| 1. 10,000 sentences |
info.puzz.a10000sentences |
10,000 sentences will help you learn new words in languages you are learning. |
Jan 27, 2018 |
https://github.com/tkrajina/10000sentences |
| 2. 104 RPN Calc |
net.project104.civyshkrpncalc |
Calc that successfully merges the Reverse Polish Notation and the Infix Notation |
Jun 19, 2018 |
https://github.com/CIVYSH/rpncalc104k |
| 3. 106/109ハードウェアキーボード配列変更(+親指Ctrl) |
jp.kcm.thumbctrl |
日本語ハードウェアキーボード用に日本語配列を追加. ([半/全]と[ESC]入替、[変換]/[無変換]→[Ctrl]、[Caps]→[半/全]も追加されます) |
Jun 13, 2018 |
https://github.com/shiftrot/ThumbCtrl |
| 4. 2048 (Ads Free) |
com.tpcstld.twozerogame |
Port of Gabriele Cirulli's 2048 to Android.\n\n+No Ads!\n+No permissions! |
Jun 10, 2018 |
https://github.com/BuddyBuild/2048-Android |
| 5. 5 Calls |
org.a5calls.android.a5calls |
Make your voice heard: Spend 5 minutes, make 5 calls. |
Jul 18, 2018 |
https://github.com/bryansills/5calls-android |
| 6. 5 Pin Bowling Companion |
ca.josephroque.bowlingcompanion |
Track 5 pin bowling scores frame-by-frame, along with a medley of statistics! |
Sep 29, 2018 |
https://github.com/sunndog/bowling-companion |
| 7. A.scribe |
com.laaidback.ascribe |
open-source, minimalist note-taking app |
Aug 3, 2017 |
https://github.com/Laaidback/A.scribe |
| 8. AES Crypto |
com.evgenii.aescrypto |
Encrypt your message with one tap. |
Sep 21, 2018 |
https://github.com/evgenyneu/aes-crypto-android |
| 9. APC UPS Countdown |
net.formula97.android.apcupscountdown |
APC by Schneider ElectricのUPSで表示される時間情報の計算を補助する |
Aug 10, 2018 |
https://github.com/f97one/ApcUpsCountdown |
| 10. APK Downloader |
ca.barraco.carlo.apkdownloader |
Save apps installed on your device to an APK file in your Download folder. |
Jun 28, 2018 |
https://github.com/cbarox/APK-Downloader |
| 11. APK Handler |
com.lim.apkhandler |
APK Handler - Free Application |
Aug 12, 2018 |
https://github.com/vjrathod/APKHandler |
| 12. APRSdroid - APRS Client |
org.aprsdroid.app |
Amateur Radio app for APRS: Track friends, exchange messages, get tactical info. |
Jul 27, 2017 |
https://github.com/ge0rg/aprsdroid |
| 13. Aard 2 |
itkach.aard2 |
Simple dictionary and offline Wikipedia reader |
Jul 3, 2018 |
https://github.com/diptakobu/aard2-android |
| 14. Accounting Fantozzi |
com.eusecom.samfantozzi |
Android mobil accounting Fantozzi complete accounting for smartphone and tablet. |
Jun 21, 2018 |
https://github.com/eurosecom/samfantozzi |
| 15. Activities |
com.cunnj.activities |
Launch and create shortcuts to hidden activities within an app. |
Jun 27, 2017 |
https://github.com/cunnj/Activities |
| 16. Actually Sufficient Storage (Root) |
com.TWP.Project.Fixes.FS.IS |
An Insufficient Storage Bug Fix App (for now, more to come!) |
Sep 30, 2018 |
https://github.com/timberwolfprogrammers/fixmestorage |
| 17. Adafruit Bluefruit LE Connect |
com.adafruit.bluefruit.le.connect |
Wirelessly connect your Android device to an Adafruit Bluefruit LE module. |
Aug 19, 2018 |
https://github.com/peterchauyw/Joey |
| 18. Adblock Fast |
com.rocketshipapps.adblockfast |
Adblock Fast is a free, open-source ad blocker for Samsung Internet 4.0 and up! |
May 17, 2017 |
https://github.com/rocketshipapps/adblockfast |
| 19. Adguard Content Blocker |
com.adguard.android.contentblocker |
Ad blocker app to block ads in Yandex Browser and Samsung Internet browser only |
Sep 17, 2018 |
https://github.com/AdguardTeam/ContentBlocker |
| 20. Aelf - Lectures du jour |
co.epitre.aelf_lectures |
Application la plus simple pour vivre l'Évangile au quotidien. |
Dec 1, 2017 |
https://github.com/HackMyChurch/aelf-dailyreadings |
| 21. Aerial Dream |
com.codingbuffalo.aerialdream |
A screensaver for Android inspired on Apple TV's video screensaver |
Sep 15, 2018 |
https://github.com/cachapa/AerialDream |
| 22. AffdexMe |
com.affectiva.affdexme |
See your facial expressions detected and measured by the Affdex SDK! |
Feb 1, 2017 |
https://github.com/Affectiva/affdexme-android |
| 23. Agile Poker Cards |
de.mytos.mobile.scrum |
Use this application for your Agile Planning meetings. |
Oct 9, 2018 |
https://github.com/mytoysgroup/AgilePokerCardsAndroid |
| 24. AirCasting |
pl.llp.aircasting |
Track & map your environment & vital signs; must have app for Quantified Selfers |
Aug 6, 2018 |
https://github.com/ekospinach/Wireless-E-Health-Monitor |
| 25. Al-Muazzin |
uz.efir.muazzin |
Prayer times application that uses GPS data and astronomical calculations. |
Feb 15, 2017 |
https://github.com/ozbek/al-muazzin |
| 26. /r/Android App store |
subreddit.android.appstore |
Download apps curated by /r/android |
2017-07-28 |
https://github.com/d4rken/reddit-android-appstore |
| 27. 1010! Klooni |
io.github.lonamiwebs.klooni |
libGDX game based on 1010 |
2018-02-06 |
https://github.com/LonamiWebs/Klooni1010 |
| 28. 34C3 Schedule |
info.metadude.android.congress.schedule |
Schedule (aka FahrPlan) of the 34C3 |
2018-01-03 |
https://github.com/EventFahrplan/EventFahrplan |
| 29. A Photo Manager |
de.k3b.android.androFotoFinder |
Manage local photos: Find/Copy/Edit-Exif and show in Gallery or Map. |
2018-03-23 |
https://github.com/k3b/androFotoFinder |
| 30. A2DP Volume |
a2dp.Vol |
Manage Bluetooth functions |
2017-04-27 |
https://github.com/jroal/a2dpvolume |
| 31. AAT |
ch.bailu.aat |
Track your activities |
2018-05-12 |
https://github.com/bailuk/AAT |
| 32. ABCore |
com.greenaddress.abcore |
Bitcoin Core wrapper |
2018-03-31 |
https://github.com/greenaddress/abcore |
| 33. ADSdroid |
hu.vsza.adsdroid |
Get technical datasheets |
2018-05-06 |
https://github.com/dnet/adsdroid |
| 34. AFH Downloader |
org.afhdownloader |
Download from androidfilehost.com |
2018-04-28 |
https://github.com/daktak/afh_downloader |
| 35. AFWall+ |
dev.ukanth.ufirewall |
Control network traffic |
2018-05-02 |
https://github.com/ukanth/afwall |
| 36. ALSA Mixer WebUI |
cz.jiriskorpil.amixerwebui |
Client for ALSA Mixer WebUI |
2018-05-07 |
https://github.com/JiriSko/amixer-webui-android |
| 37. AN2Linux |
kiwi.root.an2linuxclient |
Sync Android notifications to a Linux desktop |
2018-02-16 |
https://github.com/rootkiwi/an2linuxclient |
| 38. ANNO 1404 - Calculator |
de.ktran.anno1404warenrechner |
Population and chain calculations for ANNO 1404 |
2017-04-19 |
https://github.com/tran-khoa/ANNO1404-Warenrechner-App |
| 39. AURdroid |
com.rascarlo.aurdroid |
Simple AUR packages browser |
2018-05-21 |
https://github.com/rascarlo/AURdroid |
| 40. Acastus |
me.dbarnett.acastus |
Lookup addresses and POIs |
2017-06-13 |
https://github.com/DanielBarnett714/Acastus |
| 41. Accordion |
org.billthefarmer.accordion |
Accordion emulator for tablets |
2018-01-29 |
https://github.com/billthefarmer/accordion |
| 42. Acrylic Paint |
anupam.acrylic |
Simple finger painting |
2017-09-11 |
https://github.com/valerio-bozzolan/AcrylicPaint |
| 43. Activity Diary |
de.rampro.activitydiary |
Log and plan your recurring activities |
2018-05-14 |
https://github.com/ramack/ActivityDiary |
| 44. Activity Launcher |
de.szalkowski.activitylauncher |
Create shortcuts for apps and activities |
2017-04-17 |
https://github.com/butzist/ActivityLauncher |
| 45. Ad-Free |
ch.abertschi.adfree |
AdBlocker for Spotify |
2018-02-16 |
https://github.com/abertschi/ad-free |
| 46. AdAway |
org.adaway |
Block advertisements |
2018-03-19 |
https://github.com/AdAway/AdAway |
| 47. Additional Security Settings |
com.davidshewitt.admincontrol |
Additional security settings |
2018-03-23 |
https://github.com/linux-colonel/AdminControl |
| 48. Aeon's End |
com.games.boardgames.aeonsend |
Unofficial market setup randomizer for boardgame Aeon's End |
2017-11-28 |
https://github.com/JanSvoboda/aeonsend-randomizer |
| 49. Akhyou! |
dulleh.akhyou.fdroid |
Stream and download anime |
2017-01-06 |
https://github.com/dulleh/akhyou |
| 50. Alarm Klock |
com.angrydoughnuts.android.alarmclock |
An alarm clock |
2017-01-17 |
https://github.com/kraigs-android/kraigsandroid |
| 51. AlarmMe |
com.taradov.alarmme |
AlarmMe is a simple reminder application with only basic functions. |
Aug 4, 2018 |
https://github.com/ataradov/alarm-me |
| 52. Alfresco Process Services |
com.activiti.android.app |
Empower your mobile workforce and allow users to manage work from anywhere |
Jun 15, 2018 |
https://github.com/Alfresco/activiti-android-app |
| 53. Align4 |
org.ljf.ualign4 |
Align 4 game, with strong and configurable AI. |
Mar 13, 2017 |
https://github.com/LouJo/SailConnect4 |
| 54. All About Olaf |
com.allaboutolaf |
All About Olaf provides intuitive access to campus information and resources. |
Sep 17, 2018 |
https://github.com/StoDevX/AAO-React-Native |
| 55. All codecs for Archos Video |
com.m4rk3t.libcopy2 |
All codecs plugin for Archos video player |
Apr 5, 2018 |
https://github.com/m4rk3t/PluginInstaller |
| 56. Altavia Colli Euganei |
com.lorenzobraghetto.cooptdmaltavia |
Percorri l'altavia dei Colli Euganei con quest'app! |
Dec 7, 2017 |
https://github.com/monossido/CoopTDMAltavia |
| 57. Altcoin Prices |
eu.uwot.fabio.altcoinprices |
Monitor altcoin prices in real time |
2018-05-29 |
https://gitlab.com/cfabio/AltcoinPrices/tree/HEAD |
| 58. AltosDroid |
org.altusmetrum.AltosDroid |
Android application for AltusMetrum flight monitoring |
Oct 8, 2018 |
https://github.com/ajtowns/altos |
| 59. Always On AMOLED - BETA |
com.tomer.alwayson |
Get an always on display on your device! |
May 20, 2018 |
https://github.com/rosenpin/AlwaysOnDisplayAmoled |
| 60. Amahi |
org.amahi.anywhere |
This app enables you to seamlessly access/stream files from your Amahi server. |
Dec 9, 2017 |
https://github.com/csoni111/amahi-android |
| 61. Amaze |
com.amaze.filemanager |
Manage local files |
2017-09-02 |
https://github.com/arpitkh96/AmazeFileManager |
| 62. Ameixa LOS |
org.twelf.cmtheme |
CM12/CM13 FLOSS Theme |
2017-05-25 |
https://gitlab.com/xphnx/twelf_cm12_theme |
| 63. Ameixa Monochrome |
org.xphnx.ameixamonochrome |
Icon pack |
2018-02-22 |
https://gitlab.com/xphnx/ameixa-monochrome |
| 64. Ameixa |
org.xphnx.ameixa |
Port of TwelF CMTheme for many launchers |
2018-05-16 |
https://gitlab.com/xphnx/ameixa |
| 65. American English Pronunciation |
com.aepronunciation.ipa |
Learn the sounds of American English and the symbols used to write them. |
Jan 7, 2017 |
https://github.com/suragch/aePronunciation |
| 66. Amplify Battery Extender -Root |
com.ryansteckler.nlpunbounce |
Battery power to the people! |
Oct 21, 2017 |
https://github.com/brunoqc/unbounce-android |
| 67. AnDICT |
com.savanto.andict |
DICT protocol client for Android. Perform fast and small dictionary look-ups. |
Sep 26, 2018 |
https://github.com/savanto/AnDICT-Android |
| 68. Anchorage People Mover Bus - MonTransit |
org.mtransit.android.us_anchorage_people_mover_bus |
Anchorage People Mover Bus for MonTransit.\nSchedule. News. |
Jul 9, 2018 |
https://github.com/mtransitapps/us-anchorage-people-mover-bus-android |
| 69. And Bible |
net.bible.android.activity |
Offline Bible reader |
2017-04-13 |
https://github.com/mjdenham/and-bible |
| 70. AndIodine |
org.xapek.andiodine |
Data connection through DNS tunneling |
2018-05-12 |
https://github.com/yvesf/andiodine |
| 71. AndStatus |
org.andstatus.app |
Multiple accounts client for multiple social networks |
2018-06-02 |
https://github.com/andstatus/andstatus |
| 72. AndWars |
com.mauriciotogneri.andwars |
AndWars is a turn-based strategy game of territorial conquest and unit control. |
Sep 19, 2018 |
https://github.com/vndly/andwars |
| 73. Andhrystone |
net.teknoraver.andhrystone |
Dhrystone for Android |
Jan 8, 2017 |
https://github.com/teknoraver/andhrystone |
| 74. Andi : The Coder's Guide to Android Development |
io.ramesh.collapsingtoolbarwithwebview |
Andi - Android App Development /Mobile App Development Tutorials, Java Tutorial |
Aug 5, 2018 |
https://github.com/RameshBhupathi/CollapsingToolbar-With-Webview |
| 75. Andlytics |
com.github.andlyticsproject |
Track your Android app's statistics. |
Feb 4, 2018 |
https://github.com/TheNephilim88/andlytics |
| 76. AndrOBD |
com.fr3ts0n.ecu.gui.androbd |
Connect to your car's OBD system |
2018-06-02 |
https://github.com/fr3ts0n/AndrOBD |
| 77. Android CUPS Print |
io.github.benoitduffez.cupsprint |
|
2017-05-06 |
https://github.com/BenoitDuffez/AndroidCupsPrint/tree/fdroid |
| 78. Android Permissions |
in.arjsna.permissionchecker |
Check requested permission details of all installed applications |
2018-06-02 |
https://github.com/Arjun-sna/android-permission-checker-app |
| 79. Android Playground |
com.esafirm.androidplayground |
Android Playground |
Jan 3, 2018 |
https://github.com/esafirm/android-playground |
| 80. Android SQLite CRUD |
qodr.sqlitecrud |
android application examples using SQLite database |
Feb 11, 2017 |
https://github.com/qodrorid/android-sql-crud |
| 81. Android Token |
uk.co.bitethebullet.android.token |
OATH software tokens |
2017-05-15 |
https://github.com/markmcavoy/androidtoken |
| 82. Android version |
com.github.mueller_ma.viewandroidversion |
Simple app to view Android version information |
2018-02-22 |
https://gitlab.com/mueller-ma/View-android-version |
| 83. Anecdote |
io.gresse.hugo.anecdote |
Read your latest quote and feed in a lite app |
2017-05-06 |
https://github.com/HugoGresse/Anecdote |
| 84. AnkiDroid |
com.ichi2.anki |
A flashcard-based study aid |
2018-04-28 |
https://github.com/ankidroid/Anki-Android |
| 85. AnkiEditor for AnkiDroid |
com.jkcarino.ankieditor |
An advanced note editor plug-in for AnkiDroid |
Sep 29, 2018 |
https://github.com/jkennethcarino/AnkiEditor |
| 86. Announcer |
com.sst.anouncements |
Never miss an announcement again. |
Mar 11, 2018 |
https://github.com/MoonCheesez/sstannouncer |
| 87. Another RSS |
de.digisocken.anotherrss |
reader for multiple RSS feeds in a single, searchable list |
2018-05-23 |
https://github.com/no-go/AnotherRSS |
| 88. AnotherMonitor |
org.anothermonitor |
Monitors and records the CPU and memory usage of Android devices |
Aug 14, 2017 |
https://github.com/chinnuabhi/AnotherMonitor |
| 89. Antenna Map |
com.platypii.asr |
Antenna Map |
Sep 9, 2018 |
https://github.com/platypii/AntennaMap |
| 90. AntennaPod |
de.danoeh.antennapod |
Advanced podcast manager and player |
2018-04-16 |
https://github.com/antennapod/AntennaPod |
| 91. Antox |
chat.tox.antox |
Antox is a secure multimedia messenger |
May 20, 2018 |
https://github.com/wiiam/Antox |
| 92. Antura & the Letters (Arabic) |
org.eduapp4syria.antura |
Reading has never been so much fun! |
Feb 16, 2018 |
https://github.com/vgwb/Antura_arabic |
| 93. Anuto TD |
ch.logixisland.anuto |
Another Ugly Tower Defense |
2017-11-14 |
https://github.com/reloZid/android-anuto |
| 94. AnyMemo |
org.liberty.android.fantastischmemo |
Flashcard-based Learning |
2017-02-08 |
https://github.com/helloworld1/AnyMemo |
| 95. AnySoftKeyboard - French Language Pack |
com.anysoftkeyboard.languagepack.french |
AnySoftKeyboard French Language pack |
2018-03-23 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/French |
| 96. AnySoftKeyboard Dutch |
com.anysoftkeyboard.languagepack.dutch |
Dutch Language Pack for AnySoftKeyboard |
2017-07-23 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Dutch |
| 97. AnySoftKeyboard: Basque |
com.anysoftkeyboard.languagepack.basque |
Language pack for AnySoftKeyboard |
2017-02-09 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Basque |
| 98. AnySoftKeyboard: Brazilian |
com.anysoftkeyboard.languagepack.brazilian |
Language pack for AnySoftKeyboard |
2017-07-14 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Brazilian |
