Block 0x2b, offset 0xac0 + 0xac0: 0x2184, 0xac1: 0x218a, 0xac2: 0x2190, 0xac3: 0x2196, 0xac4: 0x219c, 0xac5: 0x21a2, + 0xac6: 0x21a8, 0xac7: 0x21ae, 0xac8: 0x21b4, 0xac9: 0x21ba, 0xaca: 0x21c0, 0xacb: 0x21c6, + 0xacc: 0x21cc, 0xacd: 0x21d2, 0xace: 0x285d, 0xacf: 0x2866, 0xad0: 0x286f, 0xad1: 0x2878, + 0xad2: 0x2881, 0xad3: 0x288a, 0xad4: 0x2893, 0xad5: 0x289c, 0xad6: 0x28a5, 0xad7: 0x28b7, + 0xad8: 0x28c0, 0xad9: 0x28c9, 0xada: 0x28d2, 0xadb: 0x28db, 0xadc: 0x28ae, 0xadd: 0x2ce3, + 0xade: 0x2c24, 0xae0: 0x21d8, 0xae1: 0x21f0, 0xae2: 0x21e4, 0xae3: 0x2238, + 0xae4: 0x21f6, 0xae5: 0x2214, 0xae6: 0x21de, 0xae7: 0x220e, 0xae8: 0x21ea, 0xae9: 0x2220, + 0xaea: 0x2250, 0xaeb: 0x226e, 0xaec: 0x2268, 0xaed: 0x225c, 0xaee: 0x22aa, 0xaef: 0x223e, + 0xaf0: 0x224a, 0xaf1: 0x2262, 0xaf2: 0x2256, 0xaf3: 0x2280, 0xaf4: 0x222c, 0xaf5: 0x2274, + 0xaf6: 0x229e, 0xaf7: 0x2286, 0xaf8: 0x221a, 0xaf9: 0x21fc, 0xafa: 0x2232, 0xafb: 0x2244, + 0xafc: 0x227a, 0xafd: 0x2202, 0xafe: 0x22a4, 0xaff: 0x2226, + // Block 0x2c, offset 0xb00 + 0xb00: 0x228c, 0xb01: 0x2208, 0xb02: 0x2292, 0xb03: 0x2298, 0xb04: 0x0a2a, 0xb05: 0x0bfe, + 0xb06: 0x0da2, 0xb07: 0x11c2, + 0xb10: 0x1cf4, 0xb11: 0x19d6, + 0xb12: 0x19d9, 0xb13: 0x19dc, 0xb14: 0x19df, 0xb15: 0x19e2, 0xb16: 0x19e5, 0xb17: 0x19e8, + 0xb18: 0x19eb, 0xb19: 0x19ee, 0xb1a: 0x19f7, 0xb1b: 0x19fa, 0xb1c: 0x19fd, 0xb1d: 0x1a00, + 0xb1e: 0x1a03, 0xb1f: 0x1a06, 0xb20: 0x0406, 0xb21: 0x040e, 0xb22: 0x0412, 0xb23: 0x041a, + 0xb24: 0x041e, 0xb25: 0x0422, 0xb26: 0x042a, 0xb27: 0x0432, 0xb28: 0x0436, 0xb29: 0x043e, + 0xb2a: 0x0442, 0xb2b: 0x0446, 0xb2c: 0x044a, 0xb2d: 0x044e, 0xb2e: 0x2f59, 0xb2f: 0x2f61, + 0xb30: 0x2f69, 0xb31: 0x2f71, 0xb32: 0x2f79, 0xb33: 0x2f81, 0xb34: 0x2f89, 0xb35: 0x2f91, + 0xb36: 0x2fa1, 0xb37: 0x2fa9, 0xb38: 0x2fb1, 0xb39: 0x2fb9, 0xb3a: 0x2fc1, 0xb3b: 0x2fc9, + 0xb3c: 0x3014, 0xb3d: 0x2fdc, 0xb3e: 0x2f99, + // Block 0x2d, offset 0xb40 + 0xb40: 0x07ba, 0xb41: 0x0816, 0xb42: 0x07c6, 0xb43: 0x0a76, 0xb44: 0x081a, 0xb45: 0x08aa, + 0xb46: 0x07c2, 0xb47: 0x08a6, 0xb48: 0x0806, 0xb49: 0x0982, 0xb4a: 0x0e02, 0xb4b: 0x0f8a, + 0xb4c: 0x0ed2, 0xb4d: 0x0e16, 0xb4e: 0x155a, 0xb4f: 0x0a86, 0xb50: 0x0dca, 0xb51: 0x0e46, + 0xb52: 0x0e06, 0xb53: 0x1146, 0xb54: 0x09f6, 0xb55: 0x0ffe, 0xb56: 0x1482, 0xb57: 0x115a, + 0xb58: 0x093e, 0xb59: 0x118a, 0xb5a: 0x1096, 0xb5b: 0x0b12, 0xb5c: 0x150a, 0xb5d: 0x087a, + 0xb5e: 0x09a6, 0xb5f: 0x0ef2, 0xb60: 0x1622, 0xb61: 0x083e, 0xb62: 0x08ce, 0xb63: 0x0e96, + 0xb64: 0x07ca, 0xb65: 0x07e2, 0xb66: 0x07ce, 0xb67: 0x0bd6, 0xb68: 0x09ea, 0xb69: 0x097a, + 0xb6a: 0x0b52, 0xb6b: 0x0b46, 0xb6c: 0x10e6, 0xb6d: 0x083a, 0xb6e: 0x1496, 0xb6f: 0x0996, + 0xb70: 0x0aee, 0xb71: 0x1a09, 0xb72: 0x1a0c, 0xb73: 0x1a0f, 0xb74: 0x1a12, 0xb75: 0x1a1b, + 0xb76: 0x1a1e, 0xb77: 0x1a21, 0xb78: 0x1a24, 0xb79: 0x1a27, 0xb7a: 0x1a2a, 0xb7b: 0x1a2d, + 0xb7c: 0x1a30, 0xb7d: 0x1a33, 0xb7e: 0x1a36, 0xb7f: 0x1a3f, + // Block 0x2e, offset 0xb80 + 0xb80: 0x1df6, 0xb81: 0x1e05, 0xb82: 0x1e14, 0xb83: 0x1e23, 0xb84: 0x1e32, 0xb85: 0x1e41, + 0xb86: 0x1e50, 0xb87: 0x1e5f, 0xb88: 0x1e6e, 0xb89: 0x22bc, 0xb8a: 0x22ce, 0xb8b: 0x22e0, + 0xb8c: 0x1a81, 0xb8d: 0x1d34, 0xb8e: 0x1b02, 0xb8f: 0x1cd8, 0xb90: 0x05c6, 0xb91: 0x05ce, + 0xb92: 0x05d6, 0xb93: 0x05de, 0xb94: 0x05e6, 0xb95: 0x05ea, 0xb96: 0x05ee, 0xb97: 0x05f2, + 0xb98: 0x05f6, 0xb99: 0x05fa, 0xb9a: 0x05fe, 0xb9b: 0x0602, 0xb9c: 0x0606, 0xb9d: 0x060a, + 0xb9e: 0x060e, 0xb9f: 0x0612, 0xba0: 0x0616, 0xba1: 0x061e, 0xba2: 0x0622, 0xba3: 0x0626, + 0xba4: 0x062a, 0xba5: 0x062e, 0xba6: 0x0632, 0xba7: 0x0636, 0xba8: 0x063a, 0xba9: 0x063e, + 0xbaa: 0x0642, 0xbab: 0x0646, 0xbac: 0x064a, 0xbad: 0x064e, 0xbae: 0x0652, 0xbaf: 0x0656, + 0xbb0: 0x065a, 0xbb1: 0x065e, 0xbb2: 0x0662, 0xbb3: 0x066a, 0xbb4: 0x0672, 0xbb5: 0x067a, + 0xbb6: 0x067e, 0xbb7: 0x0682, 0xbb8: 0x0686, 0xbb9: 0x068a, 0xbba: 0x068e, 0xbbb: 0x0692, + 0xbbc: 0x0696, 0xbbd: 0x069a, 0xbbe: 0x069e, 0xbbf: 0x282a, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x2c43, 0xbc1: 0x2adf, 0xbc2: 0x2c53, 0xbc3: 0x29b7, 0xbc4: 0x3025, 0xbc5: 0x29c1, + 0xbc6: 0x29cb, 0xbc7: 0x3069, 0xbc8: 0x2aec, 0xbc9: 0x29d5, 0xbca: 0x29df, 0xbcb: 0x29e9, + 0xbcc: 0x2b13, 0xbcd: 0x2b20, 0xbce: 0x2af9, 0xbcf: 0x2b06, 0xbd0: 0x2fea, 0xbd1: 0x2b2d, + 0xbd2: 0x2b3a, 0xbd3: 0x2cf5, 0xbd4: 0x27eb, 0xbd5: 0x2d08, 0xbd6: 0x2d1b, 0xbd7: 0x2c63, + 0xbd8: 0x2b47, 0xbd9: 0x2d2e, 0xbda: 0x2d41, 0xbdb: 0x2b54, 0xbdc: 0x29f3, 0xbdd: 0x29fd, + 0xbde: 0x2ff8, 0xbdf: 0x2b61, 0xbe0: 0x2c73, 0xbe1: 0x3036, 0xbe2: 0x2a07, 0xbe3: 0x2a11, + 0xbe4: 0x2b6e, 0xbe5: 0x2a1b, 0xbe6: 0x2a25, 0xbe7: 0x2800, 0xbe8: 0x2807, 0xbe9: 0x2a2f, + 0xbea: 0x2a39, 0xbeb: 0x2d54, 0xbec: 0x2b7b, 0xbed: 0x2c83, 0xbee: 0x2d67, 0xbef: 0x2b88, + 0xbf0: 0x2a4d, 0xbf1: 0x2a43, 0xbf2: 0x307d, 0xbf3: 0x2b95, 0xbf4: 0x2d7a, 0xbf5: 0x2a57, + 0xbf6: 0x2c93, 0xbf7: 0x2a61, 0xbf8: 0x2baf, 0xbf9: 0x2a6b, 0xbfa: 0x2bbc, 0xbfb: 0x3047, + 0xbfc: 0x2ba2, 0xbfd: 0x2ca3, 0xbfe: 0x2bc9, 0xbff: 0x280e, + // Block 0x30, offset 0xc00 + 0xc00: 0x3058, 0xc01: 0x2a75, 0xc02: 0x2a7f, 0xc03: 0x2bd6, 0xc04: 0x2a89, 0xc05: 0x2a93, + 0xc06: 0x2a9d, 0xc07: 0x2cb3, 0xc08: 0x2be3, 0xc09: 0x2815, 0xc0a: 0x2d8d, 0xc0b: 0x2fd1, + 0xc0c: 0x2cc3, 0xc0d: 0x2bf0, 0xc0e: 0x3006, 0xc0f: 0x2aa7, 0xc10: 0x2ab1, 0xc11: 0x2bfd, + 0xc12: 0x281c, 0xc13: 0x2c0a, 0xc14: 0x2cd3, 0xc15: 0x2823, 0xc16: 0x2da0, 0xc17: 0x2abb, + 0xc18: 0x1de7, 0xc19: 0x1dfb, 0xc1a: 0x1e0a, 0xc1b: 0x1e19, 0xc1c: 0x1e28, 0xc1d: 0x1e37, + 0xc1e: 0x1e46, 0xc1f: 0x1e55, 0xc20: 0x1e64, 0xc21: 0x1e73, 0xc22: 0x22c2, 0xc23: 0x22d4, + 0xc24: 0x22e6, 0xc25: 0x22f2, 0xc26: 0x22fe, 0xc27: 0x230a, 0xc28: 0x2316, 0xc29: 0x2322, + 0xc2a: 0x232e, 0xc2b: 0x233a, 0xc2c: 0x2376, 0xc2d: 0x2382, 0xc2e: 0x238e, 0xc2f: 0x239a, + 0xc30: 0x23a6, 0xc31: 0x1d44, 0xc32: 0x1af6, 0xc33: 0x1a63, 0xc34: 0x1d14, 0xc35: 0x1b77, + 0xc36: 0x1b86, 0xc37: 0x1afc, 0xc38: 0x1d2c, 0xc39: 0x1d30, 0xc3a: 0x1a8d, 0xc3b: 0x2838, + 0xc3c: 0x2846, 0xc3d: 0x2831, 0xc3e: 0x283f, 0xc3f: 0x2c17, + // Block 0x31, offset 0xc40 + 0xc40: 0x1b7a, 0xc41: 0x1b62, 0xc42: 0x1d90, 0xc43: 0x1b4a, 0xc44: 0x1b23, 0xc45: 0x1a96, + 0xc46: 0x1aa5, 0xc47: 0x1a75, 0xc48: 0x1d20, 0xc49: 0x1e82, 0xc4a: 0x1b7d, 0xc4b: 0x1b65, + 0xc4c: 0x1d94, 0xc4d: 0x1da0, 0xc4e: 0x1b56, 0xc4f: 0x1b2c, 0xc50: 0x1a84, 0xc51: 0x1d4c, + 0xc52: 0x1ce0, 0xc53: 0x1ccc, 0xc54: 0x1cfc, 0xc55: 0x1da4, 0xc56: 0x1b59, 0xc57: 0x1af9, + 0xc58: 0x1b2f, 0xc59: 0x1b0e, 0xc5a: 0x1b71, 0xc5b: 0x1da8, 0xc5c: 0x1b5c, 0xc5d: 0x1af0, + 0xc5e: 0x1b32, 0xc5f: 0x1d6c, 0xc60: 0x1d24, 0xc61: 0x1b44, 0xc62: 0x1d54, 0xc63: 0x1d70, + 0xc64: 0x1d28, 0xc65: 0x1b47, 0xc66: 0x1d58, 0xc67: 0x2418, 0xc68: 0x242c, 0xc69: 0x1ac6, + 0xc6a: 0x1d50, 0xc6b: 0x1ce4, 0xc6c: 0x1cd0, 0xc6d: 0x1d78, 0xc6e: 0x284d, 0xc6f: 0x28e4, + 0xc70: 0x1b89, 0xc71: 0x1b74, 0xc72: 0x1dac, 0xc73: 0x1b5f, 0xc74: 0x1b80, 0xc75: 0x1b68, + 0xc76: 0x1d98, 0xc77: 0x1b4d, 0xc78: 0x1b26, 0xc79: 0x1ab1, 0xc7a: 0x1b83, 0xc7b: 0x1b6b, + 0xc7c: 0x1d9c, 0xc7d: 0x1b50, 0xc7e: 0x1b29, 0xc7f: 0x1ab4, + // Block 0x32, offset 0xc80 + 0xc80: 0x1d5c, 0xc81: 0x1ce8, 0xc82: 0x1e7d, 0xc83: 0x1a66, 0xc84: 0x1aea, 0xc85: 0x1aed, + 0xc86: 0x2425, 0xc87: 0x1cc4, 0xc88: 0x1af3, 0xc89: 0x1a78, 0xc8a: 0x1b11, 0xc8b: 0x1a7b, + 0xc8c: 0x1b1a, 0xc8d: 0x1a99, 0xc8e: 0x1a9c, 0xc8f: 0x1b35, 0xc90: 0x1b3b, 0xc91: 0x1b3e, + 0xc92: 0x1d60, 0xc93: 0x1b41, 0xc94: 0x1b53, 0xc95: 0x1d68, 0xc96: 0x1d74, 0xc97: 0x1ac0, + 0xc98: 0x1e87, 0xc99: 0x1cec, 0xc9a: 0x1ac3, 0xc9b: 0x1b8c, 0xc9c: 0x1ad5, 0xc9d: 0x1ae4, + 0xc9e: 0x2412, 0xc9f: 0x240c, 0xca0: 0x1df1, 0xca1: 0x1e00, 0xca2: 0x1e0f, 0xca3: 0x1e1e, + 0xca4: 0x1e2d, 0xca5: 0x1e3c, 0xca6: 0x1e4b, 0xca7: 0x1e5a, 0xca8: 0x1e69, 0xca9: 0x22b6, + 0xcaa: 0x22c8, 0xcab: 0x22da, 0xcac: 0x22ec, 0xcad: 0x22f8, 0xcae: 0x2304, 0xcaf: 0x2310, + 0xcb0: 0x231c, 0xcb1: 0x2328, 0xcb2: 0x2334, 0xcb3: 0x2370, 0xcb4: 0x237c, 0xcb5: 0x2388, + 0xcb6: 0x2394, 0xcb7: 0x23a0, 0xcb8: 0x23ac, 0xcb9: 0x23b2, 0xcba: 0x23b8, 0xcbb: 0x23be, + 0xcbc: 0x23c4, 0xcbd: 0x23d6, 0xcbe: 0x23dc, 0xcbf: 0x1d40, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x1472, 0xcc1: 0x0df6, 0xcc2: 0x14ce, 0xcc3: 0x149a, 0xcc4: 0x0f52, 0xcc5: 0x07e6, + 0xcc6: 0x09da, 0xcc7: 0x1726, 0xcc8: 0x1726, 0xcc9: 0x0b06, 0xcca: 0x155a, 0xccb: 0x0a3e, + 0xccc: 0x0b02, 0xccd: 0x0cea, 0xcce: 0x10ca, 0xccf: 0x125a, 0xcd0: 0x1392, 0xcd1: 0x13ce, + 0xcd2: 0x1402, 0xcd3: 0x1516, 0xcd4: 0x0e6e, 0xcd5: 0x0efa, 0xcd6: 0x0fa6, 0xcd7: 0x103e, + 0xcd8: 0x135a, 0xcd9: 0x1542, 0xcda: 0x166e, 0xcdb: 0x080a, 0xcdc: 0x09ae, 0xcdd: 0x0e82, + 0xcde: 0x0fca, 0xcdf: 0x138e, 0xce0: 0x16be, 0xce1: 0x0bae, 0xce2: 0x0f72, 0xce3: 0x137e, + 0xce4: 0x1412, 0xce5: 0x0d1e, 0xce6: 0x12b6, 0xce7: 0x13da, 0xce8: 0x0c1a, 0xce9: 0x0e0a, + 0xcea: 0x0f12, 0xceb: 0x1016, 0xcec: 0x1522, 0xced: 0x084a, 0xcee: 0x08e2, 0xcef: 0x094e, + 0xcf0: 0x0d86, 0xcf1: 0x0e7a, 0xcf2: 0x0fc6, 0xcf3: 0x10ea, 0xcf4: 0x1272, 0xcf5: 0x1386, + 0xcf6: 0x139e, 0xcf7: 0x14c2, 0xcf8: 0x15ea, 0xcf9: 0x169e, 0xcfa: 0x16ba, 0xcfb: 0x1126, + 0xcfc: 0x1166, 0xcfd: 0x121e, 0xcfe: 0x133e, 0xcff: 0x1576, + // Block 0x34, offset 0xd00 + 0xd00: 0x16c6, 0xd01: 0x1446, 0xd02: 0x0ac2, 0xd03: 0x0c36, 0xd04: 0x11d6, 0xd05: 0x1296, + 0xd06: 0x0ffa, 0xd07: 0x112e, 0xd08: 0x1492, 0xd09: 0x15e2, 0xd0a: 0x0abe, 0xd0b: 0x0b8a, + 0xd0c: 0x0e72, 0xd0d: 0x0f26, 0xd0e: 0x0f5a, 0xd0f: 0x120e, 0xd10: 0x1236, 0xd11: 0x15a2, + 0xd12: 0x094a, 0xd13: 0x12a2, 0xd14: 0x08ee, 0xd15: 0x08ea, 0xd16: 0x1192, 0xd17: 0x1222, + 0xd18: 0x1356, 0xd19: 0x15aa, 0xd1a: 0x1462, 0xd1b: 0x0d22, 0xd1c: 0x0e6e, 0xd1d: 0x1452, + 0xd1e: 0x07f2, 0xd1f: 0x0b5e, 0xd20: 0x0c8e, 0xd21: 0x102a, 0xd22: 0x10aa, 0xd23: 0x096e, + 0xd24: 0x1136, 0xd25: 0x085a, 0xd26: 0x0c72, 0xd27: 0x07d2, 0xd28: 0x0ee6, 0xd29: 0x0d9e, + 0xd2a: 0x120a, 0xd2b: 0x09c2, 0xd2c: 0x0aae, 0xd2d: 0x10f6, 0xd2e: 0x135e, 0xd2f: 0x1436, + 0xd30: 0x0eb2, 0xd31: 0x14f2, 0xd32: 0x0ede, 0xd33: 0x0d32, 0xd34: 0x1316, 0xd35: 0x0d52, + 0xd36: 0x10a6, 0xd37: 0x0826, 0xd38: 0x08a2, 0xd39: 0x08e6, 0xd3a: 0x0e4e, 0xd3b: 0x11f6, + 0xd3c: 0x12ee, 0xd3d: 0x1442, 0xd3e: 0x1556, 0xd3f: 0x0956, + // Block 0x35, offset 0xd40 + 0xd40: 0x0a0a, 0xd41: 0x0b12, 0xd42: 0x0c2a, 0xd43: 0x0dba, 0xd44: 0x0f76, 0xd45: 0x113a, + 0xd46: 0x1592, 0xd47: 0x1676, 0xd48: 0x16ca, 0xd49: 0x16e2, 0xd4a: 0x0932, 0xd4b: 0x0dee, + 0xd4c: 0x0e9e, 0xd4d: 0x14e6, 0xd4e: 0x0bf6, 0xd4f: 0x0cd2, 0xd50: 0x0cee, 0xd51: 0x0d7e, + 0xd52: 0x0f66, 0xd53: 0x0fb2, 0xd54: 0x1062, 0xd55: 0x1186, 0xd56: 0x122a, 0xd57: 0x128e, + 0xd58: 0x14d6, 0xd59: 0x1366, 0xd5a: 0x14fe, 0xd5b: 0x157a, 0xd5c: 0x090a, 0xd5d: 0x0936, + 0xd5e: 0x0a1e, 0xd5f: 0x0fa2, 0xd60: 0x13ee, 0xd61: 0x1436, 0xd62: 0x0c16, 0xd63: 0x0c86, + 0xd64: 0x0d4a, 0xd65: 0x0eaa, 0xd66: 0x11d2, 0xd67: 0x101e, 0xd68: 0x0836, 0xd69: 0x0a7a, + 0xd6a: 0x0b5e, 0xd6b: 0x0bc2, 0xd6c: 0x0c92, 0xd6d: 0x103a, 0xd6e: 0x1056, 0xd6f: 0x1266, + 0xd70: 0x1286, 0xd71: 0x155e, 0xd72: 0x15de, 0xd73: 0x15ee, 0xd74: 0x162a, 0xd75: 0x084e, + 0xd76: 0x117a, 0xd77: 0x154a, 0xd78: 0x15c6, 0xd79: 0x0caa, 0xd7a: 0x0812, 0xd7b: 0x0872, + 0xd7c: 0x0b62, 0xd7d: 0x0b82, 0xd7e: 0x0daa, 0xd7f: 0x0e6e, + // Block 0x36, offset 0xd80 + 0xd80: 0x0fbe, 0xd81: 0x10c6, 0xd82: 0x1372, 0xd83: 0x1512, 0xd84: 0x171e, 0xd85: 0x0dde, + 0xd86: 0x159e, 0xd87: 0x092e, 0xd88: 0x0e2a, 0xd89: 0x0e36, 0xd8a: 0x0f0a, 0xd8b: 0x0f42, + 0xd8c: 0x1046, 0xd8d: 0x10a2, 0xd8e: 0x1122, 0xd8f: 0x1206, 0xd90: 0x1636, 0xd91: 0x08aa, + 0xd92: 0x0cfe, 0xd93: 0x15ae, 0xd94: 0x0862, 0xd95: 0x0ba6, 0xd96: 0x0f2a, 0xd97: 0x14da, + 0xd98: 0x0c62, 0xd99: 0x0cb2, 0xd9a: 0x0e3e, 0xd9b: 0x102a, 0xd9c: 0x15b6, 0xd9d: 0x0912, + 0xd9e: 0x09fa, 0xd9f: 0x0b92, 0xda0: 0x0dce, 0xda1: 0x0e1a, 0xda2: 0x0e5a, 0xda3: 0x0eee, + 0xda4: 0x1042, 0xda5: 0x10b6, 0xda6: 0x1252, 0xda7: 0x13f2, 0xda8: 0x13fe, 0xda9: 0x1552, + 0xdaa: 0x15d2, 0xdab: 0x097e, 0xdac: 0x0f46, 0xdad: 0x09fe, 0xdae: 0x0fc2, 0xdaf: 0x1066, + 0xdb0: 0x1382, 0xdb1: 0x15ba, 0xdb2: 0x16a6, 0xdb3: 0x16ce, 0xdb4: 0x0e32, 0xdb5: 0x0f22, + 0xdb6: 0x12be, 0xdb7: 0x11b2, 0xdb8: 0x11be, 0xdb9: 0x11e2, 0xdba: 0x1012, 0xdbb: 0x0f9a, + 0xdbc: 0x145e, 0xdbd: 0x082e, 0xdbe: 0x1326, 