| 99. AnySoftKeyboard: Czech |
org.herrlado.ask.languagepack.czech |
Language pack for AnySoftKeyboard |
2017-09-02 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Czech |
| 100. AnySoftKeyboard: Danish |
com.anysoftkeyboard.languagepack.danish |
Language pack for AnySoftKeyboard |
2017-04-04 |
https://softkeyboard.googlecode.com/svn/trunk/LanguagePacks/Danish |
| 101. AnySoftKeyboard: Finnish |
com.menny.anysoftkeyboard.finnish |
Language pack for AnySoftKeyboard |
2017-02-12 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Finnish |
| 102. AnySoftKeyboard: German |
com.anysoftkeyboard.languagepack.german |
Language pack for AnySoftKeyboard |
2017-08-08 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/German |
| 103. AnySoftKeyboard: Greek |
com.anysoftkeyboard.languagepack.greek |
Language pack for AnySoftKeyboard |
2017-03-03 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Greek |
| 104. AnySoftKeyboard: Hebrew |
com.anysoftkeyboard.languagepack.hebrew |
Language pack for AnySoftKeyboard |
2017-08-08 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Hebrew |
| 105. AnySoftKeyboard: Icelandic |
com.anysoftkeyboard.languagepack.icelandic |
Language pack for AnySoftKeyboard |
2017-08-28 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Icelandic |
| 106. AnySoftKeyboard: Italian |
com.anysoftkeyboard.languagepack.italian |
Language pack for AnySoftKeyboard |
2017-02-12 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Italian |
| 107. AnySoftKeyboard: Latvian |
com.anysoftkeyboard.languagepack.latvian |
Language pack for AnySoftKeyboard |
2017-02-12 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Latvian |
| 108. AnySoftKeyboard: Macedonian |
com.anysoftkeyboard.languagepack.macedonian |
Language pack for AnySoftKeyboard |
2017-08-08 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Macedonian |
| 109. AnySoftKeyboard: NEO2 |
com.anysoftkeyboard.languagepack.neo |
Neo2 Keyboard Layout for ASK |
2017-03-10 |
https://github.com/kertase/neo_anysoftkeyboard |
| 110. AnySoftKeyboard: Norwegian |
com.anysoftkeyboard.languagepack.norwegian |
Language pack for AnySoftKeyboard |
2017-02-08 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Norwegian |
| 111. AnySoftKeyboard: Portuguese |
com.anysoftkeyboard.languagepack.portuguese |
Language pack for AnySoftKeyboard |
2017-09-02 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Portuguese |
| 112. AnySoftKeyboard: Slovene |
com.anysoftkeyboard.languagepack.slovene |
Language pack for AnySoftKeyboard |
2017-02-12 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Slovene |
| 113. AnySoftKeyboard: Spanish |
com.anysoftkeyboard.languagepack.spain |
Language pack for AnySoftKeyboard |
2017-09-02 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Spanish |
| 114. AnySoftKeyboard: Swedish |
com.anysoftkeyboard.languagepack.swedish |
Language pack for AnySoftKeyboard |
2017-02-05 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Swedish |
| 115. AnySoftKeyboard: Tatar |
com.anysoftkeyboard.languagepack.tatar |
Language pack for AnySoftKeyboard |
2017-03-03 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Tatar |
| 116. AnySoftKeyboard: Ukrainian |
com.anysoftkeyboard.languagepack.ukrainian |
Language pack for AnySoftKeyboard |
2017-02-18 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Ukrainian |
| 117. AnySoftKeyboard: Русский |
com.anysoftkeyboard.languagepack.russian2 |
Language pack for AnySoftKeyboard |
2017-02-26 |
https://github.com/AnySoftKeyboard/LanguagePack/tree/Russian |
| 118. AnySoftKeyboard |
com.menny.android.anysoftkeyboard |
Alternative keyboard |
2018-03-05 |
https://github.com/AnySoftKeyboard/AnySoftKeyboard |
| 119. Apk Analyzer |
sk.styk.martin.apkanalyzer |
Take a look under the hood of your applications! |
Oct 16, 2018 |
https://github.com/MartinStyk/AndroidApkAnalyzer |
| 120. Apk Extractor |
axp.tool.apkextractor |
Get APK files from installed apps |
2018-04-05 |
https://github.com/axxapy/apkExtractor |
| 121. Apk Info |
com.wt.apkinfo |
Show informations about installed applications. |
Oct 16, 2018 |
https://github.com/kenumir/ApkInfo |
| 122. ApkTrack |
fr.kwiatkowski.ApkTrack |
Check for updates on PlayStore and other sources |
2018-01-15 |
https://github.com/JusticeRage/ApkTrack |
| 123. Apod Classic |
com.jvillalba.apod.classic |
NASA Astronomy Picture of the Day Classic |
2018-06-02 |
https://github.com/fighthawkarg/NasaApodCL |
| 124. Apod MD |
com.jvillalba.apod.md |
NASA Astronomy Picture of the Day with Material Design |
2018-06-02 |
https://github.com/fighthawkarg/NasaApodMD |
| 125. Apolline |
science.apolline |
Application for air pollution monitoring |
May 27, 2018 |
https://github.com/Apolline-Lille/apolline-android |
| 126. Apollo Trivia |
net.jakevossen.apollotrivia |
Learn more about the Apollo Moon missions |
2018-05-26 |
https://github.com/jakevossen5/Apollo-Trivia |
| 127. App Launcher |
com.simplemobiletools.applauncher |
A simple holder for your favourite app launchers. |
2018-05-23 |
https://github.com/SimpleMobileTools/Simple-App-Launcher |
| 128. App ReInstaller |
jp.ne.sakura.kkkon.android.reinstallapk |
It will only re-install the app it does not start , such as updates |
Oct 7, 2018 |
https://github.com/kkkon/kk-android-reinstall-apk |
| 129. Apple Flinger |
com.gitlab.ardash.appleflinger.android |
Funny single- and multiplayer game - Use a slingshot to shoot with apples |
2018-04-21 |
https://gitlab.com/ar-/apple-flinger |
| 130. Apps2Fire (Original) |
mobi.koni.appstofiretv |
Load every Android app on your FireTV. Just use the sideload feature. |
Sep 21, 2018 |
https://github.com/konir/Apps2Fire |
| 131. Arcane Tracker |
net.mbonnin.arcanetracker |
Hearthstone deck tracker for Android |
Aug 19, 2018 |
https://github.com/williamwebb/arcane_tracker |
| 132. ArchWiki Manual |
com.gsc.archwikimanual |
Initial version of an archlinux wiki manual for offline installation reference. |
Aug 6, 2017 |
https://github.com/xgdgsc/archwikimanual |
| 133. ArchWiki Viewer |
com.jtmcn.archwiki.viewer |
View Arch Linux Wiki articles |
2017-06-17 |
https://github.com/jtmcn/archwiki-viewer |
| 134. Archive Track Reader |
net.wenchy.ao3track.reader |
Archive Track Reader is designed to make it easy to read works on Ao3 |
Mar 23, 2018 |
https://github.com/wench/Ao3-Tracker |
| 135. Arnaud Soundboard |
com.jihiryu.albertoi.arnaudsounds |
Un Arnaud Cousergue en tu dispositivo |
Jun 2, 2017 |
https://github.com/albertoito/ArnaudSounds |
| 136. Arris POTD generator |
com.grounduphq.arrispwgen |
Password of the day generator for Arris modems |
Jan 22, 2017 |
https://github.com/borfast/arrispwgen-android |
| 137. ArtChecker |
com.magicalboy.artchecker |
Checking for your device virtual machine version. |
Jul 18, 2017 |
https://github.com/donly/ARTChecker |
| 138. Arvutaja |
ee.ioc.phon.android.arvutaja |
Voice actions in Estonian and English to set alarms, convert units, and more ... |
Sep 19, 2018 |
https://github.com/Kaljurand/Arvutaja |
| 139. Arx Explore |
sandeepjoshi1910.arxiv_explore |
Explore arXiv.org's digital repository |
Dec 12, 2017 |
https://github.com/sandeepjoshi1910/Arxiv-Explore |
| 140. AsciiCam |
com.dozingcatsoftware.asciicam |
Replace pixels with text |
2017-01-31 |
https://github.com/dozingcat/AsciiCam |
| 141. AspeQt |
org.qtproject.example.AspeQt |
AspeQt, Atari Serial Peripheral Emulator for Android |
Oct 6, 2017 |
https://github.com/greblus/aspeqt |
| 142. Assess Objects |
pl.polidea.treeview |
Evaluation a group of objects |
Mar 24, 2018 |
https://github.com/Polidea/tree-view-list-android |
| 143. AsteroidOS Sync |
org.asteroidos.sync |
Synchronize with your AsteroidOS smartwatch |
2018-04-08 |
https://github.com/AsteroidOS/AsteroidOSSync |
| 144. Atomify LAMMPS |
com.compphys.atomify |
Live molecular dynamics simulation based on LAMMPS |
Jul 29, 2017 |
https://github.com/ComputationalPhysics/molecules |
| 145. Atomize |
com.wrmndfzzy.atomize |
Compress your PNG images and save valuable storage space on your device! |
Jan 4, 2017 |
https://github.com/wrmndfzzy/Atomize |
| 146. Audinaut |
net.nullsum.audinaut |
Stream music from Subsonic-compatible servers |
2018-05-14 |
https://github.com/nvllsvm/Audinaut |
| 147. Audio Recorder |
com.github.axet.audiorecorder |
Record audio files |
2018-06-04 |
https://gitlab.com/axet/android-audio-recorder/tree/HEAD |
| 148. Audiobook player for seniors - Homer Player |
com.studio4plus.homerplayer |
An audiobook player for the elderly and visually impaired. |
Sep 23, 2018 |
https://github.com/treejames/homerplayer |
| 149. Audiometry Made Easy |
ut.ewh.audiometrytest |
Test your hearing capabilities |
2017-05-10 |
https://github.com/ReeceStevens/ut_ewh_audiometer_2014 |
| 150. Authorizer |
net.tjado.passwdsafe |
Password Manager with USB Keyboard emulation |
2017-08-02 |
https://github.com/tejado/Authorizer |
| 151. Auto Airplane Mode |
org.miamplayer.autoairplanemode |
Schedule airplane mode based on your settings |
2017-03-17 |
https://github.com/MBach/AutoAirplaneMode |
| 152. Auto Battery Saver Lollipop |
com.banyaibalazs.batterysaverlollipop |
Turns on the system's battery saver feature, when the device is discharging |
Jun 22, 2017 |
https://github.com/balazsbanyai/auto-batterysaver-lollipop |
| 153. Auto Stop Race |
pl.temomuko.autostoprace |
The official mobile application for runners autostopowego Auto Stop Race |
Apr 27, 2018 |
https://github.com/TeMoMuKo/AutoStopRace |
| 154. Auto Updater for Chromium |
com.dosse.chromiumautoupdater |
Automatic updates for Chromium |
2018-06-04 |
https://github.com/adolfintel/chromiumUpdater |
| 155. Auto-Away |
com.teamdc.stephendiniz.autoaway |
Auto respond calls and messages |
2017-10-13 |
https://github.com/DizzyThermal/Auto-Away |
| 156. AutoOff - Shutdown Timer ROOT |
de.jonathansautter.autooff |
Give your phone a break, and sleep better without radiation from your device! |
Jul 26, 2018 |
https://github.com/jonathansautter/AutoOff |
| 157. Autonomy Way |
com.autonomyway |
Discover value-time to reach the Financial Autonomy! |
Mar 27, 2018 |
https://github.com/renzon/autonomyway |
| 158. Autostarts |
com.elsdoerfer.android.autostarts |
Keep control over your phone: See what applications do behind your back. |
Mar 13, 2017 |
https://github.com/shinyvince/android-autostarts |
| 159. Auvergne Webcams |
fr.openium.auvergnewebcams |
Gardez un oeil sur votre région ! |
Oct 2, 2018 |
https://github.com/openium/auvergne-webcams-droid |
| 160. AvNav Navigation |
de.wellenvogel.avnav.main |
Sailboat Navigation |
Feb 18, 2018 |
https://github.com/wellenvogel/avnav |
| 161. Avertisseur de DLA MountyHall |
org.zoumbox.mh_dla_notifier |
Do not miss your DLA MoutyHall! |
Jul 6, 2017 |
https://github.com/athimel/mh-dla-notifier |
| 162. Awake for Debug |
com.afzaln.awakedebug |
Keep your phone awake only when debugging, not when charging from a wall socket. |
Sep 18, 2018 |
https://github.com/AfzalivE/AwakeDebug |
| 163. BBQ Timer |
com.onefishtwo.bbqtimer |
A timer that works on the lock screen and has periodic reminder alarms. |
Oct 7, 2017 |
https://github.com/1fish2/BBQTimer |
| 164. BCP Online |
com.acrylicgoat.bcponline |
BCPOnline - the Episcopal Book of Common Prayer in your pocket |
Sep 19, 2018 |
https://github.com/acrylicgoat/BCPOnline |
| 165. BLE Peripheral Simulator |
io.github.webbluetoothcg.bletestperipheral |
App that simulates a BLE Peripheral. Use to try out Web Bluetooth. |
Mar 30, 2017 |
https://github.com/mzsanford/ble-test-peripheral-android |
| 166. BMI Calculator |
com.zola.bmi |
Body Mass Index calculator |
2017-09-14 |
https://github.com/zikalify/BMI_Calculator |
| 167. BPInfo - Budapest Public Transport Info |
com.ofalvai.bpinfo |
Budapest public transport info, changes and incidents |
Feb 10, 2018 |
https://github.com/ofalvai/BPInfo |
| 168. BRD - bitcoin wallet |
com.breadwallet |
The simple and secure bitcoin wallet. |
Oct 17, 2018 |
https://github.com/dr0pthedoge/unitwallet-android |
| 169. BRouter |
btools.routingapp |
Get elevation-aware cycling directions |
2018-04-20 |
https://github.com/abrensch/brouter |
| 170. BT Chat 아두이노 블루투스 채팅 |
com.hardcopy.btchat |
This app is created to connect to the Arduino and Bluetooth to allow a simple chat. |
Jul 4, 2018 |
https://github.com/godstale/BTChat |
| 171. BTCDroid Free |
com.eiabea.btcdroid |
Monitoring App for mining bitcoin at slush's pool |
Apr 3, 2018 |
https://github.com/eiabea/btcdroid |
| 172. Baby Sleep Sounds |
protect.babysleepsounds |
Play sounds to help babies sleep |
2018-06-02 |
https://github.com/brarcher/baby-sleep-sounds |
| 173. BackgroundRestrictor |
com.pavelsikun.runinbackgroundpermissionsetter |
Manage RUN_IN_BACKGROUND permissions |
2017-11-03 |
https://github.com/MrBIMC/RunInBackgroundPermissionSetter |
| 174. BakaReader EX |
com.erakk.lnreader |
The BakaReader EX is for reading Light Novels translations from the Baka-Tsuki. |
Sep 24, 2018 |
https://github.com/freedomofkeima/LNReader-Android |
| 175. BakuBus |
com.aaplab.bakubus |
BakuBus |
Feb 1, 2018 |
https://github.com/mecid/BakuBus |
| 176. Balance |
de.mangelow.balance |
Widget that shows the value of a given ussd code |
2017-02-20 |
https://github.com/scheich/Balance |
| 177. Banff Roam Transit Bus - MonTransit |
org.mtransit.android.ca_banff_roam_transit_bus |
Banff Roam Transit Bus for MonTransit.\nSchedule. News. |
Sep 17, 2018 |
https://github.com/mtransitapps/ca-banff-roam-transit-bus-android |
| 178. Barcode Scanner |
com.google.zxing.client.android |
Scan barcodes on products, or barcodes containing URLs, contact info, and so on |
2017-11-14 |
https://github.com/zxing/zxing |
| 179. Barfastic - BARF Diet for dogs, cats and ferrets |
com.refactorizado.barfastic |
🏅 The best app about BARF diet: Feed your pets with natural food |
Jul 22, 2018 |
https://github.com/mbuenoferrer/barfastic |
| 180. Barrie Transit Bus - MonTransit |
org.mtransit.android.ca_barrie_transit_bus |
Barrie Transit Bus for MonTransit.\nSchedule… |
Sep 28, 2018 |
https://github.com/mtransitapps/ca-barrie-transit-bus-android |
| 181. Base64 Decoder |
ca.mrrafael.base64decoder |
Encrypts and Decodes text in Base64. Source code included. |
Apr 23, 2018 |
https://github.com/rafaelpassarela/base64Decoder |
| 182. Base64 ⇄ QmFzZTY0 |
be.robinj.base64 |
Encode/decode Base64 on the fly |
Mar 15, 2017 |
https://github.com/RobinJ1995/Base64-QmFzZTY0 |
| 183. Basic chess endgames |
com.loloof64.android.basicchessendgamestrainer |
Generates basic chess endgames and let you play them against the device. |
Jan 4, 2018 |
https://github.com/loloof64/BasicChessEndGamesTrainer |
| 184. BasketBuild Downloader |
org.basketbuilddownloader |
Download roms from s.basketbuild.com |
2018-05-06 |
https://github.com/daktak/basketbuild_downloader |
| 185. Bass Blog - Drum & Bass Mixes |
pixel.kotlin.bassblog |
Drum And Bass Mixes |
Sep 25, 2018 |
https://github.com/Gark/bassblog_kotlin |
| 186. Batch Uninstaller |
com.saha.batchuninstaller |
Uninstall multiple applications at once |
2018-05-18 |
https://github.com/sarbajitsaha/Batch-Uninstaller |
| 187. Bats! HIIT |
org.jfet.batsHIIT |
Practice high intensity interval training |
2017-02-24 |
https://github.com/kwantam/batsHIIT |
| 188. Battery Charge Limit |
com.slash.batterychargelimit |
Stops charging at a desired level |
2018-02-16 |
https://github.com/sriharshaarangi/BatteryChargeLimit |
| 189. Battery Live |
com.enrico.earthquake.batterysimplysolid |
Set the wallpaper based on the battery level |
2017-06-14 |
https://github.com/enricocid/Battery-Live |
| 190. BatteryCalibration |
de.perflyst.batterycalibration |
Calibrate your battery |
2018-05-28 |
https://github.com/Perflyst/BatteryCalibration |
| 191. Baustellen-SH |
de.strassen_sh |
Visit http://www.strassen-sh.de for more information. |
Feb 5, 2018 |
https://github.com/ChristianHoesel/strassen-sh |
| 192. BeHe Keyboard |
com.vlath.keyboard |
Hacking & programming keyboard with material design |
2018-01-22 |
https://github.com/VladThodo/behe-keyboard |
| 193. BeHe Pro |
com.vlath.beheexplorer |
Browse the web |
2017-05-29 |
https://github.com/VladThodo/behe-explorer |
| 194. BeTrains - SNCB Belgium |
tof.cv.mpp |
Most user-friendly train application in Belgium. Train information in real time. |
Jun 4, 2018 |
https://github.com/pieterverstraete/BeTrains-for-Android |
| 195. Beacon Locator |
com.samebits.beacon.locator |
Interact with Bluetooth beacons |
2018-04-03 |
https://github.com/vitas/beaconloc |
| 196. BeaconMQTT |
com.gjermundbjaanes.beaconmqtt |
Combine Bluetooth Beacons (like iBeacon) and the IoT messaging protocol MQTT. |
Oct 30, 2017 |
https://github.com/bjaanes/BeaconMqtt |
| 197. Bedroom Design for marriage |
com.grafixartist.masonry |
Creative Bedroom Design |
Oct 14, 2017 |
https://github.com/Suleiman19/Masonry |
| 198. BeeCount |
com.knirirr.beecount |
Knitting row counter |
2018-05-07 |
https://github.com/knirirr/BeeCount |
| 199. BenchApp Free Team Manager |
com.benchapp |
BenchApp is the ultimate hockey, soccer and baseball team manager. |
Jan 10, 2018 |
https://github.com/leok7v/android-benchApp |
| 200. Benefit Saldo |
com.hatak.benefit |
The application allows you to check the card status MyBenefit |
Apr 9, 2017 |
https://github.com/hatak30/Benefit_mvvm |
| 201. Berlin-Vegan |
org.berlin_vegan.bvapp |
Guide for vegan dining and shopping in Berlin |
2017-09-11 |
https://github.com/Berlin-Vegan/berlin-vegan-guide |
| 202. Bestiary 5th Edition: DnD 5e monster manual |
sk.libco.bestiaryfive |
Android monster manual for DnD 5e. |
Apr 8, 2018 |
https://github.com/Libco/bestiary5thedition |
| 203. Beta Updater for WhatsApp |
com.javiersantos.whatsappbetaupdater |
Update WhatsApp to latest beta release |
2018-01-29 |
https://github.com/javiersantos/WhatsAppBetaUpdater |
| 204. Bev Facey Official App |
com.bevfacey.bfhapp |
The official app for parents and students of Bev Facey Community High School |
Nov 4, 2017 |
https://github.com/FaceyComputers/BFH-Android-New |
| 205. Bewegungsmelder |
de.arnefeil.bewegungsmelder |
Get event information for Hamburg, Germany |
2017-11-07 |
https://github.com/arnef/bewegungsmelder-android |
| 206. BibleTime Mobile |
org.qtproject.bibletime.mobile |
A free Bible study application |
Oct 5, 2018 |
https://github.com/betsegaw/bibletime |
| 207. Bibleify |
com.sonnylab.alkitabapp |
Aplikasi alkitab offline modern dengan suara dramatis |
Oct 12, 2017 |
https://github.com/sonnylazuardi/alkitab-app |
| 208. Bible |
com.BibleQuote |
Bible with search, bookmarks, and advanced parallel passages of Scripture |
May 7, 2018 |
https://github.com/YakushevVladimir/BibleQuote-for-Android |
| 209. Biblia Offline ARC - CCB |
com.cubolabs.bibliaofflinearc |
Bíblia Almeida Revista e Corrigida (ARC). Rápida, offline, grátis. Versão CCB. |
May 10, 2018 |
https://github.com/diegoponciano/biblia-ccb |
| 210. Bienvenido a Internet |
org.bienvenidoainternet.app |
Bienvenido a Internet text/image board browser |
2017-01-02 |
https://github.com/Renard1911/BaiApp |
| 211. Biermacht |
com.biermacht.brews |
The Android homebrew beer recipe creator and calculator kit. |
Oct 14, 2018 |
https://github.com/caseydavenport/biermacht |
| 212. Bierverkostung |
de.retujo.bierverkostung |
Document and manage your personal beer tastings |
2018-05-14 |
https://bitbucket.org/jufickel/bierverkostung/src |
| 213. Big Days of Our Life Countdown |
com.prosellersworld.bigdaysfree |
COUNTDOWN ALL THE IMPORTANT DAYS IN YOUR LIFE IN DAYS-HOURS-MINUTES and SECONDS! |
Dec 16, 2017 |
https://github.com/VasPavlo/BigDays |
| 214. BiglyBT, Torrent Downloader |
com.biglybt.android.client |
Free, open source torrenting for Android phone, tablet, Chromebook, & Android TV |
2017-12-15 |
https://github.com/BiglySoftware/BiglyBT-Android |
| 215. Bike Share Toronto - MonTransit |
org.mtransit.android.ca_toronto_share_bike |
Bike Share Toronto for MonTransit.\nAvailability. News. |
Aug 2, 2018 |
https://github.com/mtransitapps/ca-toronto-share-bike-android |
| 216. Bimba |
ml.adamsprogs.bimba |
First Free Software Poznań Wandering Guide |
2018-05-12 |
https://github.com/apiote/Bimba |
| 217. Binary Clock |
dzik.binaryclock |
A simple Binary Clock |
Jun 24, 2017 |
https://github.com/DarnokOk/BinaryClock |
| 218. Binaural Beats Therapy |
com.ihunda.android.binauralbeat |
An app that will help you relax, sleep better, meditate, concentrate and more ! |
Aug 9, 2017 |
https://github.com/GiorgioRegni/Binaural-Beats |
| 219. Binaural Beats |
com.github.axet.binauralbeats |
Meditation helper |
2018-05-18 |
https://gitlab.com/axet/android-binaural-beats |
| 220. BirdBlox |
com.birdbraintechnologies.birdblox |
Program your Hummingbird Duo, Bit, or micro:bit using this block-based app! |
Oct 1, 2018 |
https://github.com/BirdBrainTechnologies/BirdBlox-Android-Support |
| 221. Birdays – Birthday reminder |
com.djonique.birdays |
Simple birthday alarm app with widget and notifications of upcoming Birthdays |
Dec 10, 2017 |
https://github.com/Djonique/Birdays |
| 222. BirthDay Droid |
com.tmendes.birthdaydroid |
Check your contacts birthdays |
2017-08-02 |
https://gitlab.com/tmendes/BirthDayDroid |
| 223. Birthday Calendar |
saschpe.contactevents |
Creates birthday events from all other calendar's data |
2018-02-16 |
https://github.com/saschpe/BirthdayCalendar |
| 224. Birthday Reminder |
de.ubuntix.android.birthdayreminder |
This App reminds you about all upcoming birthdays of your family and friends. |
Oct 14, 2017 |
https://github.com/sealor/BirthdayReminder |
| 225. Bitcoin Balance Widget |
samdev.de.bitcoinbalance |
Display the funds in one or more BTC addresses on your home screen |
Feb 9, 2018 |
https://github.com/Mikescher/BitcoinBalance |
| 226. Bitcoin Blue (Dollar Blue) |
com.thanksmister.btcblue |
Calculator for converting Argentina Pesos (ARS) to BTC using major exchanges. |
Feb 14, 2018 |
https://github.com/thanksmister/BitcoinBlue |
| 227. Bitcoin Lightning Wallet |
com.lightning.walletapp |
Native segwit BTC wallet with Lightning Network support |
Oct 9, 2018 |
https://github.com/btcontract/lnwallet |
| 228. Bitcoin PoS |
gr.cryptocurrencies.bitcoinpos |
This simple to use application enables merchants to accept bitcoin. |
Oct 16, 2018 |
https://github.com/karask/bitcoinpos |
| 229. Bitcoin Ticker Widget |
st.brothas.mtgoxwidget |
Bitcoin Ticker Widget displays and monitors current BTC and LTC exchange rates. |
Oct 8, 2018 |
https://github.com/gostaj/MtGoxWidget |
| 230. Bitcoin Wallet : Urchin (BETA) |
com.bytetobyte.xwallet |
Bitcoin Wallet : Urchin; Wallet & News Feed |
Sep 3, 2017 |
https://github.com/ehanoc/xwallet |
| 231. Bitcoin Wallet [testnet3] |
de.schildbach.wallet_test |
Testing version of Bitcoin |
2018-05-02 |
https://github.com/bitcoin-wallet/bitcoin-wallet |
| 232. Bitcoin Wallet |
de.schildbach.wallet |
Store digital currency |
2018-05-02 |
https://github.com/bitcoin-wallet/bitcoin-wallet |
| 233. Bitcoin World Map |
com.bubelov.coins |
See who accepts Bitcoin and get notified of new places nearby. |
Feb 25, 2018 |
https://github.com/bubelov/coins-android |
| 234. Bitcoin |
com.btcontract.wallet |
Simple Bitcoin wallet |
2017-07-09 |
https://github.com/btcontract/wallet |
| 235. Bitmask |
se.leap.bitmaskclient |
Easy and secure encrypted communication (VPN) |
2018-03-10 |
https://0xacab.org/leap/bitmask_android |
| 236. Bitwarden Password Manager |
com.x8bit.bitwarden |
Bitwarden is a login and password manager that helps keep you safe while online. |
Sep 25, 2018 |
https://github.com/bitwarden/mobile |
| 237. BkEmu - BK-0010/11M emulator |
su.comp.bk |
Emulator of 16-bit Soviet home computers Elektronika BK-0010/11M. |
Aug 27, 2018 |
https://github.com/3cky/bkemu-android |
| 238. BlabberTabber |
com.blabbertabber.blabbertabber |
Diarization and Transcription FOR SPEECH RESEARCHERS ONLY |
Apr 14, 2018 |
https://github.com/blabbertabber/blabbertabber |
| 239. Black Jack |
com.hisham.blackjack |
Black jack is back! Share and compare your score with your friends. |
Aug 31, 2017 |
https://github.com/hishamMuneer/BlackJack_Game |
| 240. BlackScot screen battery saver |
busu.blackscreenbatterysaver |
Black screen battery saving app useful when reading or listening to youtube |
Oct 26, 2017 |
https://github.com/abusuioc/black-screen-battery-saver |
| 241. Blacklist Blocker |
com.kaliturin.blacklist |
Block unwanted calls and/or SMS |
2018-06-02 |
https://github.com/kaliturin/BlackList |
| 242. Blank Daydream |
com.staceybellerose.blankdaydream |
Blank the screen in Daydream mode |
Oct 5, 2017 |
https://github.com/staceybellerose/BlankDaydream |
| 243. Blastar Reborn |
me.dylanburton.blastarreborn |
A recreation of Elon Musk's childhood game \Blastar|Aug 10, 2017 |
https://github.com/claywahlstrom/blastar |
|
| 244. BlitzMail |
de.grobox.blitzmail |
Share content and notes via email |
2017-01-11 |
https://github.com/grote/BlitzMail |
| 245. Blitzortung Lightning Monitor |
org.blitzortung.android.app |
Have a quick overview of the current thunderstorm situation whenever you want. |
Jun 5, 2018 |
https://github.com/wuan/bo-android |
| 246. Blogg - a Blogger Alternative |
thenewpotato.blogg |
A detailed editor client for the Google Blogger service |
Dec 28, 2017 |
https://github.com/thenewpotato/Blogg |
| 247. Blokada v3 (ad blocker) |
org.blokada.alarm |
The ad blocker - battery efficient, fast, powerful and simple to use |
2018-05-16 |
https://github.com/blokadaorg/blokada |
| 248. Blokish |
org.scoutant.blokish |
Board game |
2018-01-21 |
https://github.com/scoutant/blokish |
| 249. Bloom Reader |
org.sil.bloom.reader |
Reader for local language books created in Bloom |
Oct 11, 2018 |
https://github.com/BloomBooks/BloomReader |
| 250. BluEmerald CM/Substratum Theme |
io.xdevs23.theme.bluemerald.cm |
A blue, flat and beautiful theme |
Feb 5, 2017 |
https://github.com/xdevs23/BluEmerald |
| 251. Blue Dot |
com.stuffaboutcode.bluedot |
Blue Dot allows you to control your Raspberry Pi projects wirelessly. |
Sep 21, 2018 |
https://github.com/martinohanlon/BlueDot |
| 252. Blue Minimal |
de.baumann.thema |
Minimalistic CM12+ theme |
2017-05-15 |
https://github.com/scoute-dich/Baumann_Theme |
| 253. Blue Pair |
co.aurasphere.bluepair |
Simple open-source app for handling Bluetooth discovery and pairing. |
Jan 22, 2018 |
https://github.com/aurasphere/blue-pair |
| 254. BlueChat |
com.justadeveloper96.bluechat |
Chat anywhere using Bluetooth |
Aug 5, 2017 |
https://github.com/har5hit/BlueChat |
| 255. Bluebird Radio for Twitter (Abandoned) |
kai.twitter.voice |
Twitter abandoned streaming API.\nThis app cannot be working. |
Apr 21, 2017 |
https://github.com/Kjwon15/bluebirdradio |
| 256. Bluetooth Chat |
com.glodanif.bluetoothchat |
1-to-1 Bluetooth chatting app |
Sep 27, 2018 |
https://github.com/glodanif/BluetoothChat |
| 257. Bluetooth LE Analyzer |
com.github.akinaru.bleanalyzer |
Bluetooth Low Energy AD packet measurement app |
Jan 19, 2017 |
https://github.com/akinaru/RFdroid |
| 258. Bluetooth Scanner |
me.kevinvista.bluetoothscanner |
A tool to scan nearby Bluetooth devices. |
Jul 18, 2017 |
https://github.com/kevin-vista/bluetooth-scanner |
| 259. BoardGameGeek (Unofficial) |
com.boardgamegeek |
View information on your favorite board games and keep track of your collection. |
Aug 4, 2018 |
https://github.com/ccomeaux/boardgamegeek4android |
| 260. Boilermaker Toolbox |
com.atasoft.flangeassist |
Free app with Paycheque Calculator and various tools. |
Feb 27, 2018 |
https://github.com/ataboo/FlangeAssist |
| 261. Boilr |
mobi.boilr.boilr |
Pricealarm for Bitcoin, altcoins, assets & futures |
2017-01-02 |
https://github.com/drpout/boilr |
| 262. Bolte Chai |
com.aims.boltechai |
An App for verbal, non-verbal or autism child, to help them express their needs |
Feb 2, 2018 |
https://github.com/HamudiHasan/BolteChai |
| 263. Book Reader |
com.github.axet.bookreader |
Simple book reader |
2018-05-22 |
https://gitlab.com/axet/android-book-reader/tree/HEAD |
| 264. BookList |
com.ames.books |
Unofficial Google Books viewer |
2018-05-28 |
https://github.com/andviane/google-books-android-viewer |
| 265. Booky McBookface |
com.quaap.bookymcbookface |
An extremely unfancy and very basic ebook reader |
2018-04-10 |
https://github.com/quaap/BookyMcBookface |
| 266. Boom - Audio Player |
com.reyansh.audio.audioplayer.free |
Most elegant & light-weight music player with sound equaliser to play your audio |
May 27, 2018 |
https://github.com/reyanshmishra/Rey-MusicPlayer |
| 267. Borefts Beer Festival 2018 |
nl.brouwerijdemolen.borefts2013 |
Official companion app to the Borefts Beer Festival 2018 |
Sep 11, 2018 |
https://github.com/erickok/borefts2015 |
| 268. Botanist - Plant Care and Watering App |
com.scientists.happy.botanist |
The first app for plant health tracking and growth recording! |
Jan 9, 2018 |
https://github.com/iskandergaba/Botanist |
| 269. BoulderShare |
com.herak.bouldershare |
An app that lets you share boulder problems with your friends |
Oct 28, 2017 |
https://github.com/DarkokraD/BoulderShare |
| 270. BoxClub |
org.faudroids.boxclub |
Jump in the ring for a quick boxing by swinging your phone to simulate punches. |
May 15, 2018 |
https://github.com/FauDroids/BoxClub |
| 271. Brampton Transit Bus - MonTransit |
org.mtransit.android.ca_brampton_transit_bus |
Brampton Transit buses for MonTransit.\nSchedule. News. |
Oct 10, 2018 |
https://github.com/mtransitapps/ca-brampton-transit-bus-android |
| 272. Brandon Transit Bus - MonTransit |
org.mtransit.android.ca_brandon_transit_bus |
Brandon Transit Bus for MonTransit.\nSchedule… |
Jun 29, 2018 |
https://github.com/mtransitapps/ca-brandon-transit-bus-android |
| 273. BreatheWell Wear |
org.shepherd.breathewell |
Wearable app to help people use diaphragmatic breathing to manage stress |
Aug 19, 2018 |
https://github.com/ShepherdCenter/BreatheWell |
| 274. British Hills |
uk.colessoft.android.hilllist |
The Hills of Britain, now on your Android Smartphone or Tablet. |
Nov 3, 2017 |
https://github.com/colesadam/hill-lists |
| 275. Bucket - Overlay Manager |
com.jereksel.libresubstratum |
Bucket is UNOFFICIAL app for Substratum Theme Engine |
2017-12-15 |
https://github.com/jereksel/Bucket |
| 276. Buddha Voice |
com.oddsoft.buddhavoice2 |
Om mani padme hum |
Aug 12, 2018 |
https://github.com/ccjeng/BuddhaVoice |
| 277. Buddhist Prayers |
com.kinley_tshering.tangbi.khathuen |
Provides a list of daily prayers (ཁ་ཐུན) common in Bhutan |
May 25, 2017 |
https://github.com/kxt5258/moenlam |
| 278. Budget Watch |
protect.budgetwatch |
Help manage your personal budget |
2018-05-07 |
https://github.com/brarcher/budget-watch |
| 279. Budget |
com.notriddle.budget |
Manage your income and expenses |
2017-08-30 |
https://github.com/notriddle/budget-envelopes |
| 280. Bullseye |
x653.bullseye |
Scoreboard for tournament dart x01 |
2018-03-10 |
https://gitlab.com/x653/bullseye |
| 281. Buntata |
uk.ac.hutton.ics.buntata |
Plant disease identification on the go! |
Apr 26, 2018 |
https://github.com/buntata/buntata-app |
| 282. BurgerWP |
org.sasehash.burgerwp |
Get rid of your old boring Wallpaper and replace it with burgers and pizza |