0xdbf: 0x0916, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x0906, 0xdc1: 0x0c06, 0xdc2: 0x0d26, 0xdc3: 0x11ee, 0xdc4: 0x0b4e, 0xdc5: 0x0efe, + 0xdc6: 0x0dea, 0xdc7: 0x14e2, 0xdc8: 0x13e2, 0xdc9: 0x15a6, 0xdca: 0x141e, 0xdcb: 0x0c22, + 0xdcc: 0x0882, 0xdcd: 0x0a56, 0xdd0: 0x0aaa, + 0xdd2: 0x0dda, 0xdd5: 0x08f2, 0xdd6: 0x101a, 0xdd7: 0x10de, + 0xdd8: 0x1142, 0xdd9: 0x115e, 0xdda: 0x1162, 0xddb: 0x1176, 0xddc: 0x15f6, 0xddd: 0x11e6, + 0xdde: 0x126a, 0xde0: 0x138a, 0xde2: 0x144e, + 0xde5: 0x1502, 0xde6: 0x152e, + 0xdea: 0x164a, 0xdeb: 0x164e, 0xdec: 0x1652, 0xded: 0x16b6, 0xdee: 0x1526, 0xdef: 0x15c2, + 0xdf0: 0x0852, 0xdf1: 0x0876, 0xdf2: 0x088a, 0xdf3: 0x0946, 0xdf4: 0x0952, 0xdf5: 0x0992, + 0xdf6: 0x0a46, 0xdf7: 0x0a62, 0xdf8: 0x0a6a, 0xdf9: 0x0aa6, 0xdfa: 0x0ab2, 0xdfb: 0x0b8e, + 0xdfc: 0x0b96, 0xdfd: 0x0c9e, 0xdfe: 0x0cc6, 0xdff: 0x0cce, + // Block 0x38, offset 0xe00 + 0xe00: 0x0ce6, 0xe01: 0x0d92, 0xe02: 0x0dc2, 0xe03: 0x0de2, 0xe04: 0x0e52, 0xe05: 0x0f16, + 0xe06: 0x0f32, 0xe07: 0x0f62, 0xe08: 0x0fb6, 0xe09: 0x0fd6, 0xe0a: 0x104a, 0xe0b: 0x112a, + 0xe0c: 0x1146, 0xe0d: 0x114e, 0xe0e: 0x114a, 0xe0f: 0x1152, 0xe10: 0x1156, 0xe11: 0x115a, + 0xe12: 0x116e, 0xe13: 0x1172, 0xe14: 0x1196, 0xe15: 0x11aa, 0xe16: 0x11c6, 0xe17: 0x122a, + 0xe18: 0x1232, 0xe19: 0x123a, 0xe1a: 0x124e, 0xe1b: 0x1276, 0xe1c: 0x12c6, 0xe1d: 0x12fa, + 0xe1e: 0x12fa, 0xe1f: 0x1362, 0xe20: 0x140a, 0xe21: 0x1422, 0xe22: 0x1456, 0xe23: 0x145a, + 0xe24: 0x149e, 0xe25: 0x14a2, 0xe26: 0x14fa, 0xe27: 0x1502, 0xe28: 0x15d6, 0xe29: 0x161a, + 0xe2a: 0x1632, 0xe2b: 0x0c96, 0xe2c: 0x184b, 0xe2d: 0x12de, + 0xe30: 0x07da, 0xe31: 0x08de, 0xe32: 0x089e, 0xe33: 0x0846, 0xe34: 0x0886, 0xe35: 0x08b2, + 0xe36: 0x0942, 0xe37: 0x095e, 0xe38: 0x0a46, 0xe39: 0x0a32, 0xe3a: 0x0a42, 0xe3b: 0x0a5e, + 0xe3c: 0x0aaa, 0xe3d: 0x0aba, 0xe3e: 0x0afe, 0xe3f: 0x0b0a, + // Block 0x39, offset 0xe40 + 0xe40: 0x0b26, 0xe41: 0x0b36, 0xe42: 0x0c1e, 0xe43: 0x0c26, 0xe44: 0x0c56, 0xe45: 0x0c76, + 0xe46: 0x0ca6, 0xe47: 0x0cbe, 0xe48: 0x0cae, 0xe49: 0x0cce, 0xe4a: 0x0cc2, 0xe4b: 0x0ce6, + 0xe4c: 0x0d02, 0xe4d: 0x0d5a, 0xe4e: 0x0d66, 0xe4f: 0x0d6e, 0xe50: 0x0d96, 0xe51: 0x0dda, + 0xe52: 0x0e0a, 0xe53: 0x0e0e, 0xe54: 0x0e22, 0xe55: 0x0ea2, 0xe56: 0x0eb2, 0xe57: 0x0f0a, + 0xe58: 0x0f56, 0xe59: 0x0f4e, 0xe5a: 0x0f62, 0xe5b: 0x0f7e, 0xe5c: 0x0fb6, 0xe5d: 0x110e, + 0xe5e: 0x0fda, 0xe5f: 0x100e, 0xe60: 0x101a, 0xe61: 0x105a, 0xe62: 0x1076, 0xe63: 0x109a, + 0xe64: 0x10be, 0xe65: 0x10c2, 0xe66: 0x10de, 0xe67: 0x10e2, 0xe68: 0x10f2, 0xe69: 0x1106, + 0xe6a: 0x1102, 0xe6b: 0x1132, 0xe6c: 0x11ae, 0xe6d: 0x11c6, 0xe6e: 0x11de, 0xe6f: 0x1216, + 0xe70: 0x122a, 0xe71: 0x1246, 0xe72: 0x1276, 0xe73: 0x132a, 0xe74: 0x1352, 0xe75: 0x13c6, + 0xe76: 0x140e, 0xe77: 0x141a, 0xe78: 0x1422, 0xe79: 0x143a, 0xe7a: 0x144e, 0xe7b: 0x143e, + 0xe7c: 0x1456, 0xe7d: 0x1452, 0xe7e: 0x144a, 0xe7f: 0x145a, + // Block 0x3a, offset 0xe80 + 0xe80: 0x1466, 0xe81: 0x14a2, 0xe82: 0x14de, 0xe83: 0x150e, 0xe84: 0x1546, 0xe85: 0x1566, + 0xe86: 0x15b2, 0xe87: 0x15d6, 0xe88: 0x15f6, 0xe89: 0x160a, 0xe8a: 0x161a, 0xe8b: 0x1626, + 0xe8c: 0x1632, 0xe8d: 0x1686, 0xe8e: 0x1726, 0xe8f: 0x17e2, 0xe90: 0x17dd, 0xe91: 0x180f, + 0xe92: 0x0702, 0xe93: 0x072a, 0xe94: 0x072e, 0xe95: 0x1891, 0xe96: 0x18be, 0xe97: 0x1936, + 0xe98: 0x1712, 0xe99: 0x1722, + // Block 0x3b, offset 0xec0 + 0xec0: 0x1b05, 0xec1: 0x1b08, 0xec2: 0x1b0b, 0xec3: 0x1d38, 0xec4: 0x1d3c, 0xec5: 0x1b8f, + 0xec6: 0x1b8f, + 0xed3: 0x1ea5, 0xed4: 0x1e96, 0xed5: 0x1e9b, 0xed6: 0x1eaa, 0xed7: 0x1ea0, + 0xedd: 0x44d1, + 0xede: 0x8116, 0xedf: 0x4543, 0xee0: 0x0320, 0xee1: 0x0308, 0xee2: 0x0311, 0xee3: 0x0314, + 0xee4: 0x0317, 0xee5: 0x031a, 0xee6: 0x031d, 0xee7: 0x0323, 0xee8: 0x0326, 0xee9: 0x0017, + 0xeea: 0x4531, 0xeeb: 0x4537, 0xeec: 0x4635, 0xeed: 0x463d, 0xeee: 0x4489, 0xeef: 0x448f, + 0xef0: 0x4495, 0xef1: 0x449b, 0xef2: 0x44a7, 0xef3: 0x44ad, 0xef4: 0x44b3, 0xef5: 0x44bf, + 0xef6: 0x44c5, 0xef8: 0x44cb, 0xef9: 0x44d7, 0xefa: 0x44dd, 0xefb: 0x44e3, + 0xefc: 0x44ef, 0xefe: 0x44f5, + // Block 0x3c, offset 0xf00 + 0xf00: 0x44fb, 0xf01: 0x4501, 0xf03: 0x4507, 0xf04: 0x450d, + 0xf06: 0x4519, 0xf07: 0x451f, 0xf08: 0x4525, 0xf09: 0x452b, 0xf0a: 0x453d, 0xf0b: 0x44b9, + 0xf0c: 0x44a1, 0xf0d: 0x44e9, 0xf0e: 0x4513, 0xf0f: 0x1eaf, 0xf10: 0x038c, 0xf11: 0x038c, + 0xf12: 0x0395, 0xf13: 0x0395, 0xf14: 0x0395, 0xf15: 0x0395, 0xf16: 0x0398, 0xf17: 0x0398, + 0xf18: 0x0398, 0xf19: 0x0398, 0xf1a: 0x039e, 0xf1b: 0x039e, 0xf1c: 0x039e, 0xf1d: 0x039e, + 0xf1e: 0x0392, 0xf1f: 0x0392, 0xf20: 0x0392, 0xf21: 0x0392, 0xf22: 0x039b, 0xf23: 0x039b, + 0xf24: 0x039b, 0xf25: 0x039b, 0xf26: 0x038f, 0xf27: 0x038f, 0xf28: 0x038f, 0xf29: 0x038f, + 0xf2a: 0x03c2, 0xf2b: 0x03c2, 0xf2c: 0x03c2, 0xf2d: 0x03c2, 0xf2e: 0x03c5, 0xf2f: 0x03c5, + 0xf30: 0x03c5, 0xf31: 0x03c5, 0xf32: 0x03a4, 0xf33: 0x03a4, 0xf34: 0x03a4, 0xf35: 0x03a4, + 0xf36: 0x03a1, 0xf37: 0x03a1, 0xf38: 0x03a1, 0xf39: 0x03a1, 0xf3a: 0x03a7, 0xf3b: 0x03a7, + 0xf3c: 0x03a7, 0xf3d: 0x03a7, 0xf3e: 0x03aa, 0xf3f: 0x03aa, + // Block 0x3d, offset 0xf40 + 0xf40: 0x03aa, 0xf41: 0x03aa, 0xf42: 0x03b3, 0xf43: 0x03b3, 0xf44: 0x03b0, 0xf45: 0x03b0, + 0xf46: 0x03b6, 0xf47: 0x03b6, 0xf48: 0x03ad, 0xf49: 0x03ad, 0xf4a: 0x03bc, 0xf4b: 0x03bc, + 0xf4c: 0x03b9, 0xf4d: 0x03b9, 0xf4e: 0x03c8, 0xf4f: 0x03c8, 0xf50: 0x03c8, 0xf51: 0x03c8, + 0xf52: 0x03ce, 0xf53: 0x03ce, 0xf54: 0x03ce, 0xf55: 0x03ce, 0xf56: 0x03d4, 0xf57: 0x03d4, + 0xf58: 0x03d4, 0xf59: 0x03d4, 0xf5a: 0x03d1, 0xf5b: 0x03d1, 0xf5c: 0x03d1, 0xf5d: 0x03d1, + 0xf5e: 0x03d7, 0xf5f: 0x03d7, 0xf60: 0x03da, 0xf61: 0x03da, 0xf62: 0x03da, 0xf63: 0x03da, + 0xf64: 0x45af, 0xf65: 0x45af, 0xf66: 0x03e0, 0xf67: 0x03e0, 0xf68: 0x03e0, 0xf69: 0x03e0, + 0xf6a: 0x03dd, 0xf6b: 0x03dd, 0xf6c: 0x03dd, 0xf6d: 0x03dd, 0xf6e: 0x03fb, 0xf6f: 0x03fb, + 0xf70: 0x45a9, 0xf71: 0x45a9, + // Block 0x3e, offset 0xf80 + 0xf93: 0x03cb, 0xf94: 0x03cb, 0xf95: 0x03cb, 0xf96: 0x03cb, 0xf97: 0x03e9, + 0xf98: 0x03e9, 0xf99: 0x03e6, 0xf9a: 0x03e6, 0xf9b: 0x03ec, 0xf9c: 0x03ec, 0xf9d: 0x217f, + 0xf9e: 0x03f2, 0xf9f: 0x03f2, 0xfa0: 0x03e3, 0xfa1: 0x03e3, 0xfa2: 0x03ef, 0xfa3: 0x03ef, + 0xfa4: 0x03f8, 0xfa5: 0x03f8, 0xfa6: 0x03f8, 0xfa7: 0x03f8, 0xfa8: 0x0380, 0xfa9: 0x0380, + 0xfaa: 0x26da, 0xfab: 0x26da, 0xfac: 0x274a, 0xfad: 0x274a, 0xfae: 0x2719, 0xfaf: 0x2719, + 0xfb0: 0x2735, 0xfb1: 0x2735, 0xfb2: 0x272e, 0xfb3: 0x272e, 0xfb4: 0x273c, 0xfb5: 0x273c, + 0xfb6: 0x2743, 0xfb7: 0x2743, 0xfb8: 0x2743, 0xfb9: 0x2720, 0xfba: 0x2720, 0xfbb: 0x2720, + 0xfbc: 0x03f5, 0xfbd: 0x03f5, 0xfbe: 0x03f5, 0xfbf: 0x03f5, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x26e1, 0xfc1: 0x26e8, 0xfc2: 0x2704, 0xfc3: 0x2720, 0xfc4: 0x2727, 0xfc5: 0x1eb9, + 0xfc6: 0x1ebe, 0xfc7: 0x1ec3, 0xfc8: 0x1ed2, 0xfc9: 0x1ee1, 0xfca: 0x1ee6, 0xfcb: 0x1eeb, + 0xfcc: 0x1ef0, 0xfcd: 0x1ef5, 0xfce: 0x1f04, 0xfcf: 0x1f13, 0xfd0: 0x1f18, 0xfd1: 0x1f1d, + 0xfd2: 0x1f2c, 0xfd3: 0x1f3b, 0xfd4: 0x1f40, 0xfd5: 0x1f45, 0xfd6: 0x1f4a, 0xfd7: 0x1f59, + 0xfd8: 0x1f5e, 0xfd9: 0x1f6d, 0xfda: 0x1f72, 0xfdb: 0x1f77, 0xfdc: 0x1f86, 0xfdd: 0x1f8b, + 0xfde: 0x1f90, 0xfdf: 0x1f9a, 0xfe0: 0x1fd6, 0xfe1: 0x1fe5, 0xfe2: 0x1ff4, 0xfe3: 0x1ff9, + 0xfe4: 0x1ffe, 0xfe5: 0x2008, 0xfe6: 0x2017, 0xfe7: 0x201c, 0xfe8: 0x202b, 0xfe9: 0x2030, + 0xfea: 0x2035, 0xfeb: 0x2044, 0xfec: 0x2049, 0xfed: 0x2058, 0xfee: 0x205d, 0xfef: 0x2062, + 0xff0: 0x2067, 0xff1: 0x206c, 0xff2: 0x2071, 0xff3: 0x2076, 0xff4: 0x207b, 0xff5: 0x2080, + 0xff6: 0x2085, 0xff7: 0x208a, 0xff8: 0x208f, 0xff9: 0x2094, 0xffa: 0x2099, 0xffb: 0x209e, + 0xffc: 0x20a3, 0xffd: 0x20a8, 0xffe: 0x20ad, 0xfff: 0x20b7, + // Block 0x40, offset 0x1000 + 0x1000: 0x20bc, 0x1001: 0x20c1, 0x1002: 0x20c6, 0x1003: 0x20d0, 0x1004: 0x20d5, 0x1005: 0x20df, + 0x1006: 0x20e4, 0x1007: 0x20e9, 0x1008: 0x20ee, 0x1009: 0x20f3, 0x100a: 0x20f8, 0x100b: 0x20fd, + 0x100c: 0x2102, 0x100d: 0x2107, 0x100e: 0x2116, 0x100f: 0x2125, 0x1010: 0x212a, 0x1011: 0x212f, + 0x1012: 0x2134, 0x1013: 0x2139, 0x1014: 0x213e, 0x1015: 0x2148, 0x1016: 0x214d, 0x1017: 0x2152, + 0x1018: 0x2161, 0x1019: 0x2170, 0x101a: 0x2175, 0x101b: 0x4561, 0x101c: 0x4567, 0x101d: 0x459d, + 0x101e: 0x45f4, 0x101f: 0x45fb, 0x1020: 0x4602, 0x1021: 0x4609, 0x1022: 0x4610, 0x1023: 0x4617, + 0x1024: 0x26f6, 0x1025: 0x26fd, 0x1026: 0x2704, 0x1027: 0x270b, 0x1028: 0x2720, 0x1029: 0x2727, + 0x102a: 0x1ec8, 0x102b: 0x1ecd, 0x102c: 0x1ed2, 0x102d: 0x1ed7, 0x102e: 0x1ee1, 0x102f: 0x1ee6, + 0x1030: 0x1efa, 0x1031: 0x1eff, 0x1032: 0x1f04, 0x1033: 0x1f09, 0x1034: 0x1f13, 0x1035: 0x1f18, + 0x1036: 0x1f22, 0x1037: 0x1f27, 0x1038: 0x1f2c, 0x1039: 0x1f31, 0x103a: 0x1f3b, 0x103b: 0x1f40, + 0x103c: 0x206c, 0x103d: 0x2071, 0x103e: 0x2080, 0x103f: 0x2085, + // Block 0x41, offset 0x1040 + 0x1040: 0x208a, 0x1041: 0x209e, 0x1042: 0x20a3, 0x1043: 0x20a8, 0x1044: 0x20ad, 0x1045: 0x20c6, + 0x1046: 0x20d0, 0x1047: 0x20d5, 0x1048: 0x20da, 0x1049: 0x20ee, 0x104a: 0x210c, 0x104b: 0x2111, + 0x104c: 0x2116, 0x104d: 0x211b, 0x104e: 0x2125, 0x104f: 0x212a, 0x1050: 0x459d, 0x1051: 0x2157, + 0x1052: 0x215c, 0x1053: 0x2161, 0x1054: 0x2166, 0x1055: 0x2170, 0x1056: 0x2175, 0x1057: 0x26e1, + 0x1058: 0x26e8, 0x1059: 0x26ef, 0x105a: 0x2704, 0x105b: 0x2712, 0x105c: 0x1eb9, 0x105d: 0x1ebe, + 0x105e: 0x1ec3, 0x105f: 0x1ed2, 0x1060: 0x1edc, 0x1061: 0x1eeb, 0x1062: 0x1ef0, 0x1063: 0x1ef5, + 0x1064: 0x1f04, 0x1065: 0x1f0e, 0x1066: 0x1f2c, 0x1067: 0x1f45, 0x1068: 0x1f4a, 0x1069: 0x1f59, + 0x106a: 0x1f5e, 0x106b: 0x1f6d, 0x106c: 0x1f77, 0x106d: 0x1f86, 0x106e: 0x1f8b, 0x106f: 0x1f90, + 0x1070: 0x1f9a, 0x1071: 0x1fd6, 0x1072: 0x1fdb, 0x1073: 0x1fe5, 0x1074: 0x1ff4, 0x1075: 0x1ff9, + 0x1076: 0x1ffe, 0x1077: 0x2008, 0x1078: 0x2017, 0x1079: 0x202b, 0x107a: 0x2030, 0x107b: 0x2035, + 0x107c: 0x2044, 0x107d: 0x2049, 0x107e: 0x2058, 0x107f: 0x205d, + // Block 0x42, offset 0x1080 + 0x1080: 0x2062, 0x1081: 0x2067, 0x1082: 0x2076, 0x1083: 0x207b, 0x1084: 0x208f, 0x1085: 0x2094, + 0x1086: 0x2099, 0x1087: 0x209e, 0x1088: 0x20a3, 0x1089: 0x20b7, 0x108a: 0x20bc, 0x108b: 0x20c1, + 0x108c: 0x20c6, 0x108d: 0x20cb, 0x108e: 0x20df, 0x108f: 0x20e4, 0x1090: 0x20e9, 0x1091: 0x20ee, + 0x1092: 0x20fd, 0x1093: 0x2102, 0x1094: 0x2107, 0x1095: 0x2116, 0x1096: 0x2120, 0x1097: 0x212f, + 0x1098: 0x2134, 0x1099: 0x4591, 0x109a: 0x2148, 0x109b: 0x214d, 0x109c: 0x2152, 0x109d: 0x2161, + 0x109e: 0x216b, 0x109f: 0x2704, 0x10a0: 0x2712, 0x10a1: 0x1ed2, 0x10a2: 0x1edc, 0x10a3: 0x1f04, + 0x10a4: 0x1f0e, 0x10a5: 0x1f2c, 0x10a6: 0x1f36, 0x10a7: 0x1f9a, 0x10a8: 0x1f9f, 0x10a9: 0x1fc2, + 0x10aa: 0x1fc7, 0x10ab: 0x209e, 0x10ac: 0x20a3, 0x10ad: 0x20c6, 0x10ae: 0x2116, 0x10af: 0x2120, + 0x10b0: 0x2161, 0x10b1: 0x216b, 0x10b2: 0x4645, 0x10b3: 0x464d, 0x10b4: 0x4655, 0x10b5: 0x2021, + 0x10b6: 0x2026, 0x10b7: 0x203a, 0x10b8: 0x203f, 0x10b9: 0x204e, 0x10ba: 0x2053, 0x10bb: 0x1fa4, + 0x10bc: 0x1fa9, 0x10bd: 0x1fcc, 0x10be: 0x1fd1, 0x10bf: 0x1f63, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x1f68, 0x10c1: 0x1f4f, 0x10c2: 0x1f54, 0x10c3: 0x1f7c, 0x10c4: 0x1f81, 0x10c5: 0x1fea, + 0x10c6: 0x1fef, 0x10c7: 0x200d, 0x10c8: 0x2012, 0x10c9: 0x1fae, 0x10ca: 0x1fb3, 0x10cb: 0x1fb8, + 0x10cc: 0x1fc2, 0x10cd: 0x1fbd, 0x10ce: 0x1f95, 0x10cf: 0x1fe0, 0x10d0: 0x2003, 0x10d1: 0x2021, + 0x10d2: 0x2026, 0x10d3: 0x203a, 0x10d4: 0x203f, 0x10d5: 0x204e, 0x10d6: 0x2053, 0x10d7: 0x1fa4, + 0x10d8: 0x1fa9, 0x10d9: 0x1fcc, 0x10da: 0x1fd1, 0x10db: 0x1f63, 0x10dc: 0x1f68, 0x10dd: 0x1f4f, + 0x10de: 0x1f54, 0x10df: 0x1f7c, 0x10e0: 0x1f81, 0x10e1: 0x1fea, 0x10e2: 0x1fef, 0x10e3: 0x200d, + 0x10e4: 0x2012, 0x10e5: 0x1fae, 0x10e6: 0x1fb3, 0x10e7: 0x1fb8, 0x10e8: 0x1fc2, 0x10e9: 0x1fbd, + 0x10ea: 0x1f95, 0x10eb: 0x1fe0, 0x10ec: 0x2003, 0x10ed: 0x1fae, 0x10ee: 0x1fb3, 0x10ef: 0x1fb8, + 0x10f0: 0x1fc2, 0x10f1: 0x1f9f, 0x10f2: 0x1fc7, 0x10f3: 0x201c, 0x10f4: 0x1f86, 0x10f5: 0x1f8b, + 0x10f6: 0x1f90, 0x10f7: 0x1fae, 0x10f8: 0x1fb3, 0x10f9: 0x1fb8, 0x10fa: 0x201c, 0x10fb: 0x202b, + 0x10fc: 0x4549, 0x10fd: 0x4549, + // Block 0x44, offset 0x1100 + 0x1110: 0x2441, 0x1111: 0x2456, + 0x1112: 0x2456, 0x1113: 0x245d, 0x1114: 0x2464, 0x1115: 0x2479, 0x1116: 0x2480, 0x1117: 0x2487, + 0x1118: 0x24aa, 0x1119: 0x24aa, 