2018-06-02 |
https://github.com/samsumas/LivingBurger |
| 283. Burlington Transit Bus - MonTransit |
org.mtransit.android.ca_burlington_transit_bus |
Burlington Transit buses for MonTransit.\nSchedule. News. |
Sep 4, 2018 |
https://github.com/mtransitapps/ca-burlington-transit-bus-android |
| 284. BusTO |
it.reyboz.bustorino |
Arrival times for Turin public transports |
2017-04-08 |
https://code.launchpad.net/bus-torino |
| 285. BusyBox |
ru.meefik.busybox |
Install BusyBox |
2018-04-24 |
https://github.com/meefik/busybox |
| 286. CARLS |
com.carls |
Carleton in your pocket! An unofficial Carleton app. |
May 9, 2018 |
https://github.com/carls-app/carls |
| 287. CNode社区 |
org.cnodejs.android.md |
CNode community of third-party Android client, Material Design style |
Aug 29, 2017 |
https://github.com/TakWolf/CNode-Material-Design |
| 288. COSCUP Pass |
org.coscup.ccip |
This year we use COSCUP Pass App to check-in. |
Aug 11, 2018 |
https://github.com/CPRTeam/CCIP-Android |
| 289. CPU Info (open-source) |
com.kgurgul.cpuinfo |
CPU Info provides information about device hardware and software. |
Sep 27, 2018 |
https://github.com/kamgurgul/cpu-info |
| 290. CPU Stats |
jp.takke.cpustats |
Compact CPU Usage Monitor |
Mar 5, 2018 |
https://github.com/takke/cpustats |
| 291. CRT Lanaudière Bus - MonTransit |
org.mtransit.android.ca_lanaudiere_crtl_bus |
CRT Lanaudière buses for MonTransit\nSchedule… |
Jul 28, 2018 |
https://github.com/mtransitapps/ca-lanaudiere-crtl-bus-android |
| 292. CS Teaching Labs |
me.echeung.cdflabs |
Check availibilty of computers at CDFLabs |
2017-04-19 |
https://github.com/arkon/CDFLabs |
| 293. CSCS Native Scripting |
ch.cscs.vk |
With CSCS (Customized Scripting in C#) you can create native iOS & Android apps |
Mar 18, 2018 |
https://github.com/vassilych/mobile |
| 294. Cache Cleaner |
com.frozendevs.cache.cleaner |
Clean the cache |
2017-04-04 |
https://github.com/Frozen-Developers/android-cache-cleaner |
| 295. Caffeine Tile |
info.zwanenburg.caffeinetile |
Keep your device from sleeping |
2017-01-22 |
https://github.com/otaconix/caffeinetile |
| 296. CalSPEED |
gov.ca.cpuc.calspeed.android |
CalSPEED measures the quality and speed of your mobile data connection. |
Jul 16, 2018 |
https://github.com/CalSPEED/CalSPEED-Android |
| 297. CalcMate (Calculator) |
com.gigabytedevelopersinc.app.calculator |
A very powerful multi-dimensional, multipurpose Calculator app for Android |
Sep 20, 2018 |
https://github.com/gigabytedevelopers/CalcMate |
| 298. Calculadora de notas Wyden |
com.rodolfosilva.devrycalc |
Wyden calculator for easy calculation of grades. |
Jun 27, 2017 |
https://github.com/RodolfoSilva/DeVryCalc |
| 299. Calculator |
com.simplemobiletools.calculator |
A calculator with the basic functions and a customizable widget. |
2018-05-16 |
https://github.com/SimpleMobileTools/Simple-Calculator |
| 300. Calendar Import-Export |
org.sufficientlysecure.ical |
Import/Export calendars via ics files |
2017-10-01 |
https://github.com/SufficientlySecure/calendar-import-export |
| 301. Calendar Notifications |
com.github.quarck.calnotify |
Advanced calendar notifications |
2018-05-14 |
https://github.com/quarck/CalendarNotification |
| 302. Calendar Trigger |
uk.co.yahoo.p1rpp.calendartrigger |
Trigger actions on calendar events |
2018-05-29 |
https://github.com/rparkins999/CalendarTrigger |
| 303. Calendar Widget |
com.plusonelabs.calendar |
Home-screen agenda |
2017-07-27 |
https://github.com/plusonelabs/calendar-widget |
| 304. Calendar |
com.simplemobiletools.calendar |
A simple calendar with events, customizable widget and no ads. |
2018-05-28 |
https://github.com/SimpleMobileTools/Simple-Calendar |
| 305. Calendouer (Douban Calendar) |
cn.sealiu.calendouer |
Lunar Calendar, Weather and Movie Recommendation |
May 20, 2017 |
https://github.com/SEALiu/Calendouer |
| 306. Calendula |
es.usc.citius.servando.calendula |
Manage medical prescription |
2018-05-14 |
https://github.com/citiususc/calendula |
| 307. Calgary Transit Bus - MonTransit |
org.mtransit.android.ca_calgary_transit_bus |
Calgary Transit buses for MonTransit.\nSchedule. News. |
Oct 5, 2018 |
https://github.com/mtransitapps/ca-calgary-transit-bus-android |
| 308. Calgary Transit CTrain - MonTransit |
org.mtransit.android.ca_calgary_transit_train |
Calgary Transit CTrains for MonTransit.\nSchedule. News. |
Oct 5, 2018 |
https://github.com/mtransitapps/ca-calgary-transit-train-android |
| 309. Call Confirm |
com.nagopy.android.callconfirm |
Stop unintended calling.\n(Free, Ad-Free and Open Source) |
Dec 24, 2017 |
https://github.com/75py/CallConfirm |
| 310. Call Meter 3G: THE monitor app |
de.ub0r.android.callmeter |
Never spend too much! |
May 24, 2018 |
https://github.com/felixb/callmeter |
| 311. Call Recorder |
com.github.axet.callrecorder |
Simple call recorder, no ads, open-source |
2018-06-04 |
https://gitlab.com/axet/android-call-recorder/tree/HEAD |
| 312. Camera As Light Sensor |
denis.develops.utils.lightsensor |
Get illumination value by camera sensor. |
Aug 2, 2018 |
https://github.com/0lvin/LightSensor |
| 313. Camera Roll |
us.koller.cameraroll |
Camera Roll |
2018-05-14 |
https://github.com/kollerlukas/Camera-Roll-Android-App |
| 314. Camera |
com.simplemobiletools.camera |
A camera with flash, zoom and no ads. |
2018-05-16 |
https://github.com/SimpleMobileTools/Simple-Camera |
| 315. Campus Guide - University of Ottawa |
ca.josephroque.campusguide |
Welcome to your University of Ottawa Campus Guide! |
Sep 2, 2018 |
https://github.com/joseph-roque/uOttawaCampusGuide |
| 316. Can I Coffee? |
com.omatt.canicoffee |
Calculate the best time to drink coffee. |
Oct 3, 2018 |
https://github.com/omatt/canicoffee |
| 317. Candid |
in.voiceme.app.voiceme |
Candid is a social media app where people post anonymous confessions. |
Oct 7, 2018 |
https://github.com/sciage/FinalProject |
| 318. Candy Memory |
se.tube42.kidsmem.android |
Match-two memory game |
2018-02-20 |
https://github.com/tube42/candymem |
| 319. CandyBox - App for Candybooru |
org.quna.candybox |
Unofficial Android Wrapper for Candybooru, a Fan-art Site for BCB Comic. |
Jul 27, 2017 |
https://github.com/qtwyeuritoiy/CandyBox |
| 320. Capitole du Libre |
org.toulibre.capitoledulibre |
Schedule browser for the Capitole du Libre |
2017-11-24 |
https://github.com/capitoledulibre/cdl-companion-android |
| 321. Car Report |
me.kuehle.carreport |
Track your car costs |
2018-06-04 |
https://bitbucket.org/frigus02/car-report/src |
| 322. Caramelos |
com.dfzlv.gjjlt.caramelos |
Casual game made with Libgdx |
2017-10-08 |
https://github.com/luarca84/Caramelos |
| 323. Carbon Contacts |
abhijith.carboncontacts |
Duplicate contacts are a mess, aren't they? |
Feb 12, 2017 |
https://github.com/abhijith0505/CarbonContacts |
| 324. Carina Kalkulator |
com.vacosoftware.carinakalkulator |
Calculates the value of import duty and VAT when importing products in country |
Aug 3, 2017 |
https://github.com/vaco-software/carina |
| 325. Catan Dice Game |
com.ridgelineapps.resdicegame |
Resource dice game |
2017-07-18 |
https://github.com/Bubu/android-dice-game |
| 326. CaveSurvey |
com.astoev.cave.survey |
Cave surveying with Bluetooth enabled devices and the build-in sensors |
May 13, 2018 |
https://github.com/lz1asl/CaveSurvey |
| 327. Ceaseless Prayer |
org.theotech.ceaselessandroid |
Pray for 3 friends each day and together we can pray for everyone on earth. |
Jul 28, 2018 |
https://github.com/ceaseless-prayer/CeaselessAndroid |
| 328. Cemetery Surveyor |
net.frakturmedia.cemeterysurvey |
A flexible cemetery research surveying tool. |
Mar 15, 2018 |
https://github.com/serialc/CemeterySurveyor |
| 329. Central Fraser Valley TS Bus - MonTransit |
org.mtransit.android.ca_central_fraser_valley_transit_system_bus |
Central Fraser Valley Transit buses for MonTransit.\nSchedule. Alerts. News. |
Oct 5, 2018 |
https://github.com/mtransitapps/ca-central-fraser-valley-transit-system-bus-android |
| 330. Chain React Conf |
com.chainreactapp |
The live-updated schedule in your pocket for Chain React Conf |
Jul 11, 2018 |
https://github.com/infinitered/ChainReactApp |
| 331. Chalkboard - School, Timetable & Homework Planner |
com.ghofrani.classapp |
Chalkboard - Manage your classes, homework and exams with ease. |
Aug 22, 2018 |
https://github.com/arminghofrani/chalkboard |
| 332. Chalmers Card Balance |
se.creotec.chscardbalance2 |
Quickly and easily check your Chalmers card balance - never be worried again! |
Sep 10, 2018 |
https://github.com/hsson/card-balance-app |
| 333. Chameleon Live Wallpaper KLWP |
arun.com.chameleonskinforkwlp |
Create color adapting live wallpaper setups! |
Apr 15, 2017 |
https://github.com/arunkumar9t2/chameleon-live-wallpaper |
| 334. Changelog |
org.polaric.cyanogenmodchangelog |
View CM changelog |
2017-01-27 |
https://git.polaric.org/polaric/CMLog/tree/master |
| 335. Chaquopy: Python 2 for Android |
com.chaquo.python.demo |
Demo app of Chaquopy, the Python SDK for Android |
Aug 22, 2018 |
https://github.com/chaquo/chaquopy |
| 336. Charleroi Airport - Departures & Arrivals |
net.bertware.flybsca |
Arrivals, departures and notifications for Brussels South Charleroi Airport BSCA |
Sep 26, 2018 |
https://github.com/Bertware/FlyBSCA |
| 337. Chat with strangers |
com.talktostrangers |
Chat with strangers and meet new friends online. No registration required. |
May 22, 2018 |
https://github.com/graetzer/TalkToStrangers |
| 338. Cheat book |
maximsblog.blogspot.com.formuladict |
The application is an assistant to a schoolboy and a student. |
Nov 7, 2017 |
https://github.com/mksmbrtsh/formulaDict |
| 339. Check Network |
org.zephyrsoft.checknetwork |
Auto connect to network |
2017-02-20 |
https://github.com/mathisdt/checknetwork |
| 340. Checkers |
org.secuso.privacyfriendlydame |
Strategy board game for one or two players |
2018-06-02 |
https://github.com/SecUSo/privacy-friendly-dame |
| 341. Checklist |
org.sanpra.checklist |
A simple app used to maintain a to-do list |
Jul 1, 2018 |
https://github.com/sandy-8925/Checklist |
| 342. Chemistry game |
com.Misho.Chemistry |
Chemistry game is an interesting and very addictive puzzle game. |
Jan 19, 2018 |
https://github.com/mishop/2048-chemistry-android |
| 343. Cherry |
de.live.gdev.cherrymusic |
Wrapper for CherryMusic |
2017-12-04 |
https://github.com/gsantner/cherrymusic-android |
| 344. Chess |
jwtc.android.chess |
Chess. Practice, puzzle, play online and many more features. Enjoy chess. |
Aug 11, 2018 |
https://github.com/TimmyT123/android-chess |
| 345. Chibe |
com.jmstudios.chibe |
Vibrates to remind you of the time |
2017-03-15 |
https://github.com/raatmarien/chibe |
| 346. Chicago Commutes - CTA Divvy |
fr.cph.chicago |
Chicago Commutes is a new transit tracker making it easier to travel in Chicago |
Oct 4, 2018 |
https://github.com/carlphilipp/chicago-commutes |
| 347. Chilliwack Transit System Bus - MonTransit |
org.mtransit.android.ca_chilliwack_transit_system_bus |
Chilliwack Transit System buses for MonTransit.\nSchedule. Alerts. News. |
Sep 22, 2018 |
https://github.com/mtransitapps/ca-chilliwack-transit-system-bus-android |
| 348. Chinese Calendar Widget (中國農曆小工具) |
hk.ccw.chinesecalendarwidget |
A Chinese Calendar Widget |
Aug 3, 2018 |
https://github.com/HairyRobot/ChineseCalendarWidget |
| 349. Chinese Checkers |
org.scoutant.cc |
Chinese Checkers is a strategy board game. Can be used off-line. No ads! |
Oct 1, 2018 |
https://github.com/hongsenliu/chinese-checkers |
| 350. Chinese Remainder Clock |
name.cantanima.chineseremainderclock |
Time in a format you can reconstruct using the Chinese Remainder Theorem. |
Sep 18, 2017 |
https://github.com/johnperry-math/Chinese-Remainder-Clock |
| 351. Chip8 |
com.dkanada.chip |
Chip8 emulator |
2018-02-22 |
https://github.com/dkanada/Chip8 |
| 352. Chroma Doze |
net.pmarks.chromadoze |
Noise generator |
2018-02-06 |
https://github.com/pmarks-net/chromadoze |
| 353. Chromium SWE Updater |
chromiumupdater.bamless.com.chromiumsweupdater |
Update custom Chromium for Snapdragon builds |
2017-05-29 |
https://github.com/bamless/chromium-swe-updater |
| 354. Cineaste |
de.cineaste.android |
Find the perfect movie for you and your friends at a shared movie night! |
Jul 11, 2018 |
https://github.com/marcelgross90/Cineaste |
| 355. Circles |
com.coolone.circles |
Relaxing animation ellipses. |
Jan 22, 2017 |
https://github.com/CoolONEOfficial/Circles |
| 356. Circo - Icon Pack |
com.mookie.circo |
Icon pack with clean simple colorful circles |
Feb 16, 2018 |
https://github.com/MalcolmScruggs/CircoIconPack |
| 357. CityZen |
com.cityzen.cityzen |
City navigation app |
2017-10-11 |
https://github.com/CityZenApp/Android-Development |
| 358. Clevelevator |
com.goodcodeforfun.clevelevator |
Wasting your time during a ride on the elevator? Why not do math instead? |
Apr 8, 2017 |
https://github.com/snigavig/clevelevator |
| 359. Clip Stack - Clipboard Manager |
com.catchingnow.tinyclipboardmanager |
Multi Clipboard History Manager App & Viewer Tool\n✓Free ✓No-Ads ✓Material Design |
Nov 19, 2017 |
https://github.com/heruoxin/Clip-Stack |
| 360. Clock widget |
community.fairphone.clock |
Add Fairphone clock widget to your homescreen |
2017-05-31 |
https://github.com/WeAreFairphone/android_packages_apps_ClockWidget |
| 361. Clock+ |
com.philliphsu.clock2 |
View time, set alarms and timers |
2017-03-10 |
https://github.com/philliphsu/ClockPlus |
| 362. Clock |
com.simplemobiletools.clock |
A combination of a clock, alarm, stopwatch and timer. |
2018-05-29 |
https://github.com/SimpleMobileTools/Simple-CLock |
| 363. Clover |
org.floens.chan |
Imageboard browser |
2018-04-30 |
https://github.com/Floens/Clover |
| 364. Cluttr |
org.polaric.cluttr |
A fast, beautiful, and well designed photo gallery |
Aug 5, 2017 |
https://github.com/garretyoder/Cluttr |
| 365. Cmus Remote |
com.joshtwigg.cmus.droid |
Remotely control CMUS instances |
2017-06-14 |
https://github.com/jatwigg/cmus-android-remote |
| 366. CoCoRaHS Observer |
com.appcay.cocorahs |
CoCoRaHS Observer lets you submit your daily precipitation reports to CoCoRaHS. |
Sep 17, 2018 |
https://github.com/sjwoodr/CoCoRaHS |
| 367. Coco Wiggler 4 |
nz.co.canadia.cocowiggler4 |
Coco is back and in the grass |
Mar 3, 2018 |
https://github.com/anhinton/CocoWiggler4 |
| 368. CodeBoard Keyboard for Coding |
com.gazlaws.codeboard |
All the symbols you need to code in one place |
Jun 19, 2018 |
https://github.com/gazlaws-dev/codeboard |
| 369. Coding - 代码托管，项目管理，WebIDE |
net.coding.program |
Coding.net 云端软件开发协作平台，为开发者提供了代码托管、项目管理、WebIDE 、Pages 等云开发工具，让开发更简单！ |
Jul 23, 2018 |
https://github.com/jiangecho/coding_maopao |
| 370. Coffee Companion |
com.brewguide.android.coffeebrewguide |
A lightweight companion and reference for coffee enthusiasts. |
Sep 17, 2017 |
https://github.com/pattrickrice/Coffee-Brew-Guide |
| 371. Coin Collection |
com.spencerpages |
Coin Collection helps users keep track of which U.S. coins they already have |
Feb 11, 2018 |
https://github.com/sw23/coin-collection-android |
| 372. ColombiaSIVigila |
com.vigilatusalud_v3 |
To estimate the magnitude of the events of interest in public health. |
Mar 3, 2017 |
https://github.com/Iliumint/sivigila-salud |
| 373. Colorful Pixel Wallpaper |
at.connyduck.pixelwallpaper |
A beautiful Live-Wallpaper with randomly generated pixels |
Aug 20, 2017 |
https://github.com/connyduck/pixelwallpaper |
| 374. Colorpicker |
com.enrico.sample |
Pick colors and display values |
2017-06-14 |
https://github.com/enricocid/Color-picker-library |
| 375. Comfort Reader |
com.mschlauch.comfortreader |
Streams text directly to your eyes |
2018-04-21 |
https://github.com/mschlauch/comfortreader |
| 376. Comic Strip Live Wallpaper |
com.whp.wallpaper.comicstrip |
Live Wallpaper like a comic strip |
Oct 3, 2018 |
https://github.com/walterpalladino/cslwp |
| 377. Comics Reader |
net.kervala.comicsreader |
A lightweight open source comics reader for Android under GPLv3 license. |
Sep 21, 2018 |
https://github.com/pfalcon/PhotoTvViewer |
| 378. CommCare |
org.commcare.dalvik |
CommCare is a mobile platform that supports frontline workers (FLWs). |
Jul 23, 2018 |
https://github.com/dimagi/commcare-android |
| 379. CommonsLab |
com.commonslab.commonslab |
Browse and contribute Wikimedia Commons |
2017-08-30 |
https://github.com/CommonsLab/CommonsLab |
| 380. CommonsLab |
org.wikimedia.commons.wikimedia |
Browse and contribute Wikimedia Commons |
2017-04-13 |
https://github.com/CommonsLab/CommonsLab |
| 381. Commons |
fr.free.nrw.commons |
Upload images to wikimedia.org |
2018-04-21 |
https://github.com/commons-app/apps-android-commons |
| 382. Comox Valley Transit System Bus - MonTransit |
org.mtransit.android.ca_comox_valley_transit_system_bus |
Comox Valley Transit System buses for MonTransit.\nSchedule. Real time. News. |
Oct 3, 2018 |
https://github.com/mtransitapps/ca-comox-valley-transit-system-bus-android |
| 383. Companion for Microsoft Band |
com.pimp.companionforband |
The only app you will need for your Microsoft band |
Jul 17, 2017 |
https://github.com/adithya321/Companion-for-Band |
| 384. Compass |
com.sevencrayons.compass |
Open source compass application. |
Apr 14, 2018 |
https://github.com/iutinvg/compass |
| 385. Complex |
com.nao20010128nao.DroidComplex |
Inspect Complex Number Quickly |
Oct 25, 2017 |
https://github.com/nao20010128nao/DroidComplex |
| 386. Computing Tutor |
net.computingtutor.robert.computingtutor |
computingtutor.net for Android |
Oct 24, 2017 |
https://github.com/robnixon/ComputingTutorAndroidApp |
| 387. Configure Autologin |
com.juliansparber.captiveportallogin |
Automatically log into networks with captive portal |
2017-04-23 |
https://github.com/jsparber/CaptivePortalAutologin/ |
| 388. Conjugaison Française |
com.xengar.android.conjugaisonfrancaise |
Learn french verbs. Conjugate verbs. |
Oct 6, 2018 |
https://github.com/an-garcia/conjugaisonfrancaise |
| 389. ConnectBot |
org.connectbot |
SSH and local shell client |
2017-03-17 |
https://github.com/connectbot/connectbot |
| 390. Contacts |
com.simplemobiletools.contacts |
A contacts app for managing your contacts without ads. |
2018-05-16 |
https://github.com/SimpleMobileTools/Simple-Contacts |
| 391. Contador de Mus |
es.davidpob99.ContadorMus |
Un simple contador para partidas de mus |
Aug 31, 2018 |
https://github.com/davidpob99/ContadorMus |
| 392. Content Provider Helper |
de.k3b.android.contentproviderhelper |
Discover, view and query data of content providers |
2017-04-27 |
https://github.com/k3b/ContentProviderHelper |
| 393. Contraction Timer |
com.ianhanniballake.contractiontimer |
Track your contractions and automatically calculate their duration and frequency |
Aug 25, 2018 |
https://github.com/ianhanniballake/ContractionTimer |
| 394. Conversations Legacy |
eu.siacs.conversations.legacy |
Chat using the XMPP network |
2018-05-03 |
https://github.com/siacs/Conversations/tree/legacy |
| 395. Conversations |
eu.siacs.conversations |
A Jabber/XMPP chat client |
2018-06-02 |
https://github.com/siacs/Conversations |
| 396. Convert Units |
com.defianttech.convertme |
Unit conversion tool, with optional home screen widget. |
Oct 14, 2018 |
https://github.com/dbrant/unitconverter-android |
| 397. Cookvert – Unit conversions for cooking |
com.cookvert |
Convert units, save recipes and make shopping lists with this handy kitchen tool |
Aug 31, 2018 |
https://github.com/vogelfanger/cookvert |
| 398. Cool Mic |
cc.echonet.coolmicapp |
Live broadcasting / livestreaming from your microphone or line-input to Icecast! |
Sep 24, 2018 |
https://github.com/CoolMicApp/CoolMicApp-Android |
| 399. Coordinate |
org.wheatgenetics.coordinate |
Coordinate is used to collect data that's organized in grids |
Jul 2, 2018 |
https://github.com/trife/Coordinate |
| 400. Copay Bitcoin Wallet |
com.bitpay.copay |
Secure bitcoin on your own terms with an open,multisignature wallet from BitPay |
Oct 17, 2018 |
https://github.com/Tetpay/copay |
| 401. Cornwall Transit TheBus - MonTransit |
org.mtransit.android.ca_cornwall_transit_bus |
Cornwall Transit TheBus for MonTransit.\nSchedule… |
Jul 14, 2018 |
https://github.com/mtransitapps/ca-cornwall-transit-bus-android |
| 402. Cortrium ECG Monitor |
com.cortrium.cortriumc3 |
Cortrium's ECG monitor app. Connects to Cotrium C3 wearable ECG Holter monitor. |
May 31, 2017 |
https://github.com/cortrium/AndroidApp |
| 403. CosyDVR |
es.esy.CosyDVR |
Video recording (DVR) software for in-car use |
2018-02-20 |
https://github.com/sergstetsuk/CosyDVR |
| 404. Count The Days |
sreich.countthedays |
Create counters to count the days since or the days until any date. |
Feb 20, 2017 |
https://github.com/sreich/android-count-the-days |
| 405. Countdown |
com.mauriciotogneri.countdown |
Don't release the button before your opponent but do it before going under zero! |
Sep 19, 2018 |
https://github.com/vndly/countdown |
| 406. Counter +1 |
ralr.countersomething |
A simple elegant counter |
Oct 13, 2018 |
https://github.com/rulogarcillan/CounterSomething |
| 407. Counter Man |
sergey.zhuravel.munchkin |
A simple level counter for the popular Munchkin® card game |
Oct 15, 2017 |
https://github.com/eroy/munchkin |
| 408. Counter |
me.tsukanov.counter |
Tally counter |
2017-10-26 |
https://github.com/gentlecat/Simple-Counter/ |
| 409. Court Counter |
ideaman924.courtcounter |
Court Counter\nCount your scores |
Sep 29, 2018 |
https://github.com/ideaman924/courtcounter |
| 410. Crates.io unofficial |
com.bmco.cratesiounofficial |
Rust crates.io browsing app |
2017-11-28 |
https://github.com/TheUberCatman/crates-io-android |
| 411. Crazyflie Client |
se.bitcraze.crazyfliecontrol2 |
Control your Crazyflie using Bluetooth LE or the USB Crazyradio |
Sep 12, 2018 |
https://github.com/bitcraze/crazyflie-android-client |
| 412. Credit Card Expense Manager |
ve.com.abicelis.creditcardexpensemanager |
Keep an eye on your credit card balance. Manage your expenses! |
Sep 20, 2018 |
https://github.com/abicelis/CreditCardExpenseManager |
| 413. Critical Maps |
de.stephanlindauer.criticalmaps |
Critical mass location sharing and chat |
2017-08-30 |
https://github.com/CriticalMaps/criticalmaps-android |
| 414. Critical Velocity |
com.alaskalinuxuser.criticalvelocity |
Side scrolling arcade style game |
2017-07-09 |
https://github.com/alaskalinuxuser/app_critical_velocity |
| 415. CrossWords |
org.eehouse.android.xw4 |
A Scrabble-like game |
2017-12-04 |
http://xwords.sourceforge.net/source.php |
| 416. Crosswalk Project Runtime |
org.xwalk.core |
An application you just installed requires the Crosswalk Project Runtime |
Jan 23, 2017 |
https://github.com/berthnipub/cordova-plugin-crosswalk-webview |
| 417. Crossword |
org.billthefarmer.crossword |
Simple crossword solver |
2018-04-20 |
https://github.com/billthefarmer/crossword |
| 418. CrowdSense |
org.sensingkit.crowdsensing_android |
An application for capturing sensor data into your device's memory. |
Aug 17, 2017 |
https://github.com/SensingKit/CrowdSense-Android |
| 419. Crowdsourcing experiments |
openscience.crowdsource.experiments |
Participate in experiment crowdsourcing to help solve complex research problems! |
Aug 3, 2018 |
https://github.com/dsavenko/crowdsource-experiments-using-android-devices |
| 420. CryptoPass |
krasilnikov.alexey.cryptopass |
Strong passwords for different websites using a single secret key |
2017-05-30 |
https://bitbucket.org/zeac/cryptopass/src |
| 421. Cryptogram |
com.pixplicity.cryptogram |
Decipher the hidden text to reveal the motivational quote! |
Sep 24, 2018 |
https://github.com/pflammertsma/cryptogram |
| 422. Cube Droid |
com.threeDBJ.puzzleDroidFree |
An ad free, full featured, multi-dimensional cube |
Sep 4, 2017 |
https://github.com/sampullman/android-PuzzleDroid |
| 423. CuprumPDF |
org.ninthfloor.copperpdf |
View PDF files |
2017-02-12 |
https://github.com/paride/CopperPDF |
| 424. Currency BG |
net.vexelon.currencybg.app |
Get the latest Bulgarian Lev (BGN) currency and crypto exchange rates now. |
Mar 3, 2018 |
https://github.com/vexelon-dot-net/currencybg.app |
| 425. Currency and Stock Widget |
ru.besttuts.stockwidget |
Track changes of exchange rates, oil and gold prices, stocks and indices. |
Aug 28, 2017 |
https://github.com/romanchekashov/currency-and-stock-widget |
| 426. Currency |
org.billthefarmer.currency |
Currency conversion |
2018-06-04 |
https://github.com/billthefarmer/currency |
| 427. Curve Fit - Tools |
com.bragitoff.curvefit_leastsquares |
Find out the best fit for a set of data-points. |
Jan 14, 2018 |
https://github.com/manassharma07/Curve_Fitting-AndroidApp |
| 428. Custom Battery Notify |
ru.olegsvs.custombatterynotification |
Allows you to display a notification containing percentage and battery status. |
May 20, 2017 |
https://github.com/olegsvs/ru.olegsvs.custombatterynotification |
| 429. Custom Maps |
com.custommapsapp.android |
Use almost any map image as offline GPS map. |
Mar 25, 2018 |
https://github.com/gmolina75/custom-maps |
| 430. Cythara |
com.github.cythara |
Musical instrument tuner |
2018-05-16 |
https://github.com/gstraube/cythara |
| 431. Cytoid: A Community Music Game |
me.tigerhix.cytoid |
A music game powered by players like you. |
Aug 1, 2018 |
https://github.com/TigerHix/Cytoid |
| 432. D00R |
com.hasi.hasid00r |
Unlock the door at Hackspace Siegen |
2017-01-14 |
https://github.com/h42i/d00r-app |
| 433. DAPNET |
de.hampager.dapnetmobile |
Send and read calls to and from DAPNET |
2018-04-14 |
https://github.com/DecentralizedAmateurPagingNetwork/DAPNETApp |
| 434. DAVdroid |
at.bitfire.davdroid |
Sync contacts, calendars and tasks with CalDAV/CardDAV |
2018-05-29 |
https://www.davdroid.com/source/ |
| 435. DBZ Battery Widget |
com.tomer.dbz.widget |
View your battery status with your favorite DBZ character |
2017-09-27 |
https://github.com/rosenpin/DBZ-Battery-Widget |
| 436. DETERGO |
io.github.gregpdessch.detergo |
A basic app estimating how much laundry detergent is needed to wash clothes. |
Aug 15, 2017 |
https://github.com/GregPDesSCH/DETERGO |
| 437. DIEMS App |
org.diems.diemsapp |
An Application to upload and display college notices for Students and Staff. |
Aug 21, 2017 |
https://github.com/vaidehikulkarni/diems-class-test |
| 438. DMS Explorer (DLNA Player) |
net.mm2d.dmsexplorer |
This is a kind of DLNA player. |
Oct 13, 2018 |
https://github.com/ohmae/DmsExplorer |
| 439. DNS66 |
org.jak_linux.dns66 |
Block ads/hosts via DNS |
2017-11-28 |
https://github.com/julian-klode/dns66 |
| 440. DNT SjekkUT |
no.dnt.sjekkut |
Check out your neighborhood trails with its app with turposter across the country |
Jun 26, 2017 |
https://github.com/Turistforeningen/SjekkUT |
| 441. DSC Auto Rename |
ro.ciubex.dscautorename |
Rename picutres based on date |
2017-03-29 |
https://github.com/ciubex/dscautorename |
| 442. DSub for Subsonic |
github.daneren2005.dsub |
Best client for Subsonic servers with continual improvements and new features! |
Sep 27, 2018 |
https://github.com/KBerstene/Subsonic |
| 443. DVR Commander for TiVo® |
com.arantius.tivocommander |
Control your TiVo device. Browse shows, schedule recordings, and remote control. |
Apr 1, 2018 |
https://github.com/arantius/TiVo-Commander |
| 444. DWA Plug-in for Android Wear |
org.deviceconnect.android.deviceplugin.wear |
It is the Android Wear plug-in that runs on the Device Web API system. |
Mar 29, 2018 |
https://github.com/ssdwa/common |
| 445. DadosD |
com.tmendes.dadosd |
Generate Brazilian test IDs for development/test |
2017-02-24 |
https://gitlab.com/tmendes/DadosD |
| 446. Daedalus |
org.itxtech.daedalus |
No root required Android DNS modifier and Hosts/DNSMasq resolver. |
Oct 6, 2018 |
https://github.com/iTXTech/Daedalus |
| 447. Daily Dhamma - Indonesia |
red.point.dailydhamma |
Debriefing by various religious leaders, especially Theravada Buddhism. |
Sep 7, 2018 |
https://github.com/bgd-point/daily-dhamma |
| 448. Daily Dozen |
org.nutritionfacts.dailydozen |
Keep track of the foods that Dr Greger recommends in his book How Not to Die |
2018-02-16 |
https://github.com/nutritionfactsorg/daily-dozen-android |
| 449. Daily Wagers |
com.rishi.dailywagers |
Simple record keeping for daily services taken |
Aug 27, 2017 |
https://github.com/rishirajrandive/dailywagers |
| 450. Das Kinderserien-Quiz 📺🎶 |
de.selectcode.kinderserienquiz |
🌟Errate your children's series based on their theme songs - Can you make all 📺🎶? |
Jan 13, 2018 |
https://github.com/flobaader/KinderserienQuiz |
| 451. Dashboard for Pebble |
com.wordpress.ninedof.dashboard |
Pebble watchapp allowing control of phone features and viewing of phone status. |
Aug 19, 2017 |
https://github.com/C-D-Lewis/dashboard |
| 452. Data Capture for DHIS 2 |
org.dhis2.mobile |
Data capturing app for DHIS 2 |
Aug 8, 2018 |
https://github.com/dhis2/dhis2-android-datacapture |
| 453. DataStats |
jp.takke.datastats |
View bandwith usage |
2017-09-16 |
https://github.com/takke/DataStats |
| 454. Date Calculator |
info.culebrasgis.calculadoradefechas |
A date calculator for Android. |
Jan 8, 2017 |
https://github.com/culebras/CalculadoraDeFechas |
| 455. Day and night clock |
com.firebirdberlin.nightdream |
a simple DayDream clock that dims at night, but is bright during the day. |
Oct 1, 2018 |
https://github.com/firebirdberlin/nightdream |
| 456. DayCounter |
com.agusyc.daycounter |
DayCounter is an app designed for counting days since or until an event. |
Oct 13, 2017 |
https://github.com/Agusyc/DayCounter |
| 457. Dead Ascend |
com.blackgrain.android.deadascend.ad |
Open source point'n'click adventure game made with Qt (QML & Javascript). |
Apr 6, 2018 |
https://github.com/Larpon/DeadAscend |
| 458. Debt Manager |
com.chikeandroid.debtmanager |
A personal app to store details of people that you owe or owe you money. |
Jun 21, 2017 |
https://github.com/kolocoda/Debt-Manager |
| 459. Deck |
com.github.laurenttreguier.deck |
A simple archive manager for storing cards from the Sola application. |
Dec 8, 2017 |
https://github.com/LaurentTreguier/deck |
| 460. Deep OBD for BMW and VAG |
de.holeschak.bmw_deep_obd |
Deep OBD analysis for BMW and VAG cars like INPA or Tool32 (expert tool) |
Oct 18, 2018 |
https://github.com/uholeschak/ediabaslib |
| 461. Defendo |
ir.hsn6.defendo |
A tower defense game |
2017-10-18 |
https://github.com/HassanHeydariNasab/defendo |
| 462. Delern Flashcards |
org.dasfoo.delern |
Spaced repetition learning system |
Oct 10, 2018 |
https://github.com/dasfoo/delern |
| 463. Delta - Icon Pack |
website.leifs.delta |
Delta is a minimalistic pastel Icon Pack for many Android Launchers available. |
Apr 4, 2018 |
https://github.com/leifniem/Delta-Icons |
| 464. Delta Chat |
com.b44t.messenger |
Communicate instantly via e-mail |
2018-05-21 |
https://github.com/deltachat/deltachat-android |
| 465. Democracy Droid |
com.workingagenda.democracydroid |
Watch \Democracy Now The war and peace report|2018-06-02 |
https://github.com/fenimore/DemocracyDroid |
|
| 466. Dentacare - Health Training |