0x111a: 0x24cd, 0x111b: 0x24c6, 0x111c: 0x24e2, 0x111d: 0x24d4, + 0x111e: 0x24db, 0x111f: 0x24fe, 0x1120: 0x24fe, 0x1121: 0x24f7, 0x1122: 0x2505, 0x1123: 0x2505, + 0x1124: 0x252f, 0x1125: 0x252f, 0x1126: 0x254b, 0x1127: 0x2513, 0x1128: 0x2513, 0x1129: 0x250c, + 0x112a: 0x2521, 0x112b: 0x2521, 0x112c: 0x2528, 0x112d: 0x2528, 0x112e: 0x2552, 0x112f: 0x2560, + 0x1130: 0x2560, 0x1131: 0x2567, 0x1132: 0x2567, 0x1133: 0x256e, 0x1134: 0x2575, 0x1135: 0x257c, + 0x1136: 0x2583, 0x1137: 0x2583, 0x1138: 0x258a, 0x1139: 0x2598, 0x113a: 0x25a6, 0x113b: 0x259f, + 0x113c: 0x25ad, 0x113d: 0x25ad, 0x113e: 0x25c2, 0x113f: 0x25c9, + // Block 0x45, offset 0x1140 + 0x1140: 0x25fa, 0x1141: 0x2608, 0x1142: 0x2601, 0x1143: 0x25e5, 0x1144: 0x25e5, 0x1145: 0x260f, + 0x1146: 0x260f, 0x1147: 0x2616, 0x1148: 0x2616, 0x1149: 0x2640, 0x114a: 0x2647, 0x114b: 0x264e, + 0x114c: 0x2624, 0x114d: 0x2632, 0x114e: 0x2655, 0x114f: 0x265c, + 0x1152: 0x262b, 0x1153: 0x26b0, 0x1154: 0x26b7, 0x1155: 0x268d, 0x1156: 0x2694, 0x1157: 0x2678, + 0x1158: 0x2678, 0x1159: 0x267f, 0x115a: 0x26a9, 0x115b: 0x26a2, 0x115c: 0x26cc, 0x115d: 0x26cc, + 0x115e: 0x243a, 0x115f: 0x244f, 0x1160: 0x2448, 0x1161: 0x2472, 0x1162: 0x246b, 0x1163: 0x2495, + 0x1164: 0x248e, 0x1165: 0x24b8, 0x1166: 0x249c, 0x1167: 0x24b1, 0x1168: 0x24e9, 0x1169: 0x2536, + 0x116a: 0x251a, 0x116b: 0x2559, 0x116c: 0x25f3, 0x116d: 0x261d, 0x116e: 0x26c5, 0x116f: 0x26be, + 0x1170: 0x26d3, 0x1171: 0x266a, 0x1172: 0x25d0, 0x1173: 0x269b, 0x1174: 0x25c2, 0x1175: 0x25fa, + 0x1176: 0x2591, 0x1177: 0x25de, 0x1178: 0x2671, 0x1179: 0x2663, 0x117a: 0x25ec, 0x117b: 0x25d7, + 0x117c: 0x25ec, 0x117d: 0x2671, 0x117e: 0x24a3, 0x117f: 0x24bf, + // Block 0x46, offset 0x1180 + 0x1180: 0x2639, 0x1181: 0x25b4, 0x1182: 0x2433, 0x1183: 0x25d7, 0x1184: 0x257c, 0x1185: 0x254b, + 0x1186: 0x24f0, 0x1187: 0x2686, + 0x11b0: 0x2544, 0x11b1: 0x25bb, 0x11b2: 0x28f6, 0x11b3: 0x28ed, 0x11b4: 0x2923, 0x11b5: 0x2911, + 0x11b6: 0x28ff, 0x11b7: 0x291a, 0x11b8: 0x292c, 0x11b9: 0x253d, 0x11ba: 0x2db3, 0x11bb: 0x2c33, + 0x11bc: 0x2908, + // Block 0x47, offset 0x11c0 + 0x11d0: 0x0019, 0x11d1: 0x057e, + 0x11d2: 0x0582, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x05ba, + 0x11d8: 0x05be, 0x11d9: 0x1c8c, + 0x11e0: 0x8133, 0x11e1: 0x8133, 0x11e2: 0x8133, 0x11e3: 0x8133, + 0x11e4: 0x8133, 0x11e5: 0x8133, 0x11e6: 0x8133, 0x11e7: 0x812e, 0x11e8: 0x812e, 0x11e9: 0x812e, + 0x11ea: 0x812e, 0x11eb: 0x812e, 0x11ec: 0x812e, 0x11ed: 0x812e, 0x11ee: 0x8133, 0x11ef: 0x8133, + 0x11f0: 0x19a0, 0x11f1: 0x053a, 0x11f2: 0x0536, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011, + 0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x05b2, 0x11fa: 0x05b6, 0x11fb: 0x05a6, + 0x11fc: 0x05aa, 0x11fd: 0x058e, 0x11fe: 0x0592, 0x11ff: 0x0586, + // Block 0x48, offset 0x1200 + 0x1200: 0x058a, 0x1201: 0x0596, 0x1202: 0x059a, 0x1203: 0x059e, 0x1204: 0x05a2, + 0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x43aa, 0x120a: 0x43aa, 0x120b: 0x43aa, + 0x120c: 0x43aa, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x057e, + 0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003, + 0x1218: 0x053a, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x05b2, + 0x121e: 0x05b6, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b, + 0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009, + 0x122a: 0x000b, 0x122b: 0x0041, + 0x1230: 0x43eb, 0x1231: 0x456d, 0x1232: 0x43f0, 0x1234: 0x43f5, + 0x1236: 0x43fa, 0x1237: 0x4573, 0x1238: 0x43ff, 0x1239: 0x4579, 0x123a: 0x4404, 0x123b: 0x457f, + 0x123c: 0x4409, 0x123d: 0x4585, 0x123e: 0x440e, 0x123f: 0x458b, + // Block 0x49, offset 0x1240 + 0x1240: 0x0329, 0x1241: 0x454f, 0x1242: 0x454f, 0x1243: 0x4555, 0x1244: 0x4555, 0x1245: 0x4597, + 0x1246: 0x4597, 0x1247: 0x455b, 0x1248: 0x455b, 0x1249: 0x45a3, 0x124a: 0x45a3, 0x124b: 0x45a3, + 0x124c: 0x45a3, 0x124d: 0x032c, 0x124e: 0x032c, 0x124f: 0x032f, 0x1250: 0x032f, 0x1251: 0x032f, + 0x1252: 0x032f, 0x1253: 0x0332, 0x1254: 0x0332, 0x1255: 0x0335, 0x1256: 0x0335, 0x1257: 0x0335, + 0x1258: 0x0335, 0x1259: 0x0338, 0x125a: 0x0338, 0x125b: 0x0338, 0x125c: 0x0338, 0x125d: 0x033b, + 0x125e: 0x033b, 0x125f: 0x033b, 0x1260: 0x033b, 0x1261: 0x033e, 0x1262: 0x033e, 0x1263: 0x033e, + 0x1264: 0x033e, 0x1265: 0x0341, 0x1266: 0x0341, 0x1267: 0x0341, 0x1268: 0x0341, 0x1269: 0x0344, + 0x126a: 0x0344, 0x126b: 0x0347, 0x126c: 0x0347, 0x126d: 0x034a, 0x126e: 0x034a, 0x126f: 0x034d, + 0x1270: 0x034d, 0x1271: 0x0350, 0x1272: 0x0350, 0x1273: 0x0350, 0x1274: 0x0350, 0x1275: 0x0353, + 0x1276: 0x0353, 0x1277: 0x0353, 0x1278: 0x0353, 0x1279: 0x0356, 0x127a: 0x0356, 0x127b: 0x0356, + 0x127c: 0x0356, 0x127d: 0x0359, 0x127e: 0x0359, 0x127f: 0x0359, + // Block 0x4a, offset 0x1280 + 0x1280: 0x0359, 0x1281: 0x035c, 0x1282: 0x035c, 0x1283: 0x035c, 0x1284: 0x035c, 0x1285: 0x035f, + 0x1286: 0x035f, 0x1287: 0x035f, 0x1288: 0x035f, 0x1289: 0x0362, 0x128a: 0x0362, 0x128b: 0x0362, + 0x128c: 0x0362, 0x128d: 0x0365, 0x128e: 0x0365, 0x128f: 0x0365, 0x1290: 0x0365, 0x1291: 0x0368, + 0x1292: 0x0368, 0x1293: 0x0368, 0x1294: 0x0368, 0x1295: 0x036b, 0x1296: 0x036b, 0x1297: 0x036b, + 0x1298: 0x036b, 0x1299: 0x036e, 0x129a: 0x036e, 0x129b: 0x036e, 0x129c: 0x036e, 0x129d: 0x0371, + 0x129e: 0x0371, 0x129f: 0x0371, 0x12a0: 0x0371, 0x12a1: 0x0374, 0x12a2: 0x0374, 0x12a3: 0x0374, + 0x12a4: 0x0374, 0x12a5: 0x0377, 0x12a6: 0x0377, 0x12a7: 0x0377, 0x12a8: 0x0377, 0x12a9: 0x037a, + 0x12aa: 0x037a, 0x12ab: 0x037a, 0x12ac: 0x037a, 0x12ad: 0x037d, 0x12ae: 0x037d, 0x12af: 0x0380, + 0x12b0: 0x0380, 0x12b1: 0x0383, 0x12b2: 0x0383, 0x12b3: 0x0383, 0x12b4: 0x0383, 0x12b5: 0x2f41, + 0x12b6: 0x2f41, 0x12b7: 0x2f49, 0x12b8: 0x2f49, 0x12b9: 0x2f51, 0x12ba: 0x2f51, 0x12bb: 0x20b2, + 0x12bc: 0x20b2, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b, + 0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097, + 0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3, + 0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af, + 0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb, + 0x12de: 0x00bd, 0x12df: 0x056e, 0x12e0: 0x0572, 0x12e1: 0x0582, 0x12e2: 0x0596, 0x12e3: 0x059a, + 0x12e4: 0x057e, 0x12e5: 0x06a6, 0x12e6: 0x069e, 0x12e7: 0x05c2, 0x12e8: 0x05ca, 0x12e9: 0x05d2, + 0x12ea: 0x05da, 0x12eb: 0x05e2, 0x12ec: 0x0666, 0x12ed: 0x066e, 0x12ee: 0x0676, 0x12ef: 0x061a, + 0x12f0: 0x06aa, 0x12f1: 0x05c6, 0x12f2: 0x05ce, 0x12f3: 0x05d6, 0x12f4: 0x05de, 0x12f5: 0x05e6, + 0x12f6: 0x05ea, 0x12f7: 0x05ee, 0x12f8: 0x05f2, 0x12f9: 0x05f6, 0x12fa: 0x05fa, 0x12fb: 0x05fe, + 0x12fc: 0x0602, 0x12fd: 0x0606, 0x12fe: 0x060a, 0x12ff: 0x060e, + // Block 0x4c, offset 0x1300 + 0x1300: 0x0612, 0x1301: 0x0616, 0x1302: 0x061e, 0x1303: 0x0622, 0x1304: 0x0626, 0x1305: 0x062a, + 0x1306: 0x062e, 0x1307: 0x0632, 0x1308: 0x0636, 0x1309: 0x063a, 0x130a: 0x063e, 0x130b: 0x0642, + 0x130c: 0x0646, 0x130d: 0x064a, 0x130e: 0x064e, 0x130f: 0x0652, 0x1310: 0x0656, 0x1311: 0x065a, + 0x1312: 0x065e, 0x1313: 0x0662, 0x1314: 0x066a, 0x1315: 0x0672, 0x1316: 0x067a, 0x1317: 0x067e, + 0x1318: 0x0682, 0x1319: 0x0686, 0x131a: 0x068a, 0x131b: 0x068e, 0x131c: 0x0692, 0x131d: 0x06a2, + 0x131e: 0x4bb9, 0x131f: 0x4bbf, 0x1320: 0x04b6, 0x1321: 0x0406, 0x1322: 0x040a, 0x1323: 0x4b7c, + 0x1324: 0x040e, 0x1325: 0x4b82, 0x1326: 0x4b88, 0x1327: 0x0412, 0x1328: 0x0416, 0x1329: 0x041a, + 0x132a: 0x4b8e, 0x132b: 0x4b94, 0x132c: 0x4b9a, 0x132d: 0x4ba0, 0x132e: 0x4ba6, 0x132f: 0x4bac, + 0x1330: 0x045a, 0x1331: 0x041e, 0x1332: 0x0422, 0x1333: 0x0426, 0x1334: 0x046e, 0x1335: 0x042a, + 0x1336: 0x042e, 0x1337: 0x0432, 0x1338: 0x0436, 0x1339: 0x043a, 0x133a: 0x043e, 0x133b: 0x0442, + 0x133c: 0x0446, 0x133d: 0x044a, 0x133e: 0x044e, + // Block 0x4d, offset 0x1340 + 0x1342: 0x4afe, 0x1343: 0x4b04, 0x1344: 0x4b0a, 0x1345: 0x4b10, + 0x1346: 0x4b16, 0x1347: 0x4b1c, 0x134a: 0x4b22, 0x134b: 0x4b28, + 0x134c: 0x4b2e, 0x134d: 0x4b34, 0x134e: 0x4b3a, 0x134f: 0x4b40, + 0x1352: 0x4b46, 0x1353: 0x4b4c, 0x1354: 0x4b52, 0x1355: 0x4b58, 0x1356: 0x4b5e, 0x1357: 0x4b64, + 0x135a: 0x4b6a, 0x135b: 0x4b70, 0x135c: 0x4b76, + 0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x43a5, + 0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x053e, 0x1368: 0x0562, 0x1369: 0x0542, + 0x136a: 0x0546, 0x136b: 0x054a, 0x136c: 0x054e, 0x136d: 0x0566, 0x136e: 0x056a, + // Block 0x4e, offset 0x1380 + 0x1381: 0x01f1, 0x1382: 0x01f4, 0x1383: 0x00d4, 0x1384: 0x01be, 0x1385: 0x010d, + 0x1387: 0x01d3, 0x1388: 0x174e, 0x1389: 0x01d9, 0x138a: 0x01d6, 0x138b: 0x0116, + 0x138c: 0x0119, 0x138d: 0x0526, 0x138e: 0x011c, 0x138f: 0x0128, 0x1390: 0x01e5, 0x1391: 0x013a, + 0x1392: 0x0134, 0x1393: 0x012e, 0x1394: 0x01c1, 0x1395: 0x00e0, 0x1396: 0x01c4, 0x1397: 0x0143, + 0x1398: 0x0194, 0x1399: 0x01e8, 0x139a: 0x01eb, 0x139b: 0x0152, 0x139c: 0x1756, 0x139d: 0x1742, + 0x139e: 0x0158, 0x139f: 0x175b, 0x13a0: 0x01a9, 0x13a1: 0x1760, 0x13a2: 0x00da, 0x13a3: 0x0170, + 0x13a4: 0x0173, 0x13a5: 0x00a3, 0x13a6: 0x017c, 0x13a7: 0x1765, 0x13a8: 0x0182, 0x13a9: 0x0185, + 0x13aa: 0x0188, 0x13ab: 0x01e2, 0x13ac: 0x01dc, 0x13ad: 0x1752, 0x13ae: 0x01df, 0x13af: 0x0197, + 0x13b0: 0x0576, 0x13b2: 0x01ac, 0x13b3: 0x01cd, 0x13b4: 0x01d0, 0x13b5: 0x01bb, + 0x13b6: 0x00f5, 0x13b7: 0x00f8, 0x13b8: 0x00fb, 0x13b9: 0x176a, 0x13ba: 0x176f, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0063, 0x13c1: 0x0065, 0x13c2: 0x0067, 0x13c3: 0x0069, 0x13c4: 0x006b, 0x13c5: 0x006d, + 0x13c6: 0x006f, 0x13c7: 0x0071, 0x13c8: 0x0073, 0x13c9: 0x0075, 0x13ca: 0x0083, 0x13cb: 0x0085, + 0x13cc: 0x0087, 0x13cd: 0x0089, 0x13ce: 0x008b, 0x13cf: 0x008d, 0x13d0: 0x008f, 0x13d1: 0x0091, + 0x13d2: 0x0093, 0x13d3: 0x0095, 0x13d4: 0x0097, 0x13d5: 0x0099, 0x13d6: 0x009b, 0x13d7: 0x009d, + 0x13d8: 0x009f, 0x13d9: 0x00a1, 0x13da: 0x00a3, 0x13db: 0x00a5, 0x13dc: 0x00a7, 0x13dd: 0x00a9, + 0x13de: 0x00ab, 0x13df: 0x00ad, 0x13e0: 0x00af, 0x13e1: 0x00b1, 0x13e2: 0x00b3, 0x13e3: 0x00b5, + 0x13e4: 0x00e3, 0x13e5: 0x0101, 0x13e8: 0x01f7, 0x13e9: 0x01fa, + 0x13ea: 0x01fd, 0x13eb: 0x0200, 0x13ec: 0x0203, 0x13ed: 0x0206, 0x13ee: 0x0209, 0x13ef: 0x020c, + 0x13f0: 0x020f, 0x13f1: 0x0212, 0x13f2: 0x0215, 0x13f3: 0x0218, 0x13f4: 0x021b, 0x13f5: 0x021e, + 0x13f6: 0x0221, 0x13f7: 0x0224, 0x13f8: 0x0227, 0x13f9: 0x020c, 0x13fa: 0x022a, 0x13fb: 0x022d, + 0x13fc: 0x0230, 0x13fd: 0x0233, 0x13fe: 0x0236, 0x13ff: 0x0239, + // Block 0x50, offset 0x1400 + 0x1400: 0x0281, 0x1401: 0x0284, 0x1402: 0x0287, 0x1403: 0x0552, 0x1404: 0x024b, 0x1405: 0x0254, + 0x1406: 0x025a, 0x1407: 0x027e, 0x1408: 0x026f, 0x1409: 0x026c, 0x140a: 0x028a, 0x140b: 0x028d, + 0x140e: 0x0021, 0x140f: 0x0023, 0x1410: 0x0025, 0x1411: 0x0027, + 0x1412: 0x0029, 0x1413: 0x002b, 0x1414: 0x002d, 0x1415: 0x002f, 0x1416: 0x0031, 0x1417: 0x0033, + 0x1418: 0x0021, 0x1419: 0x0023, 0x141a: 0x0025, 0x141b: 0x0027, 0x141c: 0x0029, 0x141d: 0x002b, + 0x141e: 0x002d, 0x141f: 0x002f, 0x1420: 0x0031, 0x1421: 0x0033, 0x1422: 0x0021, 0x1423: 0x0023, + 0x1424: 0x0025, 0x1425: 0x0027, 0x1426: 0x0029, 0x1427: 0x002b, 0x1428: 0x002d, 0x1429: 0x002f, + 0x142a: 0x0031, 0x142b: 0x0033, 0x142c: 0x0021, 0x142d: 0x0023, 0x142e: 0x0025, 0x142f: 0x0027, + 0x1430: 0x0029, 0x1431: 0x002b, 0x1432: 0x002d, 0x1433: 0x002f, 0x1434: 0x0031, 0x1435: 0x0033, + 0x1436: 0x0021, 0x1437: 0x0023, 0x1438: 0x0025, 0x1439: 0x0027, 0x143a: 0x0029, 0x143b: 0x002b, + 0x143c: 0x002d, 0x143d: 0x002f, 0x143e: 0x0031, 0x143f: 0x0033, + // Block 0x51, offset 0x1440 + 0x1440: 0x8133, 0x1441: 0x8133, 0x1442: 0x8133, 0x1443: 0x8133, 0x1444: 0x8133, 0x1445: 0x8133, + 0x1446: 0x8133, 0x1448: 0x8133, 0x1449: 0x8133, 0x144a: 0x8133, 0x144b: 0x8133, + 0x144c: 0x8133, 0x144d: 0x8133, 0x144e: 0x8133, 0x144f: 0x8133, 0x1450: 0x8133, 0x1451: 0x8133, + 0x1452: 0x8133, 0x1453: 0x8133, 0x1454: 0x8133, 0x1455: 0x8133, 0x1456: 0x8133, 0x1457: 0x8133, + 0x1458: 0x8133, 0x145b: 0x8133, 0x145c: 0x8133, 0x145d: 0x8133, + 0x145e: 0x8133, 0x145f: 0x8133, 0x1460: 0x8133, 0x1461: 0x8133, 0x1463: 0x8133, + 0x1464: 0x8133, 0x1466: 0x8133, 0x1467: 0x8133, 0x1468: 0x8133, 0x1469: 0x8133, + 0x146a: 0x8133, + 0x1470: 0x0290, 0x1471: 0x0293, 0x1472: 0x0296, 0x1473: 0x0299, 0x1474: 0x029c, 0x1475: 