com.dentacoin.dentacare |
Dentacare Health Training – earn money by developing healthy dental care habits. |
Jul 12, 2018 |
https://github.com/Dentacoin/aftercare-app-android |
| 467. Deployment Tracker |
com.tortel.deploytrack |
A simple and attractive application for tracking deployments. |
Apr 24, 2018 |
https://github.com/Tortel/DeployTrack |
| 468. Derandom |
org.asnelt.derandom |
Pseudo random number predictor |
2017-08-22 |
https://github.com/asnelt/derandom |
| 469. Desno365's MCPE Mods |
com.desno365.mods |
Download, use and play with some awesome Minecraft Pocket Edition Mods! |
Nov 3, 2017 |
https://github.com/Desno365/Desno365sMods |
| 470. Developer Tools |
com.roysolberg.android.developertools |
The tools you need as a developer for Android! |
Aug 17, 2018 |
https://github.com/roys/java-android-developertools |
| 471. Devinettes |
com.workingagenda.devinettes |
A collection of riddles in verse |
2017-05-27 |
https://github.com/polypmer/devinettes-android |
| 472. Dialer for Pebble |
com.matejdro.pebbledialer |
Improved call interface for Pebble |
Oct 19, 2017 |
https://github.com/matejdro/PebbleDialer-Android |
| 473. Diary |
org.billthefarmer.diary |
Personal diary or journal |
2018-05-06 |
https://github.com/billthefarmer/diary |
| 474. Dib2Qm |
net.sourceforge.dibdib.android.dib2qm |
Messenger for secured chats and groups |
2018-05-25 |
https://gitlab.com/gxworks/Dib2Qm/tree/HEAD |
| 475. Dice Game |
org.secuso.privacyfriendlyyahtzeedicer |
Play dice game with 5 dice |
2017-10-18 |
https://github.com/SecUSo/privacy-friendly-dice-game |
| 476. Diceware Password Generator |
com.aptasystems.dicewarepasswordgenerator |
Diceware Password Generator creates strong passwords using the Diceware method. |
May 14, 2018 |
https://github.com/jeffisaak/diceware-pass-gen |
| 477. Dice |
at.hgz.dice |
Dice App for Android |
Oct 15, 2018 |
https://github.com/hgzojer/dice |
| 478. DictionaryForMIDs |
de.kugihan.dictionaryformids.hmi_android |
A multi-purpose, offline dictionary & word translation application |
2018-04-24 |
http://dictionarymid.sourceforge.net/android.html |
| 479. Diet Diary |
com.canyapan.dietdiaryapp |
Track your daily diet. |
Nov 22, 2017 |
https://github.com/canyapan/DietDiaryApp |
| 480. Diode |
in.shick.diode |
Interact with Reddit |
2017-05-27 |
https://github.com/zagaberoo/diode |
| 481. Diplicity |
se.oort.diplicity |
Destroy your enemies, then destroy your friends. |
Oct 18, 2018 |
https://github.com/zond/android-diplicity |
| 482. Dir |
com.veniosg.dir |
Modern file manager |
2018-01-26 |
https://github.com/veniosg/Dir |
| 483. Disable Battery Warnings |
ca.cmetcalfe.xposed.disablebatterywarnings |
Disable the annoying low battery warning popup and sound |
2017-10-18 |
https://github.com/pR0Ps/DisableBatteryWarnings |
| 484. Discourse |
com.discourse |
Discourse notifier and browser |
Jun 26, 2018 |
https://github.com/ujwalramesh/REHU-discourse |
| 485. Discover Similar Artists |
newscavazzini.similarartists |
Find artists and bands similar to the ones you like. |
Aug 20, 2017 |
https://github.com/newtonscavazzini/SimilarArtists |
| 486. DiskUsage |
com.google.android.diskusage |
Disk usage explorer |
2017-08-30 |
https://github.com/IvanVolosyuk/diskusage |
| 487. DistroHopper • The Linux desktop in your pocket |
be.robinj.distrohopper |
The Linux desktop on your Android device! (Formerly known as Ubuntu Launcher.) |
Oct 13, 2018 |
https://github.com/RobinJ1995/DistroHopper |
| 488. Document Viewer |
org.sufficientlysecure.viewer |
Viewer for many document formats |
2018-02-11 |
https://github.com/SufficientlySecure/document-viewer |
| 489. Doda The Exploda |
com.quaap.dodatheexploda |
Hidden objects game for kids and adults |
2017-07-02 |
https://github.com/quaap/DodaTheExploda |
| 490. DoliDroid |
com.nltechno.dolidroidpro |
Use Dolibarr ERP & CRM |
2017-01-24 |
https://git.framasoft.org/eldy/dolidroid/tree/develop |
| 491. Dolphin Emulator |
org.dolphinemu.dolphinemu |
Nintendo console emulator |
2018-02-28 |
https://github.com/dolphin-emu/dolphin |
| 492. Domodroid |
org.domogik.domodroid13 |
Interface with a Domogik home automation server |
2017-07-19 |
https://github.com/domogik/domodroid |
| 493. Don du Sang |
fr.mobdev.blooddonation |
Locate French Blood Donation Center of French Establishment of Blood (EFS) |
2017-10-18 |
https://git.mob-dev.fr/Schoumi/BloodDonation |
| 494. Doom idgames Archive |
nl.exl.doomidgamesarchive |
Browse and search the Doomworld /idgames archive! |
Apr 18, 2017 |
https://github.com/GitExl/DoomIdgamesArchive |
| 495. Doorbell.io |
io.doorbell.android |
The official Android client for Doorbell.io |
Oct 9, 2018 |
https://github.com/jitpack-io/android-sdk |
| 496. Dotto |
radix.com.dotto |
Collaborative drawing board with thousands of other artists |
May 30, 2017 |
https://github.com/radixdev/dotto |
| 497. Dr. Rick O'Rang loopback |
org.drrickorang.loopback |
Measure round-trip audio latency using Dr. Rick O'Rang audio loopback connector |
Sep 20, 2018 |
https://github.com/gkasten/drrickorang |
| 498. Draw |
com.simplemobiletools.draw |
A canvas you can draw on with different colors. |
2018-05-16 |
https://github.com/SimpleMobileTools/Simple-Draw |
| 499. DroidBeard |
com.rastating.droidbeard |
Manage SickBeard installations |
2017-02-26 |
https://github.com/rastating/DroidBeard |
| 500. DroidFish |
org.petero.droidfish |
Chess program |
2017-02-03 |
https://github.com/peterosterlund2/droidfish |
| 501. DroidID |
com.ssrij.fingerprintunlockmac |
DroidID lets you unlock your Mac with your Android device's fingerprint sensor |
Feb 12, 2017 |
https://github.com/theblixguy/DroidID |
| 502. DroidShows |
nl.asymmetrics.droidshows |
TV series browser and tracker |
2017-10-20 |
https://github.com/ltGuillaume/DroidShows |
| 503. Droidklavier |
org.droidklavier |
Remote controller for the Yamaha Mark IV Disklavier piano. |
Mar 26, 2017 |
https://github.com/miguelsm/droidklavier |
| 504. Drop It! Quit Smoking |
club.dropit |
Drop that filthy smoking habit! Don't smoke it! |
Jan 21, 2018 |
https://github.com/nikolica/Drop-It-Quit-Smoking |
| 505. DsaTab |
com.dsatab |
DsaTab - Der papierlose Rollenspielabend kann beginnen. |
Oct 9, 2018 |
https://github.com/gandulf/DsaTab |
| 506. DualSim Reminder |
it.mobimentum.dualsimwidget |
Reminds you to enable or disable work SIM at shceduled times. |
Nov 23, 2017 |
https://github.com/mobimentum/dualsimreminder |
| 507. DuckDuckGo Privacy Browser |
com.duckduckgo.mobile.android |
Privacy, simplified |
2018-06-04 |
https://github.com/duckduckgo/Android |
| 508. Duorem |
com.vadimfrolov.duorem |
Wake up or shutdown remote computer from your phone/tablet. |
2018-05-27 |
https://github.com/fralik/Duorem |
| 509. Durham Region Transit Bus - MonTransit |
org.mtransit.android.ca_durham_region_transit_bus |
Durham Region Transit (DRT) Bus for MonTransit.\nSchedule. News. |
Sep 13, 2018 |
https://github.com/mtransitapps/ca-durham-region-transit-bus-android |
| 510. Dynamic Night Light |
de.quaddyservices.dynamicnightlight |
Low brightness clock |
2017-04-23 |
https://github.com/quaddy-services/DynamicNightLight |
| 511. Dziennik |
com.wabadaba.dziennik |
Client for Synergia Librus |
2018-04-27 |
https://github.com/shymmq/librus-client-kotlin |
| 512. Déjà Vu Location Service |
org.fitchfamily.android.dejavu |
Mobile/cell and WLAN/Wi-Fi based network provider for UnifiedNlp and microG |
2018-03-23 |
https://github.com/n76/DejaVu |
| 513. EBookDroid - PDF & DJVU Reader |
org.ebookdroid |
EBookDroid is a highly customizable document viewer for Android. |
Oct 17, 2018 |
https://github.com/nivieru/ebookdroid |
| 514. EDCompanion |
fr.corenting.edcompanion |
Community goals updates, in-game news, and CMDR informations for Elite:Dangerous |
Oct 8, 2018 |
https://github.com/corenting/EDCompanion |
| 515. EDTVelizy |
com.edt.velizy.edtvelizy |
L'emploi du temps mobile de l'IUT de Vélizy |
Sep 6, 2018 |
https://github.com/Astropilot/EDTVelizy |
| 516. EEG 101 |
com.eeg_project |
An educational tool using the Muse headband to teach the basics of EEG |
May 1, 2018 |
https://github.com/tmcneely/eeg-101 |
| 517. EH17 Schedule |
name.myigel.fahrplan.eh17 |
Schedule (aka Fahrplan) of the EH17 |
2017-04-17 |
https://github.com/MyIgel/EH17Fahrplan |
| 518. EP Mobile |
org.epstudios.epmobile |
Medical tools |
2017-11-05 |
https://github.com/mannd/epmobile |
| 519. EPIC - Free Breastfeeding Tracker,Feed & Sleep Log |
com.singhgurjit.babycare.babycare |
EPIC baby care helps you keep track of sleeping, diapers, breastfeeding and more |
Aug 13, 2017 |
https://github.com/singh-gurjit/BabyCare |
| 520. EPIC selfie |
com.eastrivervillage.epic |
Daily EARTH images from NASA’s Earth Polychromatic Imaging Camera (EPIC) |
Jun 12, 2017 |
https://github.com/kumaran127/nasa_epic |
| 521. ES Mod Installer |
org.salieff.esmodinstaller |
Loader additions to the visual novel \Endless Summer|Feb 10, 2017 |
https://github.com/salieff/es_mod_installer |
|
| 522. EZ Screenshot |
com.skyrimcloud.app.easyscreenshot |
EZ Screenshot can help you making a screenshot easily, even only with one hand. |
Sep 12, 2017 |
https://github.com/zty5678/EZScreenshot |
| 523. EZ-GUI Ground Station |
com.ezio.multiwii |
Ground Station for Cleanflight, Betaflight, iNav and Multiwii |
Aug 5, 2017 |
https://github.com/eziosoft/MultiWii_EZ_GUI |
| 524. Eagle Connect |
com.applia.eagleconnect |
Everything you need to know about Biola while on campus, all in one place! |
May 23, 2017 |
https://github.com/RoyalSix/myBiolaApp |
| 525. Earmouse |
pk.contender.earmouse |
Train your musical ear by practising intervals and chords! |
Jul 21, 2018 |
https://github.com/pklinken/Earmouse |
| 526. Earth Wallpapers - Satellite imagery from Google |
com.github.p1va.earthviewwallpaper |
Beautiful wallpapers from Earth View by Google Earth |
Oct 7, 2017 |
https://github.com/p1va/EarthViewWallpaper |
| 527. Easer |
ryey.easer |
Event-driven Android automation |
2018-05-28 |
https://github.com/renyuneyun/Easer |
| 528. Easy Open Link |
de.audioattack.openlink |
Open URLs via select and share |
2018-05-23 |
https://gitlab.com/marc.nause/openlink/tree/HEAD |
| 529. Easy VPN Free |
com.vasilkoff.easyvpnfree |
Secure your Android with OpenVPN connection, servers from enthusiasts, free! |
Feb 28, 2017 |
https://github.com/MaxSmile/EasyVPN-Free |
| 530. Easy xkcd |
de.tap.easy_xkcd |
View xkcd comics |
2018-02-16 |
https://github.com/T-Rex96/Easy_xkcd |
| 531. EasyBudget |
com.benoitletondor.easybudgetapp |
Budget planning made simple: Easy to use app to manage budget on a daily basis. |
Sep 27, 2018 |
https://github.com/benoitletondor/EasyBudget |
| 532. EasyRPG for RPG Maker 2000 |
org.easyrpg.player |
Play your RPG Maker 2000 and 2003 games everywhere with EasyRPG Player. |
May 6, 2018 |
https://github.com/Zhek/player-zhek |
| 533. EasyRSS |
org.freshrss.easyrss |
RSS reader compatible with Google Reader API |
2017-07-23 |
https://github.com/Alkarex/EasyRSS |
| 534. EasySSHFS |
ru.nsu.bobrofon.easysshfs |
Sshfs with ssh client and interface for Android. |
Jul 28, 2018 |
https://github.com/bobrofon/easysshfs |
| 535. Eddie - AirVPN official OpenVPN GUI |
org.airvpn.eddie |
Free and open source OpenVPN GUI. Only official application by AirVPN. |
Sep 28, 2018 |
https://github.com/AirVPN/airvpn-client |
| 536. Editor |
org.billthefarmer.editor |
Simple generic text editor |
2018-03-05 |
https://github.com/billthefarmer/editor |
| 537. Edmonton ETS Bus - MonTransit |
org.mtransit.android.ca_edmonton_ets_bus |
Edmonton ETS buses for MonTransit.\nSchedule. Real-Time. News. |
Oct 5, 2018 |
https://github.com/mtransitapps/ca-edmonton-ets-bus-android |
| 538. Edmonton ETS LRT - MonTransit |
org.mtransit.android.ca_edmonton_ets_train |
Edmonton ETS Light Rail Transit for MonTransit.\nSchedule. News. |
Oct 5, 2018 |
https://github.com/mtransitapps/ca-edmonton-ets-train-android |
| 539. Elastic Sensor Dump |
ca.dungeons.sensordump |
Gather sensor and GPS data from your phone or tablet and store in Elasticsearch |
Mar 27, 2018 |
https://github.com/patw/ElasticSensorDump |
| 540. Elementary |
com.ultramegatech.ey |
Periodic Table of the Elements reference app |
2018-04-08 |
https://github.com/ultramega/elementary |
| 541. EletroFisio |
eletrofisio.com.teste11 |
Study guide in electrotherapy. |
May 25, 2017 |
https://github.com/FilipeAlbuquerque/EletroFisio |
| 542. Elliptic Curves Calculator |
de.tobiasbielefeld.ellipticcurvescalculator |
Simple app to help you with your crypto homework, now open source! |
Jan 8, 2017 |
https://github.com/TobiasBielefeld/Elliptic-Curves-Calculator |
| 543. Ello |
co.ello.ElloApp |
The Creators Network. |
Nov 27, 2017 |
https://github.com/elpoisterio/ello-android |
| 544. Emerald Launcher |
ru.henridellal.emerald |
Simple custom home screen |
2018-04-27 |
https://github.com/HenriDellal/emerald |
| 545. Emerald Mod for Minecraft: PE |
com.razvanmcrafter.addon.emeraldmod |
Adds Emerald items and blocks to Minecraft |
Aug 5, 2017 |
https://github.com/Razvan-MCrafter/Emerald-Mod |
| 546. Emoncms |
org.emoncms.myapps |
Open-source Emoncms dashboard viewer |
Aug 7, 2018 |
https://github.com/emoncms/AndroidApp |
| 547. Emulator for TI-59 Calculator |
net.obry.ti5x |
Emulator for the TI-59, TI-58C Calculator and the unreleased TI-59C. |
Oct 6, 2018 |
https://github.com/TurboGit/ti5x_android |
| 548. Encdroid |
org.mrpdaemon.android.encdroid |
File manager for encrypted cloud storage with EncFS on Dropbox and Google Drive. |
Nov 24, 2017 |
https://github.com/mrpdaemon/encdroid |
| 549. Enchanted Fortress |
hr.kravarscan.enchantedfortress |
Build, manage and defend your castle |
2018-05-29 |
https://github.com/subchannel13/EnchantedFortress |
| 550. Encrypt Text |
dk.meznik.jan.encrypttext |
Minimalistic application to encrypt plain text using AES 256 |
2018-06-02 |
https://github.com/JanmanX/EncryptTextApp |
| 551. Endoscope |
pl.hypeapp.endoscope |
RTSP live video streamer via Wi-Fi |
2017-03-17 |
https://github.com/hypeapps/Endoscope |
| 552. Energize - Battery Monitor |
com.halcyonwaves.apps.energize |
Monitor your battery, so you know how long you can keep going! |
Sep 11, 2017 |
https://github.com/thuetz/Energize |
| 553. Engine Driver Throttle |
jmri.enginedriver |
Engine Driver Throttle -- Run your model trains from your Android phone! |
Aug 9, 2018 |
https://github.com/mstevetodd/EngineDriver |
| 554. English to Chinese Multi Languages Translator 2018 |
com.zhaoweihao.mrtranslator |
English Chinese Translator instantly translate text Chinese,English to Chinese. |
Oct 12, 2017 |
https://github.com/zhaoweihaoChina/MrTranslator |
| 555. Enhancement |
com.primokorn.enhancement |
White theme for CM13 |
2017-02-12 |
https://gitlab.com/Primokorn/EnhancementTheme/tree/HEAD |
| 556. EnigmAndroid |
de.vanitasvitae.enigmandroid |
Simulation of the Enigma Machine |
2018-02-16 |
https://github.com/vanitasvitae/EnigmAndroid |
| 557. Entrust IdentityGuard Unblocker |
ca.pr0ps.xposed.entrustunblocker |
Xposed module to let rooted devices use Entrust's IdentityGuard app |
2017-05-10 |
https://github.com/pR0Ps/Entrust-IdentityGuard-Unblocker |
| 558. Epi Info |
gov.cdc.epiinfo |
Epi Info™: The essential free software tool for public health practice. |
Sep 18, 2018 |
https://github.com/Epi-Info/Epi-Info-Android |
| 559. Episodie |
pl.hypeapp.episodie |
Discover and track TV show time |
2018-05-12 |
https://github.com/hypeapps/episodie |
| 560. Equate |
com.llamacorp.equate |
Convert units |
2017-08-30 |
https://github.com/EvanRespaut/Equate |
| 561. Equiv |
com.agateau.equiv |
Follow your daily protein consumption |
Apr 28, 2017 |
https://github.com/agateau/equiv |
| 562. Escalero Dice |
com.androidheads.vienna.escalero |
Escalero is a dice game inspired from the card game poker. |
Aug 22, 2018 |
https://github.com/c4akarl/Escalero |
| 563. Essential Launcher |
de.clemensbartz.android.launcher |
A very minimal launcher |
2018-02-16 |
https://github.com/clemensbartz/essential-launcher |
| 564. Etar |
ws.xsoh.etar |
Etar is a material designed open source calendar, for everyone! |
2018-05-27 |
https://github.com/Etar-Group/Etar-Calendar |
| 565. EteSync |
com.etesync.syncadapter |
End-to-end encrypted and journaled calendar and contacts cloud sync adapter |
2018-04-24 |
https://github.com/etesync/android |
| 566. Ether Tracker |
com.og.finance.ether |
Allows you to track the Ether value compared to dollar (USD) in real time. |
Jun 14, 2017 |
https://github.com/olivierg13/EtherTracker |
| 567. Eurofurence |
org.eurofurence.connavigator |
Your one-stop Eurofurence app! Keep track of events, dealers and more! |
Aug 17, 2018 |
https://github.com/eurofurence/ef-app_android |
| 568. Eve-control |
com.evenement.encapsulation |
Control eVenement instances |
2018-02-16 |
https://github.com/e-venement/eve-control |
| 569. Eve-control |
fr.librinfo.evecontrol2 |
Control your e-venement tickets |
2017-11-14 |
https://github.com/e-venement/eve-control |
| 570. Event Logger. Time manager |
com.arkada38.eventlogger |
Helps to keep a record of events, displays the number and duration of events. |
Mar 13, 2017 |
https://github.com/arkada38/Android-Event-Logger |
| 571. Exceer Workout Trainer Pro |
org.grapentin.apps.exceer |
A simple, yet effective app for your daily workout |
May 21, 2017 |
https://github.com/oaken-source/exceer |
| 572. Exodus Privacy |
org.eu.exodus_privacy.exodusprivacy |
Analyzes privacy concerns in apps from Google Play store |
2018-04-14 |
https://github.com/Exodus-Privacy/exodus-android-app |
| 573. Expense Tracker |
com.pedrocarrillo.expensetracker |
Track your daily, weekly and monthly expenses. |
Jan 10, 2018 |
https://github.com/cpinan/Capstone-Project |
| 574. Expenses |
com.dpcsoftware.mn |
Expenses is a simple app that helps you manage your personal expenses. |
Sep 29, 2018 |
https://github.com/dpcsoftware/Expenses |
| 575. Expenses |
luankevinferreira.expenses |
Don't you know where's your money? Install, Use and Discover! |
Jan 28, 2018 |
https://github.com/luankevinferreira/expenses |
| 576. Explore |
com.wildlava.explore |
Four text adventure games - a bit of retro fun!\nSurvive to escape and win! |
Feb 4, 2017 |
https://github.com/wildlava/explore |
| 577. Expo |
host.exp.exponent |
Expo is a free & open source platform to build apps using JavaScript and React. |
Sep 12, 2018 |
https://github.com/NewSpring/Apollos |
| 578. ExprEval |
com.github.gianlucanitti.expreval |
Math expression calculator with variables and functions support |
2017-01-17 |
https://github.com/gianluca-nitti/android-expr-eval |
| 579. Extrato do Cartão |
com.marcosdiez.extratocartao |
It shows the purchases you made with your credit card and received SMS. |
May 30, 2018 |
https://github.com/marcosdiez/LimiteCartao |
| 580. Eylca |
mbmb5.lumixextendedcontrolapp |
Control a lumix camera remotely |
2017-02-06 |
https://github.com/mbmb5/Eylca |
| 581. F-Droid Privileged Extension |
org.fdroid.fdroid.privileged |
Services to allow F-Droid to securely install and update apps |
2018-05-02 |
https://gitlab.com/fdroid/privileged-extension |
| 582. F-Droid |
org.fdroid.fdroid |
The app store that respects freedom and privacy |
2018-04-28 |
https://gitlab.com/fdroid/fdroidclient |
| 583. FAST App Search Tool |
org.ligi.fast |
Find apps just by typing |
2018-04-14 |
https://github.com/ligi/FAST |
| 584. FAU Campus Info - Erlangen/Nbg |
de.jakobhaubold.tools.unierlangennuernberg |
FAU Campus Info - information portal for students of the University of Erlangen Nuremberg. |
Apr 30, 2018 |
https://github.com/jaaakob/campusyusuf |
| 585. FBReader |
org.geometerplus.zlibrary.ui.android |
An e-book reader |
2017-09-11 |
https://github.com/geometer/FBReaderJ |
| 586. FCM toolbox |
fr.smarquis.fcm |
Toolbox to easily test and debug the Firebase Cloud Messaging service |
Jan 20, 2018 |
https://github.com/SimonMarquis/FCM-toolbox |
| 587. FFUpdater |
de.marmaro.krt.ffupdater |
Download Firefox |
2018-02-16 |
https://gitlab.com/krt/ffupdater |
| 588. FLock Settings |
ryey.flock |
Floating lockscreen button |
2017-03-29 |
https://github.com/renyuneyun/FLock |
| 589. FMS - Audio delay |
eu.thedarken.fms |
Enjoy a weird experience. |
Feb 2, 2017 |
https://github.com/d4rken/android-fms |
| 590. FOSDEM Companion |
be.digitalia.fosdem |
Schedule browser for the FOSDEM conference |
2018-02-01 |
https://github.com/cbeyls/fosdem-companion-android |
| 591. FOSS Browser |
de.baumann.browser |
Browse the web |
2018-05-14 |
https://github.com/scoute-dich/browser |
| 592. FOSSASIA 2017 |
org.fossasia.openevent |
Browse information of FOSSASIA 2017 |
2017-03-24 |
https://github.com/fossasia/open-event-android |
| 593. FPU-Calculator |
de.crazyinfo.fpe_rechner |
This app is designed, to help diabetics, to calculate the fat protein units. |
Nov 6, 2017 |
https://github.com/Matze1985/FPE-Rechner |
| 594. FPV Video Channelsorter 5.8GHz |
florian.felix.flesch.fpvvideochannelsorter |
Calculates the best spread of the channels over the available frequencies. |
Sep 21, 2017 |
https://github.com/lexlix/FPV-Video-Channelsorter-5.8GHz |
| 595. FPlay |
br.com.carlosrafaelgn.fplay |
Music player with clean interface, equalizer, bass boost and customizable colors |
Oct 13, 2018 |
https://github.com/MilanNz/FPlayAndroid |
| 596. FRC Notebook |
com.plnyyanks.frcnotebook |
An app for FRC volunteers |
Mar 14, 2018 |
https://github.com/phil-lopreiato/frc-notebook |
| 597. FRC Scouting |
org.growingstems.scouting |
Application for scouting at FIRST Robotics Competitions. |
Apr 24, 2018 |
https://github.com/JonBees/SHARPScoutTest |
| 598. FTP Server (Free) |
be.ppareit.swiftp_free |
Access your phone wirelessly |
2018-02-16 |
https://github.com/ppareit/swiftp |
| 599. Face Recognition Application |
com.lauszus.facerecognitionapp |
Demonstration on how to use Eigenfaces and Fisherfaces for face recognition. |
Jun 6, 2018 |
https://github.com/Lauszus/FaceRecognitionApp |
| 600. Face Recognition |
ch.zhaw.facerecognition |
Face Recognition can be used as a test framework for face recognition methods |
May 26, 2017 |
https://github.com/Qualeams/Android-Face-Recognition-with-Deep-Learning-Test-Framework |
| 601. Face Slim |
org.indywidualni.fblite |
Connect to Facebook |
2018-04-10 |
https://github.com/indywidualny/FaceSlim |
| 602. Facepunch Droid |
com.apps.anker.facepunchdroid |
The all amazing app for the best forum Facepunch. |
Sep 24, 2018 |
https://github.com/dasmikko/facepunchdroid |
| 603. Fake Chat Conversations For LINE |
jp.yuta.kohashi.fakelineapp |
lets create fake chat conversations for line !!! |
Mar 11, 2018 |
https://github.com/YutaKohashi/FakeLineApp |
| 604. Fake GP Base |
net.formula97.fakegpbase |
The GP-based ish one that responds to the NFC tag |
Aug 11, 2018 |
https://github.com/f97one/FakeGPBase |
| 605. FakeGapps |
com.thermatk.android.xf.fakegapps |
Used with µg GmsCore to enable Google Cloud Messaging (GCM) and more |
2018-04-09 |
https://github.com/thermatk/FakeGApps |
| 606. Fallon - IUT Fontainebleau |
com.fallon.app |
Your schedule, your teachers absences and notes in a snap! |
Jun 14, 2017 |
https://github.com/TASnomad/Fallon-react-native-app |
| 607. Faltometro |
com.ufrgs.faltometro |
App que monitora o número de faltas do estudante. |
Apr 21, 2017 |
https://github.com/theolm/faltometro-android |
| 608. Fan-droid Flashlight |
org.imaginativeworld.fan |
It's an Awesome Open-source Fan Simulator app with bonus Flashlight feature. |
Sep 30, 2017 |
https://github.com/ImaginativeWorld/Fan-droid-Flashlight |
| 609. FareBot |
com.codebutler.farebot |
View balance and other info from contactless public transit cards! |
Dec 11, 2017 |
https://github.com/miikkajs/farebot |
| 610. FastHub-Libre |
com.fastaccess.github.libre |
A GitHub client app built from ground up |
2018-03-31 |
https://github.com/thermatk/FastHub-Libre |
| 611. Fate Sheets |
link.standen.michael.fatesheets |
Manage your Fate character sheets |
2017-06-23 |
https://github.com/ScreamingHawk/fate-sheets |
| 612. Feeder |
com.nononsenseapps.feeder |
RSS feed reader |
2018-06-04 |
https://gitlab.com/spacecowboy/Feeder |
| 613. Fennec F-Droid |
org.mozilla.fennec_fdroid |
Browse the web |
2018-05-21 |
http://hg.mozilla.org |
| 614. FiSSH |
tech.iodev.fissh |
SSH login on Linux PC through network and the fingerprint scanner on Android. |
Sep 24, 2018 |
https://github.com/ioanmoldovan/FiSSH-App |
| 615. Field Book |
com.fieldbook.tracker |
Field Book is an app for taking notes on field research plots. |
Sep 26, 2017 |
https://github.com/zacharymiller90/Field-Book |
| 616. File Explorer |
com.mauriciotogneri.fileexplorer |
A simple file explorer. |
Sep 20, 2018 |
https://github.com/mauriciotogneri/fileexplorer |
| 617. File Manager |
com.simplemobiletools.filemanager |
A simple file manager for browsing and editing files and directories. |
2018-05-16 |
https://github.com/SimpleMobileTools/Simple-File-Manager |
| 618. Filenotes |
sbs20.filenotes |
Simple note taking with text files and optional Dropbox syncing |
Aug 14, 2018 |
https://github.com/sbs20/filenotes-android |
| 619. FilmChecker |
me.murks.filmchecker |
Checks the status of film orders |
2018-06-04 |
https://github.com/zouroboros/filmchecker |
| 620. Filmy - Your Movie Guide |
tech.salroid.filmy |
New and awesome movie app. |
Dec 16, 2017 |
https://github.com/salRoid/Filmy |
| 621. Financisto - Personal Finance Tracker |
ru.orangesoftware.financisto |
Financisto is an open-source personal finance tracker for Android platform. |
Feb 20, 2018 |
https://github.com/tiberiusteng/financisto1-holo |
| 622. FindMyPhone |
se.erikofsweden.findmyphone |
Helps you find a mislaid phone |
2018-03-15 |
https://sourceforge.net/scm/?type=svn&group_id=335164 |
| 623. Firefly Mobile |
com.metech.firefly |
Firefly’s online services with the Firefly Mobile app! |
Sep 18, 2018 |
https://github.com/imalpasha/meV2 |
| 624. Firefox Focus: The privacy browser |
org.mozilla.focus |
Get The Privacy Browser. Fast & always private from Firefox, a browser you trust |
Oct 9, 2018 |
https://github.com/mastizada/focus-android |
| 625. Firefox Klar |
org.mozilla.klar |
Get The Privacy Browser. Fast & always private from Firefox, a browser you trust |
2018-04-21 |
https://github.com/mozilla-mobile/focus-android |
| 626. Fish FlashLight |
info.culebrasgis.linternapez |
Simple and fun fish flashlight for your device. |
Oct 4, 2017 |
https://github.com/culebras/LinternaPez |
| 627. Fit Notifications (for Fitbit) |
com.abhijitvalluri.android.fitnotifications |
Enable all notifications for compatible Fitbit devices |
Aug 27, 2018 |
https://github.com/abhijitvalluri/fitnotifications |
| 628. FixMyStreet |
org.mysociety.FixMyStreet |
Report common street problems to councils throughout the UK. |
Oct 11, 2018 |
https://github.com/ciudadanointeligente/fixmystreet-mobile |
| 629. Flame Haze Shana Animated Wallpaper |
com.miqote.shanawp |
Anime animated wallpaper |
2017-02-26 |
https://git.launchpad.net/shanawp |
| 630. Flash Boulder Balkna |
org.fbb.balkna.android |
Training application for Flash Boulder Bar's balkna |
Apr 29, 2017 |
https://github.com/judovana/FlashBalknaAndroid |
| 631. FlashBang |
imallett.FlashBang |
Automatic Android distance calculator using time delay between light and sound |
May 6, 2018 |
https://github.com/imallett/FlashBang |
| 632. Flashlight |
com.simplemobiletools.flashlight |
A simple flashlight without ads. |
2018-05-23 |
https://github.com/SimpleMobileTools/Simple-Flashlight |
| 633. Flashlight |
net.bplaced.therefactory.flashlight |
The most simplistic flashlight app. |
Feb 27, 2018 |
https://github.com/cdetamble/flashlight |
| 634. Flat Connectivity Icons |
ca.cmetcalfe.xposed.flatconnectivityicons |
Xposed module that provides flat connectivity icons |
2017-04-04 |
https://github.com/pR0Ps/FlatConnectivityIcons |
| 635. FlexiCalculator [Calculator & Unit Converter] |
com.saraighatsoftware.flexicalculator |
Calculator with Scientific Calculation, Unit Conversion and Voice Commands |
Jun 10, 2017 |
https://github.com/abhijeet080808/FlexiCalculator |
| 636. Flexible Wallpaper |
daniel_32.flexiblewallpaper |
Use images with any aspect ratio as a wallpaper |
2017-01-14 |
https://github.com/danielmeek32/FlexibleWallpaper |
| 637. Flight Duty Tracker |
com.aliakseipilko.flightdutytracker |
Keep track of your flight time limitations in a simple way. |
Feb 12, 2017 |
https://github.com/aliaksei135/FlightDutyTracker |
| 638. FlightIntel |
com.nadmm.airports |
FlightIntel |
Oct 14, 2018 |
https://github.com/postalservice14/Airports |
| 639. Flippy Campus - Buy & sell on campus at a discount |
com.jojo.flippy.app |
Buy & sell on campus at a discount. |
Mar 9, 2018 |
https://github.com/jessejohnson/flippy |
| 640. Flutter Cow |
com.quchen.flappycow |
Flap around with this cow |
Feb 25, 2018 |
https://github.com/cgpllx/FlappyCow |
| 641. Flyingkite 的電池 App |
com.flyingkite.mybattery |
Entity without pressing the power key and a volume key, you can switch screens and switching volume. |
Jul 18, 2018 |
https://github.com/chenFlyingkite/MyBattery |
| 642. Folkets Ordkompis Swedish Dictionary |
com.mbcdev.folkets |
Folkets Ordkompis is a fast, offline, and ad-free Swedish/English dictionary |
Sep 23, 2017 |
https://github.com/baz8080/folkets_android |
| 643. Fon for Members |
com.oakley.fon |
Connect to 14 Million Fon Wi-Fi hotspots all over the world automatically. |
Jul 10, 2017 |
https://github.com/gjedeer/androidwisprclient |
| 644. Food Portion Printer |
de.alpharesearch.printer |
Send food portion information to a mini thermal receipt printer |
Apr 6, 2018 |
https://github.com/alpharesearch/AndroidPrinter |
| 645. Food Restrictions |
br.com.frs.foodrestrictions |
Place orders with food restrictions in multiple languages |
2017-02-24 |
https://gitlab.com/tmendes/FoodRestrictions |
| 646. Food Scale Droid |
tmendes.com.analyticalbalancedroid |
Scale prices to common base units |
2017-02-24 |
https://gitlab.com/tmendes/FoodScaleDroid |
| 647. ForPDA |
org.softeg.slartus.forpdaplus |
Client for 4pda.ru |
2017-04-17 |
https://github.com/slartus/4pdaClient-plus |
| 648. Forecastie |
cz.martykan.forecastie |
Show weather information from OpenWeatherMap |
2018-01-02 |
https://github.com/martykan/forecastie |
| 649. Forest Watcher |
com.forestwatcher |
Monitor forests anywhere, with near real-time data at your fingertips. |
Jun 15, 2018 |
https://github.com/Vizzuality/forest-watcher |
| 650. Forest of Secrets |
com.kakao.talk.theme.kakaofriendsa |
Forest of Secrets |
Sep 9, 2018 |
https://github.com/fanky10/kakaotalk-kawaii |
| 651. ForkHub |
jp.forkhub |
GitHub client based on the abandoned official app. |
2017-03-26 |
https://github.com/jonan/ForkHub |
| 652. Forró Lyrics |
de.gabbo.forro_lyrics |
Offline database of Forró lyrics |
2018-03-15 |
https://gitlab.com/GabbO2/ForroLyrics/tree/HEAD |
| 653. Fort Erie Transit Bus - MonTransit |
org.mtransit.android.ca_fort_erie_transit_bus |
Fort Erie Transit Bus for MonTransit.\nSchedule. News. |
Sep 5, 2018 |
https://github.com/mtransitapps/ca-fort-erie-transit-bus-android |
| 654. FoxIT |