0x029f, + 0x1476: 0x02a2, 0x1477: 0x02a5, 0x1478: 0x02a8, 0x1479: 0x02ab, 0x147a: 0x02ae, 0x147b: 0x02b1, + 0x147c: 0x02b7, 0x147d: 0x02ba, 0x147e: 0x02bd, 0x147f: 0x02c0, + // Block 0x52, offset 0x1480 + 0x1480: 0x02c3, 0x1481: 0x02c6, 0x1482: 0x02c9, 0x1483: 0x02cc, 0x1484: 0x02cf, 0x1485: 0x02d2, + 0x1486: 0x02d5, 0x1487: 0x02db, 0x1488: 0x02e1, 0x1489: 0x02e4, 0x148a: 0x1736, 0x148b: 0x0302, + 0x148c: 0x02ea, 0x148d: 0x02ed, 0x148e: 0x0305, 0x148f: 0x02f9, 0x1490: 0x02ff, 0x1491: 0x0290, + 0x1492: 0x0293, 0x1493: 0x0296, 0x1494: 0x0299, 0x1495: 0x029c, 0x1496: 0x029f, 0x1497: 0x02a2, + 0x1498: 0x02a5, 0x1499: 0x02a8, 0x149a: 0x02ab, 0x149b: 0x02ae, 0x149c: 0x02b7, 0x149d: 0x02ba, + 0x149e: 0x02c0, 0x149f: 0x02c6, 0x14a0: 0x02c9, 0x14a1: 0x02cc, 0x14a2: 0x02cf, 0x14a3: 0x02d2, + 0x14a4: 0x02d5, 0x14a5: 0x02d8, 0x14a6: 0x02db, 0x14a7: 0x02f3, 0x14a8: 0x02ea, 0x14a9: 0x02e7, + 0x14aa: 0x02f0, 0x14ab: 0x02f6, 0x14ac: 0x1732, 0x14ad: 0x02fc, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x032c, 0x14c1: 0x032f, 0x14c2: 0x033b, 0x14c3: 0x0344, 0x14c5: 0x037d, + 0x14c6: 0x034d, 0x14c7: 0x033e, 0x14c8: 0x035c, 0x14c9: 0x0383, 0x14ca: 0x036e, 0x14cb: 0x0371, + 0x14cc: 0x0374, 0x14cd: 0x0377, 0x14ce: 0x0350, 0x14cf: 0x0362, 0x14d0: 0x0368, 0x14d1: 0x0356, + 0x14d2: 0x036b, 0x14d3: 0x034a, 0x14d4: 0x0353, 0x14d5: 0x0335, 0x14d6: 0x0338, 0x14d7: 0x0341, + 0x14d8: 0x0347, 0x14d9: 0x0359, 0x14da: 0x035f, 0x14db: 0x0365, 0x14dc: 0x0386, 0x14dd: 0x03d7, + 0x14de: 0x03bf, 0x14df: 0x0389, 0x14e1: 0x032f, 0x14e2: 0x033b, + 0x14e4: 0x037a, 0x14e7: 0x033e, 0x14e9: 0x0383, + 0x14ea: 0x036e, 0x14eb: 0x0371, 0x14ec: 0x0374, 0x14ed: 0x0377, 0x14ee: 0x0350, 0x14ef: 0x0362, + 0x14f0: 0x0368, 0x14f1: 0x0356, 0x14f2: 0x036b, 0x14f4: 0x0353, 0x14f5: 0x0335, + 0x14f6: 0x0338, 0x14f7: 0x0341, 0x14f9: 0x0359, 0x14fb: 0x0365, + // Block 0x54, offset 0x1500 + 0x1502: 0x033b, + 0x1507: 0x033e, 0x1509: 0x0383, 0x150b: 0x0371, + 0x150d: 0x0377, 0x150e: 0x0350, 0x150f: 0x0362, 0x1511: 0x0356, + 0x1512: 0x036b, 0x1514: 0x0353, 0x1517: 0x0341, + 0x1519: 0x0359, 0x151b: 0x0365, 0x151d: 0x03d7, + 0x151f: 0x0389, 0x1521: 0x032f, 0x1522: 0x033b, + 0x1524: 0x037a, 0x1527: 0x033e, 0x1528: 0x035c, 0x1529: 0x0383, + 0x152a: 0x036e, 0x152c: 0x0374, 0x152d: 0x0377, 0x152e: 0x0350, 0x152f: 0x0362, + 0x1530: 0x0368, 0x1531: 0x0356, 0x1532: 0x036b, 0x1534: 0x0353, 0x1535: 0x0335, + 0x1536: 0x0338, 0x1537: 0x0341, 0x1539: 0x0359, 0x153a: 0x035f, 0x153b: 0x0365, + 0x153c: 0x0386, 0x153e: 0x03bf, + // Block 0x55, offset 0x1540 + 0x1540: 0x032c, 0x1541: 0x032f, 0x1542: 0x033b, 0x1543: 0x0344, 0x1544: 0x037a, 0x1545: 0x037d, + 0x1546: 0x034d, 0x1547: 0x033e, 0x1548: 0x035c, 0x1549: 0x0383, 0x154b: 0x0371, + 0x154c: 0x0374, 0x154d: 0x0377, 0x154e: 0x0350, 0x154f: 0x0362, 0x1550: 0x0368, 0x1551: 0x0356, + 0x1552: 0x036b, 0x1553: 0x034a, 0x1554: 0x0353, 0x1555: 0x0335, 0x1556: 0x0338, 0x1557: 0x0341, + 0x1558: 0x0347, 0x1559: 0x0359, 0x155a: 0x035f, 0x155b: 0x0365, + 0x1561: 0x032f, 0x1562: 0x033b, 0x1563: 0x0344, + 0x1565: 0x037d, 0x1566: 0x034d, 0x1567: 0x033e, 0x1568: 0x035c, 0x1569: 0x0383, + 0x156b: 0x0371, 0x156c: 0x0374, 0x156d: 0x0377, 0x156e: 0x0350, 0x156f: 0x0362, + 0x1570: 0x0368, 0x1571: 0x0356, 0x1572: 0x036b, 0x1573: 0x034a, 0x1574: 0x0353, 0x1575: 0x0335, + 0x1576: 0x0338, 0x1577: 0x0341, 0x1578: 0x0347, 0x1579: 0x0359, 0x157a: 0x035f, 0x157b: 0x0365, + // Block 0x56, offset 0x1580 + 0x1580: 0x19a6, 0x1581: 0x19a3, 0x1582: 0x19a9, 0x1583: 0x19cd, 0x1584: 0x19f1, 0x1585: 0x1a15, + 0x1586: 0x1a39, 0x1587: 0x1a42, 0x1588: 0x1a48, 0x1589: 0x1a4e, 0x158a: 0x1a54, + 0x1590: 0x1bbc, 0x1591: 0x1bc0, + 0x1592: 0x1bc4, 0x1593: 0x1bc8, 0x1594: 0x1bcc, 0x1595: 0x1bd0, 0x1596: 0x1bd4, 0x1597: 0x1bd8, + 0x1598: 0x1bdc, 0x1599: 0x1be0, 0x159a: 0x1be4, 0x159b: 0x1be8, 0x159c: 0x1bec, 0x159d: 0x1bf0, + 0x159e: 0x1bf4, 0x159f: 0x1bf8, 0x15a0: 0x1bfc, 0x15a1: 0x1c00, 0x15a2: 0x1c04, 0x15a3: 0x1c08, + 0x15a4: 0x1c0c, 0x15a5: 0x1c10, 0x15a6: 0x1c14, 0x15a7: 0x1c18, 0x15a8: 0x1c1c, 0x15a9: 0x1c20, + 0x15aa: 0x2855, 0x15ab: 0x0047, 0x15ac: 0x0065, 0x15ad: 0x1a69, 0x15ae: 0x1ae1, + 0x15b0: 0x0043, 0x15b1: 0x0045, 0x15b2: 0x0047, 0x15b3: 0x0049, 0x15b4: 0x004b, 0x15b5: 0x004d, + 0x15b6: 0x004f, 0x15b7: 0x0051, 0x15b8: 0x0053, 0x15b9: 0x0055, 0x15ba: 0x0057, 0x15bb: 0x0059, + 0x15bc: 0x005b, 0x15bd: 0x005d, 0x15be: 0x005f, 0x15bf: 0x0061, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x27dd, 0x15c1: 0x27f2, 0x15c2: 0x05fe, + 0x15d0: 0x0d0a, 0x15d1: 0x0b42, + 0x15d2: 0x09ce, 0x15d3: 0x4705, 0x15d4: 0x0816, 0x15d5: 0x0aea, 0x15d6: 0x142a, 0x15d7: 0x0afa, + 0x15d8: 0x0822, 0x15d9: 0x0dd2, 0x15da: 0x0faa, 0x15db: 0x0daa, 0x15dc: 0x0922, 0x15dd: 0x0c66, + 0x15de: 0x08ba, 0x15df: 0x0db2, 0x15e0: 0x090e, 0x15e1: 0x1212, 0x15e2: 0x107e, 0x15e3: 0x1486, + 0x15e4: 0x0ace, 0x15e5: 0x0a06, 0x15e6: 0x0f5e, 0x15e7: 0x0d16, 0x15e8: 0x0d42, 0x15e9: 0x07ba, + 0x15ea: 0x07c6, 0x15eb: 0x1506, 0x15ec: 0x0bd6, 0x15ed: 0x07e2, 0x15ee: 0x09ea, 0x15ef: 0x0d36, + 0x15f0: 0x14ae, 0x15f1: 0x0d0e, 0x15f2: 0x116a, 0x15f3: 0x11a6, 0x15f4: 0x09f2, 0x15f5: 0x0f3e, + 0x15f6: 0x0e06, 0x15f7: 0x0e02, 0x15f8: 0x1092, 0x15f9: 0x0926, 0x15fa: 0x0a52, 0x15fb: 0x153e, + // Block 0x58, offset 0x1600 + 0x1600: 0x07f6, 0x1601: 0x07ee, 0x1602: 0x07fe, 0x1603: 0x1774, 0x1604: 0x0842, 0x1605: 0x0852, + 0x1606: 0x0856, 0x1607: 0x085e, 0x1608: 0x0866, 0x1609: 0x086a, 0x160a: 0x0876, 0x160b: 0x086e, + 0x160c: 0x06ae, 0x160d: 0x1788, 0x160e: 0x088a, 0x160f: 0x088e, 0x1610: 0x0892, 0x1611: 0x08ae, + 0x1612: 0x1779, 0x1613: 0x06b2, 0x1614: 0x089a, 0x1615: 0x08ba, 0x1616: 0x1783, 0x1617: 0x08ca, + 0x1618: 0x08d2, 0x1619: 0x0832, 0x161a: 0x08da, 0x161b: 0x08de, 0x161c: 0x195e, 0x161d: 0x08fa, + 0x161e: 0x0902, 0x161f: 0x06ba, 0x1620: 0x091a, 0x1621: 0x091e, 0x1622: 0x0926, 0x1623: 0x092a, + 0x1624: 0x06be, 0x1625: 0x0942, 0x1626: 0x0946, 0x1627: 0x0952, 0x1628: 0x095e, 0x1629: 0x0962, + 0x162a: 0x0966, 0x162b: 0x096e, 0x162c: 0x098e, 0x162d: 0x0992, 0x162e: 0x099a, 0x162f: 0x09aa, + 0x1630: 0x09b2, 0x1631: 0x09b6, 0x1632: 0x09b6, 0x1633: 0x09b6, 0x1634: 0x1797, 0x1635: 0x0f8e, + 0x1636: 0x09ca, 0x1637: 0x09d2, 0x1638: 0x179c, 0x1639: 0x09de, 0x163a: 0x09e6, 0x163b: 0x09ee, + 0x163c: 0x0a16, 0x163d: 0x0a02, 0x163e: 0x0a0e, 0x163f: 0x0a12, + // Block 0x59, offset 0x1640 + 0x1640: 0x0a1a, 0x1641: 0x0a22, 0x1642: 0x0a26, 0x1643: 0x0a2e, 0x1644: 0x0a36, 0x1645: 0x0a3a, + 0x1646: 0x0a3a, 0x1647: 0x0a42, 0x1648: 0x0a4a, 0x1649: 0x0a4e, 0x164a: 0x0a5a, 0x164b: 0x0a7e, + 0x164c: 0x0a62, 0x164d: 0x0a82, 0x164e: 0x0a66, 0x164f: 0x0a6e, 0x1650: 0x0906, 0x1651: 0x0aca, + 0x1652: 0x0a92, 0x1653: 0x0a96, 0x1654: 0x0a9a, 0x1655: 0x0a8e, 0x1656: 0x0aa2, 0x1657: 0x0a9e, + 0x1658: 0x0ab6, 0x1659: 0x17a1, 0x165a: 0x0ad2, 0x165b: 0x0ad6, 0x165c: 0x0ade, 0x165d: 0x0aea, + 0x165e: 0x0af2, 0x165f: 0x0b0e, 0x1660: 0x17a6, 0x1661: 0x17ab, 0x1662: 0x0b1a, 0x1663: 0x0b1e, + 0x1664: 0x0b22, 0x1665: 0x0b16, 0x1666: 0x0b2a, 0x1667: 0x06c2, 0x1668: 0x06c6, 0x1669: 0x0b32, + 0x166a: 0x0b3a, 0x166b: 0x0b3a, 0x166c: 0x17b0, 0x166d: 0x0b56, 0x166e: 0x0b5a, 0x166f: 0x0b5e, + 0x1670: 0x0b66, 0x1671: 0x17b5, 0x1672: 0x0b6e, 0x1673: 0x0b72, 0x1674: 0x0c4a, 0x1675: 0x0b7a, + 0x1676: 0x06ca, 0x1677: 0x0b86, 0x1678: 0x0b96, 0x1679: 0x0ba2, 0x167a: 0x0b9e, 0x167b: 0x17bf, + 0x167c: 0x0baa, 0x167d: 0x17c4, 0x167e: 0x0bb6, 0x167f: 0x0bb2, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0bba, 0x1681: 0x0bca, 0x1682: 0x0bce, 0x1683: 0x06ce, 0x1684: 0x0bde, 0x1685: 0x0be6, + 0x1686: 0x0bea, 0x1687: 0x0bee, 0x1688: 0x06d2, 0x1689: 0x17c9, 0x168a: 0x06d6, 0x168b: 0x0c0a, + 0x168c: 0x0c0e, 0x168d: 0x0c12, 0x168e: 0x0c1a, 0x168f: 0x1990, 0x1690: 0x0c32, 0x1691: 0x17d3, + 0x1692: 0x17d3, 0x1693: 0x12d2, 0x1694: 0x0c42, 0x1695: 0x0c42, 0x1696: 0x06da, 0x1697: 0x17f6, + 0x1698: 0x18c8, 0x1699: 0x0c52, 0x169a: 0x0c5a, 0x169b: 0x06de, 0x169c: 0x0c6e, 0x169d: 0x0c7e, + 0x169e: 0x0c82, 0x169f: 0x0c8a, 0x16a0: 0x0c9a, 0x16a1: 0x06e6, 0x16a2: 0x06e2, 0x16a3: 0x0c9e, + 0x16a4: 0x17d8, 0x16a5: 0x0ca2, 0x16a6: 0x0cb6, 0x16a7: 0x0cba, 0x16a8: 0x0cbe, 0x16a9: 0x0cba, + 0x16aa: 0x0cca, 0x16ab: 0x0cce, 0x16ac: 0x0cde, 0x16ad: 0x0cd6, 0x16ae: 0x0cda, 0x16af: 0x0ce2, + 0x16b0: 0x0ce6, 0x16b1: 0x0cea, 0x16b2: 0x0cf6, 0x16b3: 0x0cfa, 0x16b4: 0x0d12, 0x16b5: 0x0d1a, + 0x16b6: 0x0d2a, 0x16b7: 0x0d3e, 0x16b8: 0x17e7, 0x16b9: 0x0d3a, 0x16ba: 0x0d2e, 0x16bb: 0x0d46, + 0x16bc: 0x0d4e, 0x16bd: 0x0d62, 0x16be: 0x17ec, 0x16bf: 0x0d6a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x0d5e, 0x16c1: 0x0d56, 0x16c2: 0x06ea, 0x16c3: 0x0d72, 0x16c4: 0x0d7a, 0x16c5: 0x0d82, + 0x16c6: 0x0d76, 0x16c7: 0x06ee, 0x16c8: 0x0d92, 0x16c9: 0x0d9a, 0x16ca: 0x17f1, 0x16cb: 0x0dc6, + 0x16cc: 0x0dfa, 0x16cd: 0x0dd6, 0x16ce: 0x06fa, 0x16cf: 0x0de2, 0x16d0: 0x06f6, 0x16d1: 0x06f2, + 0x16d2: 0x08be, 0x16d3: 0x08c2, 0x16d4: 0x0dfe, 0x16d5: 0x0de6, 0x16d6: 0x12a6, 0x16d7: 0x075e, + 0x16d8: 0x0e0a, 0x16d9: 0x0e0e, 0x16da: 0x0e12, 0x16db: 0x0e26, 0x16dc: 0x0e1e, 0x16dd: 0x180a, + 0x16de: 0x06fe, 0x16df: 0x0e3a, 0x16e0: 0x0e2e, 0x16e1: 0x0e4a, 0x16e2: 0x0e52, 0x16e3: 0x1814, + 0x16e4: 0x0e56, 0x16e5: 0x0e42, 0x16e6: 0x0e5e, 0x16e7: 0x0702, 0x16e8: 0x0e62, 0x16e9: 0x0e66, + 0x16ea: 0x0e6a, 0x16eb: 0x0e76, 0x16ec: 0x1819, 0x16ed: 0x0e7e, 0x16ee: 0x0706, 0x16ef: 0x0e8a, + 0x16f0: 0x181e, 0x16f1: 0x0e8e, 0x16f2: 0x070a, 0x16f3: 0x0e9a, 0x16f4: 0x0ea6, 0x16f5: 0x0eb2, + 0x16f6: 0x0eb6, 0x16f7: 0x1823, 0x16f8: 0x17ba, 0x16f9: 0x1828, 0x16fa: 0x0ed6, 0x16fb: 0x182d, + 0x16fc: 0x0ee2, 0x16fd: 0x0eea, 0x16fe: 0x0eda, 0x16ff: 0x0ef6, + // Block 0x5c, offset 0x1700 + 0x1700: 0x0f06, 0x1701: 0x0f16, 0x1702: 0x0f0a, 0x1703: 0x0f0e, 0x1704: 0x0f1a, 0x1705: 0x0f1e, + 0x1706: 0x1832, 0x1707: 0x0f02, 0x1708: 0x0f36, 0x1709: 0x0f3a, 0x170a: 0x070e, 0x170b: 0x0f4e, + 0x170c: 0x0f4a, 0x170d: 0x1837, 0x170e: 0x0f2e, 0x170f: 0x0f6a, 0x1710: 0x183c, 0x1711: 0x1841, + 0x1712: 0x0f6e, 0x1713: 0x0f82, 0x1714: 0x0f7e, 0x1715: 0x0f7a, 0x1716: 0x0712, 0x1717: 0x0f86, + 0x1718: 0x0f96, 0x1719: 0x0f92, 0x171a: 0x0f9e, 0x171b: 0x177e, 0x171c: 0x0fae, 0x171d: 0x1846, + 0x171e: 0x0fba, 0x171f: 0x1850, 0x1720: 0x0fce, 0x1721: 0x0fda, 0x1722: 0x0fee, 0x1723: 0x1855, + 0x1724: 0x1002, 0x1725: 0x1006, 0x1726: 0x185a, 0x1727: 0x185f, 0x1728: 0x1022, 0x1729: 0x1032, + 0x172a: 0x0716, 0x172b: 0x1036, 0x172c: 0x071a, 0x172d: 0x071a, 0x172e: 0x104e, 0x172f: 0x1052, + 0x1730: 0x105a, 0x1731: 0x105e, 0x1732: 0x106a, 0x1733: 0x071e, 0x1734: 0x1082, 0x1735: 0x1864, + 0x1736: 0x109e, 0x1737: 0x1869, 0x1738: 0x10aa, 0x1739: 0x17ce, 0x173a: 0x10ba, 0x173b: 0x186e, + 0x173c: 0x1873, 0x173d: 0x1878, 0x173e: 0x0722, 0x173f: 0x0726, + // Block 0x5d, offset 0x1740 + 0x1740: 0x10f2, 0x1741: 0x1882, 0x1742: 0x187d, 0x1743: 0x1887, 0x1744: 0x188c, 0x1745: 0x10fa, + 0x1746: 0x10fe, 0x1747: 0x10fe, 0x1748: 0x1106, 0x1749: 0x072e, 0x174a: 0x110a, 0x174b: 0x0732, + 0x174c: 0x0736, 0x174d: 0x1896, 0x174e: 0x111e, 0x174f: 0x1126, 0x1750: 0x1132, 0x1751: 0x073a, + 0x1752: 0x189b, 0x1753: 0x1156, 0x1754: 0x18a0, 0x1755: 0x18a5, 0x1756: 0x1176, 0x1757: 0x118e, + 0x1758: 0x073e, 0x1759: 0x1196, 0x175a: 0x119a, 0x175b: 0x119e, 0x175c: 0x18aa, 0x175d: 0x18af, + 0x175e: 0x18af, 0x175f: 0x11b6, 0x1760: 0x0742, 0x1761: 0x18b4, 0x1762: 0x11ca, 0x1763: 0x11ce, + 0x1764: 0x0746, 0x1765: 0x18b9, 0x1766: 0x11ea, 0x1767: 0x074a, 0x1768: 0x11fa, 0x1769: 0x11f2, + 0x176a: 0x1202, 0x176b: 0x18c3, 0x176c: 0x121a, 0x176d: 0x074e, 0x176e: 0x1226, 0x176f: 0x122e, + 0x1770: 0x123e, 0x1771: 0x0752, 0x1772: 0x18cd, 0x1773: 0x18d2, 0x1774: 0x0756, 0x1775: 0x18d7, + 0x1776: 0x1256, 0x1777: 0x18dc, 0x1778: 0x1262, 0x1779: 0x126e, 0x177a: 0x1276, 0x177b: 0x18e1, + 0x177c: 0x18e6, 0x177d: 0x128a, 0x177e: 0x18eb, 0x177f: 0x1292, + // Block 0x5e, offset 0x1780 + 0x1780: 0x17fb, 0x1781: 0x075a, 0x1782: 0x12aa, 0x1783: 0x12ae, 0x1784: 0x0762, 0x1785: 0x12b2, + 0x1786: 0x0b2e, 0x1787: 0x18f0, 0x1788: 0x18f5, 0x1789: 0x1800, 0x178a: 0x1805, 0x178b: 0x12d2, + 0x178c: 0x12d6, 0x178d: 0x14ee, 0x178e: 0x0766, 0x178f: 0x1302, 0x1790: 0x12fe, 0x1791: 0x1306, + 0x1792: 0x093a, 0x1793: 0x130a, 0x1794: 0x130e, 0x1795: 0x1312, 0x1796: 0x131a, 0x1797: 0x18fa, + 0x1798: 0x1316, 0x1799: 0x131e, 0x179a: 0x1332, 0x179b: 0x1336, 0x179c: 0x1322, 0x179d: 0x133a, + 0x179e: 0x134e, 0x179f: 0x1362, 0x17a0: 0x132e, 0x17a1: 0x1342, 0x17a2: 0x1346, 0x17a3: 0x134a, + 0x17a4: 0x18ff, 0x17a5: 0x1909, 0x17a6: 0x1904, 0x17a7: 0x076a, 0x17a8: 0x136a, 0x17a9: 0x136e, + 0x17aa: 0x1376, 0x17ab: 0x191d, 0x17ac: 0x137a, 0x17ad: 0x190e, 0x17ae: 0x076e, 0x17af: 0x0772, + 0x17b0: 0x1913, 0x17b1: 0x1918, 0x17b2: 0x0776, 0x17b3: 0x139a, 0x17b4: 0x139e, 0x17b5: 0x13a2, + 0x17b6: 0x13a6, 0x17b7: 0x13b2, 0x17b8: 0x13ae, 0x17b9: 0x13ba, 0x17ba: 0x13b6, 0x17bb: 0x13c6, + 0x17bc: 0x13be, 0x17bd: 0x13c2, 0x17be: 0x13ca, 0x17bf: 0x077a, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x13d2, 0x17c1: 0x13d6, 0x17c2: 0x077e, 0x17c3: 0x13e6, 0x17c4: 0x13ea, 0x17c5: 0x1922, + 0x17c6: 0x13f6, 0x17c7: 0x13fa, 0x17c8: 0x0782, 0x17c9: 0x1406, 0x17ca: 0x06b6, 0x17cb: 0x1927, + 0x17cc: 0x192c, 0x17cd: 0x0786, 0x17ce: 0x078a, 0x17cf: 0x1432, 0x17d0: 0x144a, 0x17d1: 0x1466, + 0x17d2: 0x1476, 0x17d3: 0x1931, 0x17d4: 0x148a, 0x17d5: 0x148e, 0x17d6: 0x14a6, 0x17d7: 0x14b2, + 0x17d8: 0x193b, 0x17d9: 0x178d, 0x17da: 0x14be, 0x17db: 0x14ba, 0x17dc: 0x14c6, 0x17dd: 0x1792, + 0x17de: 0x14d2, 0x17df: 0x14de, 0x17e0: 0x1940, 0x17e1: 0x1945, 0x17e2: 0x151e, 0x17e3: 0x152a, + 0x17e4: 0x1532, 0x17e5: 0x194a, 0x17e6: 0x1536, 0x17e7: 0x1562, 0x17e8: 0x156e, 0x17e9: 0x1572, + 0x17ea: 0x156a, 0x17eb: 0x157e, 0x17ec: 0x1582, 0x17ed: 0x194f, 0x17ee: 0x158e, 0x17ef: 0x078e, + 0x17f0: 0x1596, 0x17f1: 0x1954, 0x17f2: 0x0792, 0x17f3: 0x15ce, 0x17f4: 0x0bbe, 0x17f5: 0x15e6, + 0x17f6: 0x1959, 0x17f7: 0x1963, 0x17f8: 0x0796, 0x17f9: 0x079a, 0x17fa: 0x160e, 0x17fb: 0x1968, + 0x17fc: 0x079e, 0x17fd: 0x196d, 0x17fe: 0x1626, 0x17ff: 0x1626, + // Block 0x60, offset 0x1800 + 0x1800: 0x162e, 0x1801: 0x1972, 0x1802: 0x1646, 0x1803: 0x07a2, 0x1804: 0x1656, 0x1805: 0x1662, + 0x1806: 0x166a, 0x1807: 0x1672, 0x1808: 0x07a6, 0x1809: 0x1977, 0x180a: 0x1686, 0x180b: 0x16a2, + 0x180c: 0x16ae, 0x180d: 0x07aa, 0x180e: 0x07ae, 0x180f: 0x16b2, 0x1810: 0x197c, 0x1811: 0x07b2, + 0x1812: 0x1981, 0x1813: 0x1986, 0x1814: 0x198b, 0x1815: 0x16d6, 0x1816: 0x07b6, 0x1817: 0x16ea, + 0x1818: 0x16f2, 0x1819: 0x16f6, 0x181a: 0x16fe, 0x181b: 0x1706, 0x181c: 0x170e, 0x181d: 0x1995, +} + +// nfkcIndex: 22 blocks, 1408 entries, 2816 bytes +// Block 0 is the zero block. +var nfkcIndex = [1408]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x5f, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x60, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x61, 0xcb: 0x62, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09, + 0xd0: 0x0a, 0xd1: 0x63, 0xd2: 0x64, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x65, + 0xd8: 0x66, 0xd9: 0x0d, 0xdb: 0x67, 0xdc: 0x68, 0xdd: 0x69, 0xdf: 0x6a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x6b, 0x121: 0x6c, 0x122: 0x6d, 0x123: 0x0e, 0x124: 0x6e, 0x125: 0x6f, 0x126: 0x70, 0x127: 0x71, + 0x128: 0x72, 0x129: 0x73, 0x12a: 0x74, 0x12b: 0x75, 0x12c: 0x70, 0x12d: 0x76, 0x12e: 0x77, 0x12f: 0x78, + 0x130: 0x74, 0x131: 0x79, 0x132: 0x7a, 0x133: 0x7b, 0x134: 0x7c, 0x135: 0x7d, 0x137: 0x7e, + 0x138: 0x7f, 0x139: 0x80, 0x13a: 0x81, 0x13b: 0x82, 0x13c: 0x83, 0x13d: 0x84, 0x13e: 0x85, 0x13f: 0x86, + // Block 0x5, offset 0x140 + 0x140: 0x87, 0x142: 0x88, 0x143: 0x89, 0x144: 0x8a, 0x145: 0x8b, 0x146: 0x8c, 0x147: 0x8d, + 0x14d: 0x8e, + 0x15c: 0x8f, 0x15f: 0x90, + 0x162: 0x91, 0x164: 0x92, + 0x168: 0x93, 0x169: 0x94, 0x16a: 0x95, 0x16b: 0x96, 0x16c: 0x0f, 0x16d: 0x97, 0x16e: 0x98, 0x16f: 0x99, + 0x170: 0x9a, 0x173: 0x9b, 0x174: 0x9c, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12, + 0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a, + // Block 0x6, offset 0x180 + 0x180: 0x9d, 0x181: 0x9e, 0x182: 0x9f, 0x183: 0xa0, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0xa1, 0x187: 0xa2, + 0x188: 0xa3, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0xa4, 0x18c: 0xa5, + 0x191: 0x1f, 0x192: 0x20, 0x193: 0xa6, + 0x1a8: 0xa7, 0x1a9: 0xa8, 0x1ab: 0xa9, + 0x1b1: 0xaa, 0x1b3: 0xab, 0x1b5: 0xac, 0x1b7: 0xad, + 0x1ba: 0xae, 0x1bb: 0xaf, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xb0, + // Block 0x7, offset 0x1c0 + 0x1c0: 0xb1, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xb2, 0x1c5: 0x27, 0x1c6: 0x28, + 0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30, + // Block 0x8, offset 0x200 + 0x219: 0xb3, 0x21a: 0xb4, 0x21b: 0xb5, 0x21d: 0xb6, 0x21f: 0xb7, + 0x220: 0xb8, 0x223: 0xb9, 0x224: 0xba, 0x225: 0xbb, 0x226: 0xbc, 0x227: 0xbd, + 0x22a: 0xbe, 0x22b: 0xbf, 0x22d: 0xc0, 0x22f: 0xc1, + 0x230: 0xc2, 0x231: 0xc3, 0x232: 0xc4, 0x233: 0xc5, 0x234: 0xc6, 0x235: 0xc7, 0x236: 0xc8, 0x237: 0xc2, + 0x238: 0xc3, 0x239: 0xc4, 0x23a: 0xc5, 0x23b: 0xc6, 0x23c: 0xc7, 0x23d: 0xc8, 0x23e: 0xc2, 0x23f: 0xc3, + // Block 0x9, offset 0x240 + 0x240: 0xc4, 0x241: 0xc5, 0x242: 0xc6, 0x243: 0xc7, 0x244: 0xc8, 0x245: 0xc2, 0x246: 0xc3, 0x247: 0xc4, + 0x248: 0xc5, 0x249: 0xc6, 0x24a: 0xc7, 0x24b: 0xc8, 0x24c: 0xc2, 0x24d: 0xc3, 0x24e: 0xc4, 0x24f: 0xc5, + 0x250: 0xc6, 0x251: 0xc7, 0x252: 0xc8, 0x253: 0xc2, 0x254: 0xc3, 0x255: 0xc4, 0x256: 0xc5, 0x257: 0xc6, + 0x258: 0xc7, 0x259: 0xc8, 0x25a: 0xc2, 0x25b: 0xc3, 0x25c: 0xc4, 0x25d: 0xc5, 0x25e: 0xc6, 0x25f: 0xc7, + 0x260: 0xc8, 0x261: 0xc2, 0x262: 0xc3, 0x263: 0xc4, 0x264: 0xc5, 0x265: 0xc6, 0x266: 0xc7, 0x267: 0xc8, + 0x268: 0xc2, 0x269: 0xc3, 0x26a: 0xc4, 0x26b: 0xc5, 0x26c: 0xc6, 0x26d: 0xc7, 0x26e: 0xc8, 0x26f: 0xc2, + 0x270: 0xc3, 0x271: 0xc4, 0x272: 0xc5, 0x273: 0xc6, 0x274: 0xc7, 0x275: 0xc8, 0x276: 0xc2, 0x277: 0xc3, + 0x278: 0xc4, 0x279: 0xc5, 0x27a: 0xc6, 0x27b: 0xc7, 0x27c: 0xc8, 0x27d: 0xc2, 0x27e: 0xc3, 0x27f: 0xc4, + // Block 0xa, offset 0x280 + 0x280: 0xc5, 0x281: 0xc6, 0x282: 0xc7, 0x283: 0xc8, 0x284: 0xc2, 0x285: 0xc3, 0x286: 0xc4, 0x287: 0xc5, + 0x288: 0xc6, 0x289: 0xc7, 0x28a: 0xc8, 0x28b: 0xc2, 0x28c: 0xc3, 0x28d: 0xc4, 0x28e: 0xc5, 0x28f: 0xc6, + 0x290: 0xc7, 0x291: 0xc8, 0x292: 0xc2, 0x293: 0xc3, 0x294: 0xc4, 0x295: 0xc5, 0x296: 0xc6, 0x297: 0xc7, + 0x298: 0xc8, 0x299: 0xc2, 0x29a: 0xc3, 0x29b: 0xc4, 0x29c: 0xc5, 0x29d: 0xc6, 0x29e: 0xc7, 0x29f: 0xc8, + 0x2a0: 0xc2, 0x2a1: 0xc3, 0x2a2: 0xc4, 0x2a3: 0xc5, 0x2a4: 0xc6, 0x2a5: 0xc7, 0x2a6: 0xc8, 0x2a7: 0xc2, + 0x2a8: 0xc3, 0x2a9: 0xc4, 0x2aa: 0xc5, 0x2ab: 0xc6, 0x2ac: 0xc7, 0x2ad: 0xc8, 0x2ae: 0xc2, 0x2af: 0xc3, + 0x2b0: 0xc4, 0x2b1: 0xc5, 0x2b2: 0xc6, 0x2b3: 0xc7, 0x2b4: 0xc8, 0x2b5: 0xc2, 0x2b6: 0xc3, 0x2b7: 0xc4, + 0x2b8: 0xc5, 0x2b9: 0xc6, 0x2ba: 0xc7, 0x2bb: 0xc8, 0x2bc: 0xc2, 0x2bd: 0xc3, 0x2be: 0xc4, 0x2bf: 0xc5, + // Block 0xb, offset 0x2c0 + 0x2c0: 0xc6, 0x2c1: 0xc7, 0x2c2: 0xc8, 0x2c3: 0xc2, 0x2c4: 0xc3, 0x2c5: 0xc4, 0x2c6: 0xc5, 0x2c7: 0xc6, + 0x2c8: 0xc7, 0x2c9: 0xc8, 0x2ca: 0xc2, 0x2cb: 0xc3, 0x2cc: 0xc4, 0x2cd: 0xc5, 0x2ce: 0xc6, 0x2cf: 0xc7, + 0x2d0: 0xc8, 0x2d1: 0xc2, 0x2d2: 0xc3, 0x2d3: 0xc4, 0x2d4: 0xc5, 0x2d5: 0xc6, 0x2d6: 0xc7, 0x2d7: 0xc8, + 0x2d8: 0xc2, 0x2d9: 0xc3, 0x2da: 0xc4, 0x2db: 0xc5, 0x2dc: 0xc6, 0x2dd: 0xc7, 0x2de: 0xc9, + // Block 0xc, offset 0x300 + 0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34, + 0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c, + 0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44, + 0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xca, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b, + // Block 0xd, offset 0x340 + 0x347: 0xcb, + 0x34b: 0xcc, 0x34d: 0xcd, + 0x35e: 0x4c, + 0x368: 0xce, 0x36b: 0xcf, + 0x374: 0xd0, + 0x37a: 0xd1, 0x37b: 0xd2, 0x37d: 0xd3, 0x37e: 0xd4, + // Block 0xe, offset 0x380 + 0x381: 0xd5, 0x382: 0xd6, 0x384: 0xd7, 0x385: 0xbc, 0x387: 0xd8, + 0x388: 0xd9, 0x38b: 0xda, 0x38c: 0xdb, 0x38d: 0xdc, + 0x391: 0xdd, 0x392: 0xde, 0x393: 0xdf, 0x396: 0xe0, 0x397: 0xe1, + 0x398: 0xe2, 0x39a: 0xe3, 0x39c: 0xe4, + 0x3a0: 0xe5, 0x3a4: 0xe6, 0x3a5: 0xe7, 0x3a7: 0xe8, + 0x3a8: 0xe9, 0x3a9: 0xea, 0x3aa: 0xeb, + 0x3b0: 0xe2, 0x3b5: 0xec, 0x3b6: 0xed, + 0x3bd: 0xee, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xef, 0x3ec: 0xf0, + 0x3ff: 0xf1, + // Block 0x10, offset 0x400 + 0x432: 0xf2, + // Block 0x11, offset 0x440 + 0x445: 0xf3, 0x446: 0xf4, 0x447: 0xf5, + 0x449: 0xf6, + 0x450: 0xf7, 0x451: 0xf8, 0x452: 0xf9, 0x453: 0xfa, 0x454: 0xfb, 0x455: 0xfc, 0x456: 0xfd, 0x457: 0xfe, + 0x458: 0xff, 0x459: 0x100, 0x45a: 0x4d, 0x45b: 0x101, 0x45c: 0x102, 0x45d: 0x103, 0x45e: 0x104, 0x45f: 0x4e, + // Block 0x12, offset 0x480 + 0x480: 0x4f, 0x481: 0x50, 0x482: 0x105, 0x484: 0xf0, + 0x48a: 0x106, 0x48b: 0x107, + 0x493: 0x108, + 0x4a3: 0x109, 0x4a5: 0x10a, + 0x4b8: 0x51, 0x4b9: 0x52, 0x4ba: 0x53, + // Block 0x13, offset 0x4c0 + 0x4c4: 0x54, 0x4c5: 0x10b, 0x4c6: 0x10c, + 0x4c8: 0x55, 0x4c9: 0x10d, + 0x4ef: 0x10e, + // Block 0x14, offset 0x500 + 0x520: 0x56, 0x521: 0x57, 0x522: 0x58, 0x523: 0x59, 0x524: 0x5a, 0x525: 0x5b, 0x526: 0x5c, 0x527: 0x5d, + 0x528: 0x5e, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfkcSparseOffset: 176 entries, 352 bytes +var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1c, 0x26, 0x36, 0x38, 0x3d, 0x48, 0x57, 0x64, 0x6c, 0x71, 0x76, 0x78, 0x7c, 0x84, 0x8b, 0x8e, 0x96, 0x9a, 0x9e, 0xa0, 0xa2, 0xab, 0xaf, 0xb6, 0xbb, 0xbe, 0xc8, 0xcb, 0xd2, 0xda, 0xde, 0xe0, 0xe4, 0xe8, 0xee, 0xff, 0x10b, 0x10d, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11d, 0x11f, 0x121, 0x124, 0x127, 0x129, 0x12c, 0x12f, 0x133, 0x139, 0x140, 0x149, 0x14b, 0x14e, 0x150, 0x15b, 0x166, 0x174, 0x182, 0x192, 0x1a0, 0x1a7, 0x1ad, 0x1bc, 0x1c0, 0x1c2, 0x1c6, 0x1c8, 0x1cb, 0x1cd, 0x1d0, 0x1d2, 0x1d5, 0x1d7, 0x1d9, 0x1db, 0x1e7, 0x1f1, 0x1fb, 0x1fe, 0x202, 0x204, 0x206, 0x20b, 0x20e, 0x211, 0x213, 0x215, 0x217, 0x219, 0x21f, 0x222, 0x227, 0x229, 0x230, 0x236, 0x23c, 0x244, 0x24a, 0x250, 0x256, 0x25a, 0x25c, 0x25e, 0x260, 0x262, 0x268, 0x26b, 0x26d, 0x26f, 0x271, 0x277, 0x27b, 0x27f, 0x287, 0x28e, 0x291, 0x294, 0x296, 0x299, 0x2a1, 0x2a5, 0x2ac, 0x2af, 0x2b5, 0x2b7, 0x2b9, 0x2bc, 0x2be, 0x2c1, 0x2c6, 0x2c8, 0x2ca, 0x2cc, 0x2ce, 0x2d0, 0x2d3, 0x2d5, 0x2d7, 0x2d9, 0x2db, 0x2dd, 0x2df, 0x2ec, 0x2f6, 0x2f8, 0x2fa, 0x2fe, 0x303, 0x30f, 0x314, 0x31d, 0x323, 0x328, 0x32c, 0x331, 0x335, 0x345, 0x353, 0x361, 0x36f, 0x371, 0x373, 0x375, 0x379, 0x37b, 0x37e, 0x389, 0x38b, 0x395} + +// nfkcSparseValues: 919 entries, 3676 bytes +var nfkcSparseValues = [919]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0002, lo: 0x0d}, + {value: 0x0001, lo: 0xa0, hi: 0xa0}, + {value: 0x43b9, lo: 0xa8, hi: 0xa8}, + {value: 0x0083, lo: 0xaa, hi: 0xaa}, + {value: 0x43a5, lo: 0xaf, hi: 0xaf}, + {value: 0x0025, lo: 0xb2, hi: 0xb3}, + {value: 0x439b, lo: 0xb4, hi: 0xb4}, + {value: 0x0260, lo: 0xb5, hi: 0xb5}, + {value: 0x43d2, lo: 0xb8, hi: 0xb8}, + {value: 0x0023, lo: 0xb9, hi: 0xb9}, + {value: 0x009f, lo: 0xba, hi: 0xba}, + {value: 0x234c, lo: 0xbc, hi: 0xbc}, + {value: 0x2340, lo: 0xbd, hi: 0xbd}, + {value: 0x23e2, lo: 0xbe, hi: 0xbe}, + // Block 0x1, offset 0xe + {value: 0x0091, lo: 0x03}, + {value: 0x4823, lo: 0xa0, hi: 0xa1}, + {value: 0x4855, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x12 + {value: 0x0004, lo: 0x09}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x0091, lo: 0xb0, hi: 0xb0}, + {value: 0x0140, lo: 0xb1, hi: 0xb1}, + {value: 0x0095, lo: 0xb2, hi: 0xb2}, + {value: 0x00a5, lo: 0xb3, hi: 0xb3}, + {value: 0x0179, lo: 0xb4, hi: 0xb4}, + {value: 0x017f, lo: 0xb5, hi: 0xb5}, + {value: 0x018b, lo: 0xb6, hi: 0xb6}, + {value: 0x00af, lo: 0xb7, hi: 0xb8}, + // Block 0x3, offset 0x1c + {value: 0x000a, lo: 0x09}, + {value: 0x43af, lo: 0x98, hi: 0x98}, + {value: 0x43b4, lo: 0x99, hi: 0x9a}, + {value: 0x43d7, lo: 0x9b, hi: 0x9b}, + {value: 0x43a0, lo: 0x9c, hi: 0x9c}, + {value: 0x43c3, lo: 0x9d, hi: 0x9d}, + {value: 0x0137, lo: 0xa0, hi: 0xa0}, + {value: 0x0099, lo: 0xa1, hi: 0xa1}, + {value: 0x00a7, lo: 0xa2, hi: 0xa3}, + {value: 0x01b8, lo: 0xa4, hi: 0xa4}, + // Block 0x4, offset 0x26 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x38e6, lo: 0x90, hi: 0x90}, + {value: 0x38f2, lo: 0x91, hi: 0x91}, + {value: 0x38e0, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3958, lo: 0x97, hi: 0x97}, + {value: 0x3922, lo: 0x9c, hi: 0x9c}, + {value: 0x390a, lo: 0x9d, hi: 0x9d}, + {value: 0x3934, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x395e, lo: 0xb6, hi: 0xb6}, + {value: 0x3964, lo: 0xb7, hi: 0xb7}, + // Block 0x5, offset 0x36 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x83, hi: 0x87}, + // Block 0x6, offset 0x38 + {value: 0x0001, lo: 0x04}, + {value: 0x8114, lo: 0x81, hi: 0x82}, + {value: 0x8133, lo: 0x84, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + {value: 0x810e, lo: 0x87, hi: 0x87}, + // Block 0x7, offset 0x3d + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x97}, + {value: 0x811a, lo: 0x98, hi: 0x98}, + {value: 0x811b, lo: 0x99, hi: 0x99}, + {value: 0x811c, lo: 0x9a, hi: 0x9a}, + {value: 0x3982, lo: 0xa2, hi: 0xa2}, + {value: 0x3988, lo: 0xa3, hi: 0xa3}, + {value: 0x3994, lo: 0xa4, hi: 0xa4}, + {value: 0x398e, lo: 0xa5, hi: 0xa5}, + {value: 0x399a, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x8, offset 0x48 + {value: 0x0000, lo: 0x0e}, + {value: 0x39ac, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x39a0, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x39a6, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8133, lo: 0x96, hi: 0x9c}, + {value: 0x8133, lo: 0x9f, hi: 0xa2}, + {value: 0x812e, lo: 0xa3, hi: 0xa3}, + {value: 0x8133, lo: 0xa4, hi: 0xa4}, + {value: 0x8133, lo: 0xa7, hi: 0xa8}, + {value: 0x812e, lo: 0xaa, hi: 0xaa}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + // Block 0x9, offset 0x57 + {value: 0x0000, lo: 0x0c}, + {value: 0x8120, lo: 0x91, hi: 0x91}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x812e, lo: 0xb1, hi: 0xb1}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb5, hi: 0xb6}, + {value: 0x812e, lo: 0xb7, hi: 0xb9}, + {value: 0x8133, lo: 0xba, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbc}, + {value: 0x8133, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbe, hi: 0xbe}, + {value: 0x8133, lo: 0xbf, hi: 0xbf}, + // Block 0xa, offset 0x64 + {value: 0x0005, lo: 0x07}, + {value: 0x8133, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x812e, lo: 0x82, hi: 0x83}, + {value: 0x812e, lo: 0x84, hi: 0x85}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x812e, lo: 0x88, hi: 0x89}, + {value: 0x8133, lo: 0x8a, hi: 0x8a}, + // Block 0xb, offset 0x6c + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0xab, hi: 0xb1}, + {value: 0x812e, lo: 0xb2, hi: 0xb2}, + {value: 0x8133, lo: 0xb3, hi: 0xb3}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0xc, offset 0x71 + {value: 0x0000, lo: 0x04}, + {value: 0x8133, lo: 0x96, hi: 0x99}, + {value: 0x8133, lo: 0x9b, hi: 0xa3}, + {value: 0x8133, lo: 0xa5, hi: 0xa7}, + {value: 0x8133, lo: 0xa9, hi: 0xad}, + // Block 0xd, offset 0x76 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + // Block 0xe, offset 0x78 + {value: 0x0000, lo: 0x03}, + {value: 0x8133, lo: 0x98, hi: 0x98}, + {value: 0x812e, lo: 0x99, hi: 0x9b}, + {value: 0x8133, lo: 0x9c, hi: 0x9f}, + // Block 0xf, offset 0x7c + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x4019, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x4021, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x4029, lo: 0xb4, hi: 0xb4}, + {value: 0x9903, lo: 0xbc, hi: 0xbc}, + // Block 0x10, offset 0x84 + {value: 0x0008, lo: 0x06}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x91, hi: 0x91}, + {value: 0x812e, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x93, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x94}, + {value: 0x465d, lo: 0x98, hi: 0x9f}, + // Block 0x11, offset 0x8b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x12, offset 0x8e + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2dd5, lo: 0x8b, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x469d, lo: 0x9c, hi: 0x9d}, + {value: 0x46ad, lo: 0x9f, hi: 0x9f}, + {value: 0x8133, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x96 + {value: 0x0000, lo: 0x03}, + {value: 0x46d5, lo: 0xb3, hi: 0xb3}, + {value: 0x46dd, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x14, offset 0x9a + {value: 0x0008, lo: 0x03}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x46b5, lo: 0x99, hi: 0x9b}, + {value: 0x46cd, lo: 0x9e, hi: 0x9e}, + // Block 0x15, offset 0x9e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + // Block 0x16, offset 0xa0 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + // Block 0x17, offset 0xa2 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ded, lo: 0x88, hi: 0x88}, + {value: 0x2de5, lo: 0x8b, hi: 0x8b}, + {value: 0x2df5, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x46e5, lo: 0x9c, hi: 0x9c}, + {value: 0x46ed, lo: 0x9d, hi: 0x9d}, + // Block 0x18, offset 0xab + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2dfd, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x19, offset 0xaf + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e05, lo: 0x8a, hi: 0x8a}, + {value: 0x2e15, lo: 0x8b, hi: 0x8b}, + {value: 0x2e0d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1a, offset 0xb6 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x4031, lo: 0x88, hi: 0x88}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x8121, lo: 0x95, hi: 0x96}, + // Block 0x1b, offset 0xbb + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1c, offset 0xbe + {value: 0x0000, lo: 0x09}, + {value: 0x2e1d, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2e25, lo: 0x87, hi: 0x87}, + {value: 0x2e2d, lo: 0x88, hi: 0x88}, + {value: 0x3091, lo: 0x8a, hi: 0x8a}, + {value: 0x2f19, lo: 0x8b, hi: 0x8b}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1d, offset 0xc8 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xcb + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2e35, lo: 0x8a, hi: 0x8a}, + {value: 0x2e45, lo: 0x8b, hi: 0x8b}, + {value: 0x2e3d, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1f, offset 0xd2 + {value: 0x6ab3, lo: 0x07}, + {value: 0x9905, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4039, lo: 0x9a, hi: 0x9a}, + {value: 0x3099, lo: 0x9c, hi: 0x9c}, + {value: 0x2f24, lo: 0x9d, hi: 0x9d}, + {value: 0x2e4d, lo: 0x9e, hi: 0x9f}, + // Block 0x20, offset 0xda + {value: 0x0000, lo: 0x03}, + {value: 0x2751, lo: 0xb3, hi: 0xb3}, + {value: 0x8123, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x21, offset 0xde + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0x88, hi: 0x8b}, + // Block 0x22, offset 0xe0 + {value: 0x0000, lo: 0x03}, + {value: 0x2766, lo: 0xb3, hi: 0xb3}, + {value: 0x8125, lo: 0xb8, hi: 0xb9}, + {value: 0x8105, lo: 0xba, hi: 0xba}, + // Block 0x23, offset 0xe4 + {value: 0x0000, lo: 0x03}, + {value: 0x8126, lo: 0x88, hi: 0x8b}, + {value: 0x2758, lo: 0x9c, hi: 0x9c}, + {value: 0x275f, lo: 0x9d, hi: 0x9d}, + // Block 0x24, offset 0xe8 + {value: 0x0000, lo: 0x05}, + {value: 0x03fe, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x98, hi: 0x99}, + {value: 0x812e, lo: 0xb5, hi: 0xb5}, + {value: 0x812e, lo: 0xb7, hi: 0xb7}, + {value: 0x812c, lo: 0xb9, hi: 0xb9}, + // Block 0x25, offset 0xee + {value: 0x0000, lo: 0x10}, + {value: 0x2774, lo: 0x83, hi: 0x83}, + {value: 0x277b, lo: 0x8d, hi: 0x8d}, + {value: 0x2782, lo: 0x92, hi: 0x92}, + {value: 0x2789, lo: 0x97, hi: 0x97}, + {value: 0x2790, lo: 0x9c, hi: 0x9c}, + {value: 0x276d, lo: 0xa9, hi: 0xa9}, + {value: 0x8127, lo: 0xb1, hi: 0xb1}, + {value: 0x8128, lo: 0xb2, hi: 0xb2}, + {value: 0x4bc5, lo: 0xb3, hi: 0xb3}, + {value: 0x8129, lo: 0xb4, hi: 0xb4}, + {value: 0x4bce, lo: 0xb5, hi: 0xb5}, + {value: 0x46f5, lo: 0xb6, hi: 0xb6}, + {value: 0x4735, lo: 0xb7, hi: 0xb7}, + {value: 0x46fd, lo: 0xb8, hi: 0xb8}, + {value: 0x4740, lo: 0xb9, hi: 0xb9}, + {value: 0x8128, lo: 0xba, hi: 0xbd}, + // Block 0x26, offset 0xff + {value: 0x0000, lo: 0x0b}, + {value: 0x8128, lo: 0x80, hi: 0x80}, + {value: 0x4bd7, lo: 0x81, hi: 0x81}, + {value: 0x8133, lo: 0x82, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0x86, hi: 0x87}, + {value: 0x279e, lo: 0x93, hi: 0x93}, + {value: 0x27a5, lo: 0x9d, hi: 0x9d}, + {value: 0x27ac, lo: 0xa2, hi: 0xa2}, + {value: 0x27b3, lo: 0xa7, hi: 0xa7}, + {value: 0x27ba, lo: 0xac, hi: 0xac}, + {value: 0x2797, lo: 0xb9, hi: 0xb9}, + // Block 0x27, offset 0x10b + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x86, hi: 0x86}, + // Block 0x28, offset 0x10d + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2e55, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x29, offset 0x113 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + // Block 0x2a, offset 0x115 + {value: 0x0000, lo: 0x01}, + {value: 0x0402, lo: 0xbc, hi: 0xbc}, + // Block 0x2b, offset 0x117 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2c, offset 0x119 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2d, offset 0x11b + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2e, offset 0x11d + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2f, offset 0x11f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x9d, hi: 0x9f}, + // Block 0x30, offset 0x121 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x94, hi: 0x95}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x31, offset 0x124 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x92, hi: 0x92}, + {value: 0x8133, lo: 0x9d, hi: 0x9d}, + // Block 0x32, offset 0x127 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + // Block 0x33, offset 0x129 + {value: 0x0004, lo: 0x02}, + {value: 0x812f, lo: 0xb9, hi: 0xba}, + {value: 0x812e, lo: 0xbb, hi: 0xbb}, + // Block 0x34, offset 0x12c + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x97, hi: 0x97}, + {value: 0x812e, lo: 0x98, hi: 0x98}, + // Block 0x35, offset 0x12f + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + {value: 0x8133, lo: 0xb5, hi: 0xbc}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x36, offset 0x133 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + {value: 0x812e, lo: 0xb5, hi: 0xba}, + {value: 0x8133, lo: 0xbb, hi: 0xbc}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + {value: 0x812e, lo: 0xbf, hi: 0xbf}, + // Block 0x37, offset 0x139 + {value: 0x0000, lo: 0x06}, + {value: 0x812e, lo: 0x80, hi: 0x80}, + {value: 0x8133, lo: 0x81, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8a}, + {value: 0x8133, lo: 0x8b, hi: 0x8e}, + // Block 0x38, offset 0x140 + {value: 0x0000, lo: 0x08}, + {value: 0x2e9d, lo: 0x80, hi: 0x80}, + {value: 0x2ea5, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2ead, lo: 0x83, hi: 0x83}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xab, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xac}, + {value: 0x8133, lo: 0xad, hi: 0xb3}, + // Block 0x39, offset 0x149 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xaa, hi: 0xab}, + // Block 0x3a, offset 0x14b + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xa6, hi: 0xa6}, + {value: 0x8105, lo: 0xb2, hi: 0xb3}, + // Block 0x3b, offset 0x14e + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x3c, offset 0x150 + {value: 0x0000, lo: 0x0a}, + {value: 0x8133, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812e, lo: 0x95, hi: 0x99}, + {value: 0x8133, lo: 0x9a, hi: 0x9b}, + {value: 0x812e, lo: 0x9c, hi: 0x9f}, + {value: 0x8133, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x8133, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb8, hi: 0xb9}, + // Block 0x3d, offset 0x15b + {value: 0x0002, lo: 0x0a}, + {value: 0x0043, lo: 0xac, hi: 0xac}, + {value: 0x00d1, lo: 0xad, hi: 0xad}, + {value: 0x0045, lo: 0xae, hi: 0xae}, + {value: 0x0049, lo: 0xb0, hi: 0xb1}, + {value: 0x00ec, lo: 0xb2, hi: 0xb2}, + {value: 0x004f, lo: 0xb3, hi: 0xba}, + {value: 0x005f, lo: 0xbc, hi: 0xbc}, + {value: 0x00fe, lo: 0xbd, hi: 0xbd}, + {value: 0x0061, lo: 0xbe, hi: 0xbe}, + {value: 0x0065, lo: 0xbf, hi: 0xbf}, + // Block 0x3e, offset 0x166 + {value: 0x0000, lo: 0x0d}, + {value: 0x0001, lo: 0x80, hi: 0x8a}, + {value: 0x0532, lo: 0x91, hi: 0x91}, + {value: 0x43dc, lo: 0x97, hi: 0x97}, + {value: 0x001d, lo: 0xa4, hi: 0xa4}, + {value: 0x19a0, lo: 0xa5, hi: 0xa5}, + {value: 0x1c8c, lo: 0xa6, hi: 0xa6}, + {value: 0x0001, lo: 0xaf, hi: 0xaf}, + {value: 0x27c1, lo: 0xb3, hi: 0xb3}, + {value: 0x2935, lo: 0xb4, hi: 0xb4}, + {value: 0x27c8, lo: 0xb6, hi: 0xb6}, + {value: 0x293f, lo: 0xb7, hi: 0xb7}, + {value: 0x199a, lo: 0xbc, hi: 0xbc}, + {value: 0x43aa, lo: 0xbe, hi: 0xbe}, + // Block 0x3f, offset 0x174 + {value: 0x0002, lo: 0x0d}, + {value: 0x1a60, lo: 0x87, hi: 0x87}, + {value: 0x1a5d, lo: 0x88, hi: 0x88}, + {value: 0x199d, lo: 0x89, hi: 0x89}, + {value: 0x2ac5, lo: 0x97, hi: 0x97}, + {value: 0x0001, lo: 0x9f, hi: 0x9f}, + {value: 0x0021, lo: 0xb0, hi: 0xb0}, + {value: 0x0093, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb4, hi: 0xb9}, + {value: 0x0017, lo: 0xba, hi: 0xba}, + {value: 0x055e, lo: 0xbb, hi: 0xbb}, + {value: 0x003b, lo: 0xbc, hi: 0xbc}, + {value: 0x0011, lo: 0xbd, hi: 0xbe}, + {value: 0x009d, lo: 0xbf, hi: 0xbf}, + // Block 0x40, offset 0x182 + {value: 0x0002, lo: 0x0f}, + {value: 0x0021, lo: 0x80, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8a}, + {value: 0x055e, lo: 0x8b, hi: 0x8b}, + {value: 0x003b, lo: 0x8c, hi: 0x8c}, + {value: 0x0011, lo: 0x8d, hi: 0x8e}, + {value: 0x0083, lo: 0x90, hi: 0x90}, + {value: 0x008b, lo: 0x91, hi: 0x91}, + {value: 0x009f, lo: 0x92, hi: 0x92}, + {value: 0x00b1, lo: 0x93, hi: 0x93}, + {value: 0x011f, lo: 0x94, hi: 0x94}, + {value: 0x0091, lo: 0x95, hi: 0x95}, + {value: 0x0097, lo: 0x96, hi: 0x99}, + {value: 0x00a1, lo: 0x9a, hi: 0x9a}, + {value: 0x00a7, lo: 0x9b, hi: 0x9c}, + {value: 0x1ac9, lo: 0xa8, hi: 0xa8}, + // Block 0x41, offset 0x192 + {value: 0x0000, lo: 0x0d}, + {value: 0x8133, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8133, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8133, lo: 0x9b, hi: 0x9c}, + {value: 0x8133, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8133, lo: 0xa7, hi: 0xa7}, + {value: 0x812e, lo: 0xa8, hi: 0xa8}, + {value: 0x8133, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812e, lo: 0xac, hi: 0xaf}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + // Block 0x42, offset 0x1a0 + {value: 0x0007, lo: 0x06}, + {value: 0x22b0, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3cfa, lo: 0x9a, hi: 0x9b}, + {value: 0x3d08, lo: 0xae, hi: 0xae}, + // Block 0x43, offset 0x1a7 + {value: 0x000e, lo: 0x05}, + {value: 0x3d0f, lo: 0x8d, hi: 0x8e}, + {value: 0x3d16, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x44, offset 0x1ad + {value: 0x017a, lo: 0x0e}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3d24, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3d2b, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3d32, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3d39, lo: 0xa4, hi: 0xa4}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x3d40, lo: 0xa6, hi: 0xa6}, + {value: 0x27cf, lo: 0xac, hi: 0xad}, + {value: 0x27d6, lo: 0xaf, hi: 0xaf}, + {value: 0x2953, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x45, offset 0x1bc + {value: 0x0007, lo: 0x03}, + {value: 0x3da9, lo: 0xa0, hi: 0xa1}, + {value: 0x3dd3, lo: 0xa2, hi: 0xa3}, + {value: 0x3dfd, lo: 0xaa, hi: 0xad}, + // Block 0x46, offset 0x1c0 + {value: 0x0004, lo: 0x01}, + {value: 0x0586, lo: 0xa9, hi: 0xaa}, + // Block 0x47, offset 0x1c2 + {value: 0x0002, lo: 0x03}, + {value: 0x0057, lo: 0x80, hi: 0x8f}, + {value: 0x0083, lo: 0x90, hi: 0xa9}, + {value: 0x0021, lo: 0xaa, hi: 0xaa}, + // Block 0x48, offset 0x1c6 + {value: 0x0000, lo: 0x01}, + {value: 0x2ad2, lo: 0x8c, hi: 0x8c}, + // Block 0x49, offset 0x1c8 + {value: 0x0266, lo: 0x02}, + {value: 0x1cbc, lo: 0xb4, hi: 0xb4}, + {value: 0x1a5a, lo: 0xb5, hi: 0xb6}, + // Block 0x4a, offset 0x1cb + {value: 0x0000, lo: 0x01}, + {value: 0x461e, lo: 0x9c, hi: 0x9c}, + // Block 0x4b, offset 0x1cd + {value: 0x0000, lo: 0x02}, + {value: 0x0095, lo: 0xbc, hi: 0xbc}, + {value: 0x006d, lo: 0xbd, hi: 0xbd}, + // Block 0x4c, offset 0x1d0 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xaf, hi: 0xb1}, + // Block 0x4d, offset 0x1d2 + {value: 0x0000, lo: 0x02}, + {value: 0x057a, lo: 0xaf, hi: 0xaf}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x4e, offset 0x1d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa0, hi: 0xbf}, + // Block 0x4f, offset 0x1d7 + {value: 0x0000, lo: 0x01}, + {value: 0x0ebe, lo: 0x9f, hi: 0x9f}, + // Block 0x50, offset 0x1d9 + {value: 0x0000, lo: 0x01}, + {value: 0x172a, lo: 0xb3, hi: 0xb3}, + // Block 0x51, offset 0x1db + {value: 0x0004, lo: 0x0b}, + {value: 0x1692, lo: 0x80, hi: 0x82}, + {value: 0x16aa, lo: 0x83, hi: 0x83}, + {value: 0x16c2, lo: 0x84, hi: 0x85}, + {value: 0x16d2, lo: 0x86, hi: 0x89}, + {value: 0x16e6, lo: 0x8a, hi: 0x8c}, + {value: 0x16fa, lo: 0x8d, hi: 0x8d}, + {value: 0x1702, lo: 0x8e, hi: 0x8e}, + {value: 0x170a, lo: 0x8f, hi: 0x90}, + {value: 0x1716, lo: 0x91, hi: 0x93}, + {value: 0x1726, lo: 0x94, hi: 0x94}, + {value: 0x172e, lo: 0x95, hi: 0x95}, + // Block 0x52, offset 0x1e7 + {value: 0x0004, lo: 0x09}, + {value: 0x0001, lo: 0x80, hi: 0x80}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x8134, lo: 0xac, hi: 0xac}, + {value: 0x812f, lo: 0xad, hi: 0xad}, + {value: 0x8130, lo: 0xae, hi: 0xae}, + {value: 0x8130, lo: 0xaf, hi: 0xaf}, + {value: 0x05ae, lo: 0xb6, hi: 0xb6}, + {value: 0x0982, lo: 0xb8, hi: 0xba}, + // Block 0x53, offset 0x1f1 + {value: 0x0006, lo: 0x09}, + {value: 0x0406, lo: 0xb1, hi: 0xb1}, + {value: 0x040a, lo: 0xb2, hi: 0xb2}, + {value: 0x4b7c, lo: 0xb3, hi: 0xb3}, + {value: 0x040e, lo: 0xb4, hi: 0xb4}, + {value: 0x4b82, lo: 0xb5, hi: 0xb6}, + {value: 0x0412, lo: 0xb7, hi: 0xb7}, + {value: 0x0416, lo: 0xb8, hi: 0xb8}, + {value: 0x041a, lo: 0xb9, hi: 0xb9}, + {value: 0x4b8e, lo: 0xba, hi: 0xbf}, + // Block 0x54, offset 0x1fb + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + {value: 0x8133, lo: 0xb4, hi: 0xbd}, + // Block 0x55, offset 0x1fe + {value: 0x0000, lo: 0x03}, + {value: 0x02d8, lo: 0x9c, hi: 0x9c}, + {value: 0x02de, lo: 0x9d, hi: 0x9d}, + {value: 0x8133, lo: 0x9e, hi: 0x9f}, + // Block 0x56, offset 0x202 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb1}, + // Block 0x57, offset 0x204 + {value: 0x0000, lo: 0x01}, + {value: 0x173e, lo: 0xb0, hi: 0xb0}, + // Block 0x58, offset 0x206 + {value: 0x0006, lo: 0x04}, + {value: 0x0047, lo: 0xb2, hi: 0xb3}, + {value: 0x0063, lo: 0xb4, hi: 0xb4}, + {value: 0x00dd, lo: 0xb8, hi: 0xb8}, + {value: 0x00e9, lo: 0xb9, hi: 0xb9}, + // Block 0x59, offset 0x20b + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xac, hi: 0xac}, + // Block 0x5a, offset 0x20e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x84, hi: 0x84}, + {value: 0x8133, lo: 0xa0, hi: 0xb1}, + // Block 0x5b, offset 0x211 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xab, hi: 0xad}, + // Block 0x5c, offset 0x213 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x93, hi: 0x93}, + // Block 0x5d, offset 0x215 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0xb3, hi: 0xb3}, + // Block 0x5e, offset 0x217 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + // Block 0x5f, offset 0x219 + {value: 0x0000, lo: 0x05}, + {value: 0x8133, lo: 0xb0, hi: 0xb0}, + {value: 0x8133, lo: 0xb2, hi: 0xb3}, + {value: 0x812e, lo: 0xb4, hi: 0xb4}, + {value: 0x8133, lo: 0xb7, hi: 0xb8}, + {value: 0x8133, lo: 0xbe, hi: 0xbf}, + // Block 0x60, offset 0x21f + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x81, hi: 0x81}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + // Block 0x61, offset 0x222 + {value: 0x000c, lo: 0x04}, + {value: 0x173a, lo: 0x9c, hi: 0x9d}, + {value: 0x014f, lo: 0x9e, hi: 0x9e}, + {value: 0x174a, lo: 0x9f, hi: 0x9f}, + {value: 0x01a6, lo: 0xa9, hi: 0xa9}, + // Block 0x62, offset 0x227 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xad, hi: 0xad}, + // Block 0x63, offset 0x229 + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x64, offset 0x230 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x65, offset 0x236 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x66, offset 0x23c + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x67, offset 0x244 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x68, offset 0x24a + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x69, offset 0x250 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x6a, offset 0x256 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x6b, offset 0x25a + {value: 0x0002, lo: 0x01}, + {value: 0x0003, lo: 0x81, hi: 0xbf}, + // Block 0x6c, offset 0x25c + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbd}, + // Block 0x6d, offset 0x25e + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xa0, hi: 0xa0}, + // Block 0x6e, offset 0x260 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb6, hi: 0xba}, + // Block 0x6f, offset 0x262 + {value: 0x002d, lo: 0x05}, + {value: 0x812e, lo: 0x8d, hi: 0x8d}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + {value: 0x8133, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x70, offset 0x268 + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0xa5, hi: 0xa5}, + {value: 0x812e, lo: 0xa6, hi: 0xa6}, + // Block 0x71, offset 0x26b + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xa4, hi: 0xa7}, + // Block 0x72, offset 0x26d + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xab, hi: 0xac}, + // Block 0x73, offset 0x26f + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0xbd, hi: 0xbf}, + // Block 0x74, offset 0x271 + {value: 0x0000, lo: 0x05}, + {value: 0x812e, lo: 0x86, hi: 0x87}, + {value: 0x8133, lo: 0x88, hi: 0x8a}, + {value: 0x812e, lo: 0x8b, hi: 0x8b}, + {value: 0x8133, lo: 0x8c, hi: 0x8c}, + {value: 0x812e, lo: 0x8d, hi: 0x90}, + // Block 0x75, offset 0x277 + {value: 0x0005, lo: 0x03}, + {value: 0x8133, lo: 0x82, hi: 0x82}, + {value: 0x812e, lo: 0x83, hi: 0x84}, + {value: 0x812e, lo: 0x85, hi: 0x85}, + // Block 0x76, offset 0x27b + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x86, hi: 0x86}, + {value: 0x8105, lo: 0xb0, hi: 0xb0}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x77, offset 0x27f + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4379, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4383, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x438d, lo: 0xab, hi: 0xab}, + {value: 0x8105, lo: 0xb9, hi: 0xba}, + // Block 0x78, offset 0x287 + {value: 0x0000, lo: 0x06}, + {value: 0x8133, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2eb5, lo: 0xae, hi: 0xae}, + {value: 0x2ebf, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8105, lo: 0xb3, hi: 0xb4}, + // Block 0x79, offset 0x28e + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x80, hi: 0x80}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0x7a, offset 0x291 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb5, hi: 0xb5}, + {value: 0x8103, lo: 0xb6, hi: 0xb6}, + // Block 0x7b, offset 0x294 + {value: 0x0002, lo: 0x01}, + {value: 0x8103, lo: 0xa9, hi: 0xaa}, + // Block 0x7c, offset 0x296 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x7d, offset 0x299 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2ec9, lo: 0x8b, hi: 0x8b}, + {value: 0x2ed3, lo: 0x8c, hi: 0x8c}, + {value: 0x8105, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8133, lo: 0xa6, hi: 0xac}, + {value: 0x8133, lo: 0xb0, hi: 0xb4}, + // Block 0x7e, offset 0x2a1 + {value: 0x0000, lo: 0x03}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x86, hi: 0x86}, + {value: 0x8133, lo: 0x9e, hi: 0x9e}, + // Block 0x7f, offset 0x2a5 + {value: 0x6a23, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2ee7, lo: 0xbb, hi: 0xbb}, + {value: 0x2edd, lo: 0xbc, hi: 0xbd}, + {value: 0x2ef1, lo: 0xbe, hi: 0xbe}, + // Block 0x80, offset 0x2ac + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0x82, hi: 0x82}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x81, offset 0x2af + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2efb, lo: 0xba, hi: 0xba}, + {value: 0x2f05, lo: 0xbb, hi: 0xbb}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x82, offset 0x2b5 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x80, hi: 0x80}, + // Block 0x83, offset 0x2b7 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xbf, hi: 0xbf}, + // Block 0x84, offset 0x2b9 + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb6, hi: 0xb6}, + {value: 0x8103, lo: 0xb7, hi: 0xb7}, + // Block 0x85, offset 0x2bc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xab, hi: 0xab}, + // Block 0x86, offset 0x2be + {value: 0x0000, lo: 0x02}, + {value: 0x8105, lo: 0xb9, hi: 0xb9}, + {value: 0x8103, lo: 0xba, hi: 0xba}, + // Block 0x87, offset 0x2c1 + {value: 0x0000, lo: 0x04}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb5, hi: 0xb5}, + {value: 0x2f0f, lo: 0xb8, hi: 0xb8}, + {value: 0x8105, lo: 0xbd, hi: 0xbe}, + // Block 0x88, offset 0x2c6 + {value: 0x0000, lo: 0x01}, + {value: 0x8103, lo: 0x83, hi: 0x83}, + // Block 0x89, offset 0x2c8 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xa0, hi: 0xa0}, + // Block 0x8a, offset 0x2ca + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0xb4, hi: 0xb4}, + // Block 0x8b, offset 0x2cc + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x87, hi: 0x87}, + // Block 0x8c, offset 0x2ce + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x99, hi: 0x99}, + // Block 0x8d, offset 0x2d0 + {value: 0x0000, lo: 0x02}, + {value: 0x8103, lo: 0x82, hi: 0x82}, + {value: 0x8105, lo: 0x84, hi: 0x85}, + // Block 0x8e, offset 0x2d3 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x97, hi: 0x97}, + // Block 0x8f, offset 0x2d5 + {value: 0x0000, lo: 0x01}, + {value: 0x8105, lo: 0x81, hi: 0x82}, + // Block 0x90, offset 0x2d7 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x91, offset 0x2d9 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xb0, hi: 0xb6}, + // Block 0x92, offset 0x2db + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb0, hi: 0xb1}, + // Block 0x93, offset 0x2dd + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x94, offset 0x2df + {value: 0x0000, lo: 0x0c}, + {value: 0x470d, lo: 0x9e, hi: 0x9e}, + {value: 0x4717, lo: 0x9f, hi: 0x9f}, + {value: 0x474b, lo: 0xa0, hi: 0xa0}, + {value: 0x4759, lo: 0xa1, hi: 0xa1}, + {value: 0x4767, lo: 0xa2, hi: 0xa2}, + {value: 0x4775, lo: 0xa3, hi: 0xa3}, + {value: 0x4783, lo: 0xa4, hi: 0xa4}, + {value: 0x812c, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8131, lo: 0xad, hi: 0xad}, + {value: 0x812c, lo: 0xae, hi: 0xb2}, + {value: 0x812e, lo: 0xbb, hi: 0xbf}, + // Block 0x95, offset 0x2ec + {value: 0x0000, lo: 0x09}, + {value: 0x812e, lo: 0x80, hi: 0x82}, + {value: 0x8133, lo: 0x85, hi: 0x89}, + {value: 0x812e, lo: 0x8a, hi: 0x8b}, + {value: 0x8133, lo: 0xaa, hi: 0xad}, + {value: 0x4721, lo: 0xbb, hi: 0xbb}, + {value: 0x472b, lo: 0xbc, hi: 0xbc}, + {value: 0x4791, lo: 0xbd, hi: 0xbd}, + {value: 0x47ad, lo: 0xbe, hi: 0xbe}, + {value: 0x479f, lo: 0xbf, hi: 0xbf}, + // Block 0x96, offset 0x2f6 + {value: 0x0000, lo: 0x01}, + {value: 0x47bb, lo: 0x80, hi: 0x80}, + // Block 0x97, offset 0x2f8 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x82, hi: 0x84}, + // Block 0x98, offset 0x2fa + {value: 0x0002, lo: 0x03}, + {value: 0x0043, lo: 0x80, hi: 0x99}, + {value: 0x0083, lo: 0x9a, hi: 0xb3}, + {value: 0x0043, lo: 0xb4, hi: 0xbf}, + // Block 0x99, offset 0x2fe + {value: 0x0002, lo: 0x04}, + {value: 0x005b, lo: 0x80, hi: 0x8d}, + {value: 0x0083, lo: 0x8e, hi: 0x94}, + {value: 0x0093, lo: 0x96, hi: 0xa7}, + {value: 0x0043, lo: 0xa8, hi: 0xbf}, + // Block 0x9a, offset 0x303 + {value: 0x0002, lo: 0x0b}, + {value: 0x0073, lo: 0x80, hi: 0x81}, + {value: 0x0083, lo: 0x82, hi: 0x9b}, + {value: 0x0043, lo: 0x9c, hi: 0x9c}, + {value: 0x0047, lo: 0x9e, hi: 0x9f}, + {value: 0x004f, lo: 0xa2, hi: 0xa2}, + {value: 0x0055, lo: 0xa5, hi: 0xa6}, + {value: 0x005d, lo: 0xa9, hi: 0xac}, + {value: 0x0067, lo: 0xae, hi: 0xb5}, + {value: 0x0083, lo: 0xb6, hi: 0xb9}, + {value: 0x008d, lo: 0xbb, hi: 0xbb}, + {value: 0x0091, lo: 0xbd, hi: 0xbf}, + // Block 0x9b, offset 0x30f + {value: 0x0002, lo: 0x04}, + {value: 0x0097, lo: 0x80, hi: 0x83}, + {value: 0x00a1, lo: 0x85, hi: 0x8f}, + {value: 0x0043, lo: 0x90, hi: 0xa9}, + {value: 0x0083, lo: 0xaa, hi: 0xbf}, + // Block 0x9c, offset 0x314 + {value: 0x0002, lo: 0x08}, + {value: 0x00af, lo: 0x80, hi: 0x83}, + {value: 0x0043, lo: 0x84, hi: 0x85}, + {value: 0x0049, lo: 0x87, hi: 0x8a}, + {value: 0x0055, lo: 0x8d, hi: 0x94}, + {value: 0x0067, lo: 0x96, hi: 0x9c}, + {value: 0x0083, lo: 0x9e, hi: 0xb7}, + {value: 0x0043, lo: 0xb8, hi: 0xb9}, + {value: 0x0049, lo: 0xbb, hi: 0xbe}, + // Block 0x9d, offset 0x31d + {value: 0x0002, lo: 0x05}, + {value: 0x0053, lo: 0x80, hi: 0x84}, + {value: 0x005f, lo: 0x86, hi: 0x86}, + {value: 0x0067, lo: 0x8a, hi: 0x90}, + {value: 0x0083, lo: 0x92, hi: 0xab}, + {value: 0x0043, lo: 0xac, hi: 0xbf}, + // Block 0x9e, offset 0x323 + {value: 0x0002, lo: 0x04}, + {value: 0x006b, lo: 0x80, hi: 0x85}, + {value: 0x0083, lo: 0x86, hi: 0x9f}, + {value: 0x0043, lo: 0xa0, hi: 0xb9}, + {value: 0x0083, lo: 0xba, hi: 0xbf}, + // Block 0x9f, offset 0x328 + {value: 0x0002, lo: 0x03}, + {value: 0x008f, lo: 0x80, hi: 0x93}, + {value: 0x0043, lo: 0x94, hi: 0xad}, + {value: 0x0083, lo: 0xae, hi: 0xbf}, + // Block 0xa0, offset 0x32c + {value: 0x0002, lo: 0x04}, + {value: 0x00a7, lo: 0x80, hi: 0x87}, + {value: 0x0043, lo: 0x88, hi: 0xa1}, + {value: 0x0083, lo: 0xa2, hi: 0xbb}, + {value: 0x0043, lo: 0xbc, hi: 0xbf}, + // Block 0xa1, offset 0x331 + {value: 0x0002, lo: 0x03}, + {value: 0x004b, lo: 0x80, hi: 0x95}, + {value: 0x0083, lo: 0x96, hi: 0xaf}, + {value: 0x0043, lo: 0xb0, hi: 0xbf}, + // Block 0xa2, offset 0x335 + {value: 0x0003, lo: 0x0f}, + {value: 0x023c, lo: 0x80, hi: 0x80}, + {value: 0x0556, lo: 0x81, hi: 0x81}, + {value: 0x023f, lo: 0x82, hi: 0x9a}, + {value: 0x0552, lo: 0x9b, hi: 0x9b}, + {value: 0x024b, lo: 0x9c, hi: 0x9c}, + {value: 0x0254, lo: 0x9d, hi: 0x9d}, + {value: 0x025a, lo: 0x9e, hi: 0x9e}, + {value: 0x027e, lo: 0x9f, hi: 0x9f}, + {value: 0x026f, lo: 0xa0, hi: 0xa0}, + {value: 0x026c, lo: 0xa1, hi: 0xa1}, + {value: 0x01f7, lo: 0xa2, hi: 0xb2}, + {value: 0x020c, lo: 0xb3, hi: 0xb3}, + {value: 0x022a, lo: 0xb4, hi: 0xba}, + {value: 0x0556, lo: 0xbb, hi: 0xbb}, + {value: 0x023f, lo: 0xbc, hi: 0xbf}, + // Block 0xa3, offset 0x345 + {value: 0x0003, lo: 0x0d}, + {value: 0x024b, lo: 0x80, hi: 0x94}, + {value: 0x0552, lo: 0x95, hi: 0x95}, + {value: 0x024b, lo: 0x96, hi: 0x96}, + {value: 0x0254, lo: 0x97, hi: 0x97}, + {value: 0x025a, lo: 0x98, hi: 0x98}, + {value: 0x027e, lo: 0x99, hi: 0x99}, + {value: 0x026f, lo: 0x9a, hi: 0x9a}, + {value: 0x026c, lo: 0x9b, hi: 0x9b}, + {value: 0x01f7, lo: 0x9c, hi: 0xac}, + {value: 0x020c, lo: 0xad, hi: 0xad}, + {value: 0x022a, lo: 0xae, hi: 0xb4}, + {value: 0x0556, lo: 0xb5, hi: 0xb5}, + {value: 0x023f, lo: 0xb6, hi: 0xbf}, + // Block 0xa4, offset 0x353 + {value: 0x0003, lo: 0x0d}, + {value: 0x025d, lo: 0x80, hi: 0x8e}, + {value: 0x0552, lo: 0x8f, hi: 0x8f}, + {value: 0x024b, lo: 0x90, hi: 0x90}, + {value: 0x0254, lo: 0x91, hi: 0x91}, + {value: 0x025a, lo: 0x92, hi: 0x92}, + {value: 0x027e, lo: 0x93, hi: 0x93}, + {value: 0x026f, lo: 0x94, hi: 0x94}, + {value: 0x026c, lo: 0x95, hi: 0x95}, + {value: 0x01f7, lo: 0x96, hi: 0xa6}, + {value: 0x020c, lo: 0xa7, hi: 0xa7}, + {value: 0x022a, lo: 0xa8, hi: 0xae}, + {value: 0x0556, lo: 0xaf, hi: 0xaf}, + {value: 0x023f, lo: 0xb0, hi: 0xbf}, + // Block 0xa5, offset 0x361 + {value: 0x0003, lo: 0x0d}, + {value: 0x026f, lo: 0x80, hi: 0x88}, + {value: 0x0552, lo: 0x89, hi: 0x89}, + {value: 0x024b, lo: 0x8a, hi: 0x8a}, + {value: 0x0254, lo: 0x8b, hi: 0x8b}, + {value: 0x025a, lo: 0x8c, hi: 0x8c}, + {value: 0x027e, lo: 0x8d, hi: 0x8d}, + {value: 0x026f, lo: 0x8e, hi: 0x8e}, + {value: 0x026c, lo: 0x8f, hi: 0x8f}, + {value: 0x01f7, lo: 0x90, hi: 0xa0}, + {value: 0x020c, lo: 0xa1, hi: 0xa1}, + {value: 0x022a, lo: 0xa2, hi: 0xa8}, + {value: 0x0556, lo: 0xa9, hi: 0xa9}, + {value: 0x023f, lo: 0xaa, hi: 0xbf}, + // Block 0xa6, offset 0x36f + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0x8f, hi: 0x8f}, + // Block 0xa7, offset 0x371 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xae, hi: 0xae}, + // Block 0xa8, offset 0x373 + {value: 0x0000, lo: 0x01}, + {value: 0x8133, lo: 0xac, hi: 0xaf}, + // Block 0xa9, offset 0x375 + {value: 0x0000, lo: 0x03}, + {value: 0x8134, lo: 0xac, hi: 0xad}, + {value: 0x812e, lo: 0xae, hi: 0xae}, + {value: 0x8133, lo: 0xaf, hi: 0xaf}, + // Block 0xaa, offset 0x379 + {value: 0x0000, lo: 0x01}, + {value: 0x812e, lo: 0x90, hi: 0x96}, + // Block 0xab, offset 0x37b + {value: 0x0000, lo: 0x02}, + {value: 0x8133, lo: 0x84, hi: 0x89}, + {value: 0x8103, lo: 0x8a, hi: 0x8a}, + // Block 0xac, offset 0x37e + {value: 0x0002, lo: 0x0a}, + {value: 0x0063, lo: 0x80, hi: 0x89}, + {value: 0x1a7e, lo: 0x8a, hi: 0x8a}, + {value: 0x1ab1, lo: 0x8b, hi: 0x8b}, + {value: 0x1acc, lo: 0x8c, hi: 0x8c}, + {value: 0x1ad2, lo: 0x8d, hi: 0x8d}, + {value: 0x1cf0, lo: 0x8e, hi: 0x8e}, + {value: 0x1ade, lo: 0x8f, hi: 0x8f}, + {value: 0x1aa8, lo: 0xaa, hi: 0xaa}, + {value: 0x1aab, lo: 0xab, hi: 0xab}, + {value: 0x1aae, lo: 0xac, hi: 0xac}, + // Block 0xad, offset 0x389 + {value: 0x0000, lo: 0x01}, + {value: 0x1a6c, lo: 0x90, hi: 0x90}, + // Block 0xae, offset 0x38b + {value: 0x0028, lo: 0x09}, + {value: 0x2999, lo: 0x80, hi: 0x80}, + {value: 0x295d, lo: 0x81, hi: 0x81}, + {value: 0x2967, lo: 0x82, hi: 0x82}, + {value: 0x297b, lo: 0x83, hi: 0x84}, + {value: 0x2985, lo: 0x85, hi: 0x86}, + {value: 0x2971, lo: 0x87, hi: 0x87}, + {value: 0x298f, lo: 0x88, hi: 0x88}, + {value: 0x0c6a, lo: 0x90, hi: 0x90}, + {value: 0x09e2, lo: 0x91, hi: 0x91}, + // Block 0xaf, offset 0x395 + {value: 0x0002, lo: 0x01}, + {value: 0x0021, lo: 0xb0, hi: 0xb9}, +} + +// recompMap: 7528 bytes (entries only) +var recompMap map[uint32]rune +var recompMapOnce sync.Once + +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "\x195\x190\x00\x01\x198" + // 0x19351930: 0x00011938 + "" + // Total size of tables: 56KB (57068 bytes) diff --git a/vendor/golang.org/x/text/unicode/norm/trie.go b/vendor/golang.org/x/text/unicode/norm/trie.go index 423386b..e4250ae 100644 --- a/vendor/golang.org/x/text/unicode/norm/trie.go +++ b/vendor/golang.org/x/text/unicode/norm/trie.go @@ -29,7 +29,7 @@ var ( nfkcData = newNfkcTrie(0) ) -// lookupValue determines the type of block n and looks up the value for b. +// lookup determines the type of block n and looks up the value for b. // For n < t.cutoff, the block is a simple lookup table. Otherwise, the block // is a list of ranges with an accompanying value. Given a matching range r, // the value for b is by r.value + (b - r.lo) * stride. diff --git a/vendor/modules.txt b/vendor/modules.txt index 5b2350c..313bafa 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -9,9 +9,7 @@ github.com/go-zeromq/goczmq/v4 github.com/go-zeromq/zmq4 github.com/go-zeromq/zmq4/internal/inproc github.com/go-zeromq/zmq4/transport -# github.com/kr/text v0.2.0 -## explicit -# github.com/libsv/go-bc v0.1.11 +# github.com/libsv/go-bc v0.1.29 ## explicit; go 1.17 github.com/libsv/go-bc # github.com/libsv/go-bk v0.1.6 @@ -22,28 +20,31 @@ github.com/libsv/go-bk/bip32 github.com/libsv/go-bk/chaincfg github.com/libsv/go-bk/crypto github.com/libsv/go-bk/wif -# github.com/libsv/go-bt/v2 v2.1.0-beta.4 +# github.com/libsv/go-bt/v2 v2.2.5 ## explicit; go 1.17 github.com/libsv/go-bt/v2 github.com/libsv/go-bt/v2/bscript github.com/libsv/go-bt/v2/sighash +# github.com/libsv/go-p2p v0.1.3 +## explicit; go 1.19 +github.com/libsv/go-p2p/chaincfg/chainhash # github.com/pkg/errors v0.9.1 ## explicit github.com/pkg/errors # github.com/pmezard/go-difflib v1.0.0 ## explicit github.com/pmezard/go-difflib/difflib -# github.com/stretchr/testify v1.8.0 -## explicit; go 1.13 +# github.com/stretchr/testify v1.8.4 +## explicit; go 1.20 github.com/stretchr/testify/assert -# golang.org/x/crypto v0.0.0-20210921155107-089bfa567519 +# golang.org/x/crypto v0.13.0 ## explicit; go 1.17 golang.org/x/crypto/ripemd160 -# golang.org/x/sync v0.0.0-20220601150217-0de741cfad7f -## explicit +# golang.org/x/sync v0.3.0 +## explicit; go 1.17 golang.org/x/sync/errgroup golang.org/x/sync/singleflight -# golang.org/x/text v0.3.7 +# golang.org/x/text v0.13.0 ## explicit; go 1.17 golang.org/x/text/cases golang.org/x/text/internal