com.foxyourprivacy.f0x1t |
Get foxy! Learn all about privacy and data protection, apps and permissions! |
Feb 17, 2017 |
https://github.com/sleep-yearning/FoxIT |
| 655. FragDenStaat |
de.fragdenstaat.app |
Navigate FragDenStaat |
2018-05-16 |
https://github.com/jfilter/frag-den-staat-app |
| 656. Fraser Valley Express Bus - MonTransit |
org.mtransit.android.ca_fraser_valley_express_bus |
Fraser Valley Express (FVX) bus for MonTransit.\nSchedule. Alerts. News. |
Sep 4, 2018 |
https://github.com/mtransitapps/ca-fraser-valley-express-bus-android |
| 657. Fredericton Transit Bus - MonTransit |
org.mtransit.android.ca_fredericton_transit_bus |
Fredericton Transit Bus for MonTransit.\nSchedule… |
Aug 7, 2018 |
https://github.com/mtransitapps/ca-fredericton-transit-bus-android |
| 658. Free Mobile Netstat |
org.pixmob.freemobile.netstat |
Monitor your Free Mobile plan |
2017-06-23 |
https://github.com/gilbsgilbs/freemobilenetstat |
| 659. Free Tamil Ebooks |
com.jskaleel.fte |
application for freetamilebooks(dot)com |
Sep 25, 2018 |
https://github.com/jskcse4/FreeTamilEBooks |
| 660. Free42 |
com.thomasokken.free42 |
HP-42S Simulator: advanced scientific programmable RPN calculator. |
Jun 24, 2018 |
https://github.com/jackokring/free42 |
| 661. FreeAmp (Free Audio Player) |
org.freemp.droid |
Best sound quality audio player on android. Small and Cute. No ads, just music. |
May 22, 2018 |
https://github.com/recoilme/freemp |
| 662. FreeOTP+ |
org.liberty.android.freeotpplus |
Two-factor authentication with import/export functionality |
2018-04-10 |
https://github.com/helloworld1/FreeOTPPlus |
| 663. FreeShisen |
de.cwde.freeshisen |
Shisen-Sho game |
2017-04-04 |
https://github.com/knilch0r/freeshisen |
| 664. Freebeard Music Generator |
com.wordsaretoys.freebeard |
More music than humanly possible. |
Oct 11, 2017 |
https://github.com/wordsaretoys/freebeard |
| 665. Freebloks |
de.saschahlusiak.freebloks |
Board game |
2017-01-29 |
https://github.com/shlusiak/Freebloks-Android |
| 666. FreedomBox |
org.freedombox.freedombox |
A companion app for your FreedomBox server |
2018-03-23 |
https://salsa.debian.org/freedombox-team/android-app |
| 667. Freezer Manager |
de.geek_hub.freezermanager |
Organize and keep track of your freezer content |
Nov 17, 2017 |
https://github.com/MrR0bo7/FreezerManager |
| 668. Freifunk Auto Connect |
com.example.tobiastrumm.freifunkautoconnect |
Add multiple Freifunk SSIDs to your device |
2017-10-13 |
https://github.com/WIStudent/FreifunkAutoConnectApp |
| 669. French Calendar |
ca.rmen.android.frenchcalendar |
French Revolutionary calendar widget |
2017-10-21 |
https://github.com/caarmen/FRCAndroidWidget |
| 670. Frequent Contacts |
com.ferid.app.frequentcontacts |
Practical widget for frequently used contacts.\nCall contacts with only a touch. |
May 7, 2018 |
https://github.com/feridsource/Frequent-Contacts |
| 671. Frost |
com.dkanada.icecons |
Monotone icon pack |
2018-04-24 |
https://github.com/dkanada/frost |
| 672. Frozen Bubble |
org.jfedor.frozenbubble |
Bubble shooting game |
2017-03-10 |
https://github.com/videogameboy76/frozenbubbleandroid |
| 673. Fujitsu Asia Conference Manila |
com.fujitsu.fac |
Fujitsu World Tour-Asia Conference Manila is Fujitsu’s flagship annual event. |
Oct 2, 2017 |
https://github.com/BrianBalote/fac_android |
| 674. Funktrainer |
de.hosenhasser.funktrainer |
Trainer for german ham radio license A and E. |
Feb 17, 2018 |
https://github.com/meyerd/funktrainer |
| 675. Fwd: port forwarder |
com.elixsr.portforwarder |
Fwd let's you easily forward ports from your Android device |
Apr 29, 2018 |
https://github.com/elixsr/FwdPortForwardingApp |
| 676. FxcnBeta |
org.chaos.fx.cnbeta |
cnBeta 第三方客户端 |
Jun 16, 2018 |
https://github.com/ChaosLeong/FxcnBeta |
| 677. Föhnix |
foehnix.widget |
The Foehnix weather widget aims at helping pilots with weather conditions |
2018-05-29 |
https://github.com/dzmanto/foehnix |
| 678. G-TimeTracker |
org.g_timetracker |
Simple and cloud-friendly open source time tracker |
Feb 27, 2017 |
https://github.com/g-timetracker/g-timetracker |
| 679. GAR PR |
com.garpr.android |
a fan-made ranking system and tournament archive for Smash |
Mar 29, 2018 |
https://github.com/charlesmadere/smash-ranks-android |
| 680. GApps Browser |
com.tobykurien.google_news |
Sandbox for web apps |
2017-07-14 |
https://github.com/tobykurien/GoogleNews |
| 681. GEO Hozjan |
com.fritex.geohozjan |
The application serves the purpose as a final work. |
Jul 8, 2017 |
https://github.com/fritexvz/geohozjan |
| 682. GH::watch GitHub notifications |
com.daskiworks.ghwatch |
Stay in touch with what is happening around GitHub projects of your interest. |
Sep 24, 2018 |
https://github.com/nickvergessen/ghwatch |
| 683. GLT Companion |
at.linuxtage.companion |
Browse the \Grazer Linuxtage\ schedule |
2018-04-28 |
https://github.com/linuxtage/glt-companion |
| 684. GMI Media TV/Radio broadcast |
com.gospelministries.gmimedia |
Watch exciting mission reports, concentration/relax music and bible messages. |
Apr 25, 2018 |
https://github.com/Flakhound/NoIdea |
| 685. GNU Go - ElyGo |
lrstudios.games.gnugo |
This app will add GNU Go to the list of available opponents on ElyGo. |
May 30, 2018 |
https://github.com/Daimas/elygo-bots |
| 686. GO Transit Bus - MonTransit |
org.mtransit.android.ca_gtha_go_transit_bus |
GTHA GO Transit buses for MonTransit.\nSchedule. News. |
Oct 11, 2018 |
https://github.com/mtransitapps/ca-gtha-go-transit-bus-android |
| 687. GO Transit Train - MonTransit |
org.mtransit.android.ca_gtha_go_transit_train |
GTHA GO Transit trains for MonTransit.\nSchedule. News. |
Oct 11, 2018 |
https://github.com/mtransitapps/ca-gtha-go-transit-train-android |
| 688. GPS Logger for Android |
com.mendhak.gpslogger |
A lightweight GPS logger, battery efficient, GPX/KML, add notes, share, upload. |
Sep 30, 2018 |
https://github.com/iiichtang/gpslogger |
| 689. GPS Logger |
eu.basicairdata.graziano.gpslogger |
A simple and lightweight app to take track of your position and your path |
Sep 22, 2018 |
https://github.com/BasicAirData/GPSLogger |
| 690. GPS to SMS - location sharing |
ru.perm.trubnikov.gps2sms |
The simplest way to share your GPS location with friends! |
Aug 2, 2018 |
https://github.com/tral/GPS2SMS |
| 691. GTFSOffline |
com.wbrenna.gtfsoffline |
Use with any pro-GTFS transit agency |
2017-01-24 |
https://github.com/wbrenna/GTFSOffline |
| 692. Gadgetbridge |
nodomain.freeyourgadget.gadgetbridge |
Communicate with Pebble/Mi Band/Amazfit Bip/Hplus devices and more |
2018-05-22 |
https://github.com/Freeyourgadget/Gadgetbridge |
| 693. Galaxy Sound Issue Fixer |
com.wendyliga.s7soundfix |
Galaxy Sound Issue Fixer , Read More for Explanation |
Sep 20, 2018 |
https://github.com/wendyliga/s7soundfix |
| 694. Galerie |
com.aguasonic.android.galerie |
An overview of selected genuine AGUASONIC® mandalas, with related links. |
Jan 10, 2018 |
https://github.com/aguasonic/Galerie |
| 695. Gallery |
com.simplemobiletools.gallery |
A gallery for viewing photos and videos without ads. |
2018-05-28 |
https://github.com/SimpleMobileTools/Simple-Gallery |
| 696. Game of Life |
com.teinproductions.tein.gameoflife |
Conway's Game of Life |
Aug 10, 2017 |
https://github.com/teinvdlugt/GameOfLife |
| 697. Game of Life |
hu.supercluster.gameoflife |
Conway's Game of Life with editable rules |
Sep 6, 2017 |
https://github.com/zsoltk/GameOfLife |
| 698. GameMaster Dice |
de.duenndns.gmdice |
A dice rolling application with a special focus on role playing games. |
Mar 29, 2018 |
https://github.com/ge0rg/gamemasterdice |
| 699. Garage Opener |
uk.echosoft.garage.opener |
Remote control for opening your garage or for creating a one time access pin |
Mar 23, 2017 |
https://github.com/benjefferies/gogo-garage-opener-android |
| 700. Gatineau STO Bus - MonTransit |
org.mtransit.android.ca_gatineau_sto_bus |
Gatineau STO Bus for MonTransit.\nSchedule. System-Info. News. |
Oct 16, 2018 |
https://github.com/mtransitapps/ca-gatineau-sto-bus-android |
| 701. Geleceği Yazanlar |
com.turkcell.gelecegiyazanlar |
Eğitim içeriklerini, blog yazılarını ve etkinlikleri takip edebilirsiniz. |
May 17, 2017 |
https://github.com/Turkcell/GYAppAnd |
| 702. Gentse Feesten 2018 |
com.genschefieste |
Gentse Feesten 2018 |
Jul 13, 2018 |
https://github.com/swentel/gentsefeesten |
| 703. GeoClick |
com.hanson.geoclick |
The map of your adventures in the world! |
Aug 13, 2017 |
https://github.com/peterdestasio/Geoclick |
| 704. GeoQuake |
com.geo.GeoQuake |
An application that utilizes and displays USGS earthquake data. |
May 21, 2018 |
https://github.com/stinsonga/GeoQuake |
| 705. Geometric Weather |
wangdaye.com.geometricweather |
A light, bright, beautiful and powerful weather application. |
Jul 28, 2018 |
https://github.com/WangDaYeeeeee/GeometricWeather |
| 706. Gerberoid |
se.pp.mc.android.Gerberoid |
Viewer for Gerber files |
2017-08-14 |
https://github.com/zeldin/Gerberoid |
| 707. Get Foreground Activity |
name.seguri.android.getforegroundactivity |
Show current foreground activity |
2017-01-24 |
https://github.com/seguri/GetForegroundActivity |
| 708. GetBack GPS |
com.github.ruleant.getback_gps |
Navigation tool |
2018-02-16 |
https://github.com/ruleant/getback_gps |
| 709. Ghost Commander - Samba plugin |
com.ghostsq.commander.samba |
Access files on the network |
2017-09-03 |
https://sourceforge.net/p/gc-samba/code |
| 710. Ghost Commander |
com.ghostsq.commander |
Dual-panel file manager |
2017-12-24 |
https://sourceforge.net/p/ghostcommander/code |
| 711. Gift Card Guard |
protect.gift_card_guard |
Manage gift cards and their current values |
2017-12-07 |
https://github.com/brarcher/gift-card-guard |
| 712. Giggity |
net.gaast.giggity |
Schedule viewer for conferences and other events |
2018-02-06 |
https://github.com/Wilm0r/giggity |
| 713. GitPoint - GitHub in your pocket |
com.gitpoint |
A complete GitHub client with a minimal and beautiful UI |
Feb 15, 2018 |
https://github.com/housseindjirdeh/git-point |
| 714. Glucosio: Diabetes Tracker |
org.glucosio.android |
Glucosio is a modern diabetes tracker |
Jun 21, 2018 |
https://github.com/ensozos/android-1 |
| 715. Gluten Free Recipes |
com.zzolta.android.gfrecipes |
This wonderful application makes easier to cook gluten free. |
Sep 11, 2017 |
https://github.com/zzolta/GlutenFreeRecipes |
| 716. Go on Tap, PoGo IV calculator |
net.thedju.GoOnTap |
A replacement for Now on Tap to detect Pokemon Go IVs |
Jul 28, 2017 |
https://github.com/jbatonnet/goontap |
| 717. GoBees |
com.davidmiguel.gobees |
Smart apiary management. |
Feb 10, 2017 |
https://github.com/davidmigloz/go-bees |
| 718. GoFun 🎉 |
com.adityakamble49.ttl |
Motivates you to go home 🏡 and live your life |
Mar 14, 2017 |
https://github.com/AkshayChordiya/gofun-android |
| 719. GoSCELE - Unofficial App |
com.mgilangjanuar.dev.goscele |
GoSCELE is an unofficial mobile application of SCELE Fasilkom UI |
Jan 27, 2018 |
https://github.com/mgilangjanuar/GoSCELE |
| 720. Gobandroid TV |
org.ligi.gobandroid_hd |
Ancient Go game |
2018-05-29 |
https://github.com/ligi/gobandroid |
| 721. Goblim |
fr.mobdev.goblim |
Share your photos |
2017-10-18 |
https://git.mob-dev.fr/Schoumi/Goblim |
| 722. Good Weather |
org.asdtm.goodweather |
Display weather information |
2017-05-10 |
https://github.com/qqq3/good-weather |
| 723. Grande Prairie Transit Bus - MonTransit |
org.mtransit.android.ca_grande_prairie_transit_bus |
Grande Prairie Transit Bus for MonTransit.\nSchedule. News. |
Oct 16, 2018 |
https://github.com/mtransitapps/ca-grande-prairie-transit-bus-android |
| 724. GraphView Demos |
com.jjoe64.graphview_demos |
GraphView is a library for Android to create\nflexible and nice-looking diagrams |
Apr 19, 2018 |
https://github.com/bharaszti/MyGraphView |
| 725. Grbl Controller |
in.co.gorest.grblcontroller |
Compact android mobile application for grbl powered cnc machines. |
Aug 27, 2018 |
https://github.com/zeevy/grblcontroller |
| 726. Greater Sudbury Transit Bus - MonTransit |
org.mtransit.android.ca_sudbury_transit_bus |
Greater Sudbury Transit Bus for MonTransit.\nSchedule. Offline. Real-Time. |
Oct 8, 2018 |
https://github.com/mtransitapps/ca-sudbury-transit-bus-android |
| 727. GreenBits Testnet |
com.greenaddress.greenbits_android_wallet.testnet |
GreenAddress Testnet client |
2018-02-20 |
https://github.com/greenaddress/GreenBits |
| 728. GreenBits |
com.greenaddress.greenbits_android_wallet |
GreenAddress client |
2018-02-16 |
https://github.com/greenaddress/GreenBits |
| 729. Greenville Trolley Tracker |
com.codeforgvl.trolleytrackerclient |
App for tracking Greenlink's Trolleys in Downtown Greenville, SC |
Dec 5, 2017 |
https://github.com/codeforgreenville/trolley-tracker-android-client |
| 730. Grid Walking |
org.dyndns.gill_roxrud.frodeg.gridwalking |
Discover Earth. One square at a time. |
Jul 15, 2018 |
https://github.com/frodegill/GridWalking |
| 731. Growth - be awesome developer |
ren.growth |
Growth is a app to help you become awesome developer. |
Jul 18, 2017 |
https://github.com/phodal/growth-ng |
| 732. Guelph Transit Bus - MonTransit |
org.mtransit.android.ca_guelph_transit_bus |
Guelph Transit buses for MonTransit.\nSchedule. News. |
Sep 4, 2018 |
https://github.com/mtransitapps/ca-guelph-transit-bus-android |
| 733. Guessaday |
com.goltzkiste.guessaday |
Guess the day of week of a random date |
2017-12-11 |
https://github.com/mo271/guessaday |
| 734. Guinea Track |
de.brunsen.guineatrack |
Keep track of your guinea pigs. Perfect for breeders. |
Jul 8, 2017 |
https://github.com/brunsen/guinea-track |
| 735. HABPanelViewer Kiosk utility for openHAB HABPanel |
de.vier_bier.habpanelviewer |
A native Android application for openHAB's HABPanel dashboard user interface. |
Oct 12, 2018 |
https://github.com/txmiker/habpanelviewer |
| 736. HCI Debugger |
com.github.akinaru.hcidebugger |
decode/display Bluetooth HCI packets streaming from snoop log |
Mar 25, 2017 |
https://github.com/akinaru/hci-debugger |
| 737. HHS Moodle |
de.baumann.hhsmoodle |
Interact with HHS moodle instance |
2017-09-03 |
https://github.com/scoute-dich/HHSMoodle |
| 738. HKEPC Android (非官方版) |
net.louislam.hkepc |
HKEPC unofficial version of the reader |
Jan 19, 2018 |
https://github.com/louislam/hkepc-unofficial-android |
| 739. HTTP Request Shortcuts |
ch.rmy.android.http_shortcuts |
Submit HTTP Requests from Shortcuts on your Home Screen. |
Sep 4, 2018 |
https://github.com/Waboodoo/HTTP-Shortcuts |
| 740. HTWG LSF Plan |
com.hstrobel.lsfplan |
The lecture plan from the LSF in beautiful shape |
Jul 13, 2018 |
https://github.com/GoneUp/Htwg_LsfPlan |
| 741. Habitica: Gamify Your Tasks |
com.habitrpg.android.habitica |
Treat your life like a game to stay motivated and organized! |
Oct 4, 2018 |
https://github.com/jeubank12/habitrpg-android |
| 742. HackDash |
com.tasomaniac.dashclock.hackerspace.floss |
Hackerspace extension for DashClock |
2017-02-24 |
https://github.com/tasomaniac/hackdash |
| 743. HackWinds |
com.nucc.hackwinds |
Rhode Island specific surf camera and forecasting app. |
Apr 12, 2018 |
https://github.com/mpiannucci/HackWinds-Android |
| 744. Hacked? - have i been pwned? |
li.doerf.hacked |
Check if your account was compromised and is listed on 'Have I been pwned?' |
Oct 3, 2018 |
https://github.com/doerfli/hacked |
| 745. Hacker News |
com.marcelljee.hackernews |
The unofficial Android app for reading Hacker News |
Aug 19, 2017 |
https://github.com/marcelljee/hacker-news-android-app |
| 746. Halifax Transit Bus - MonTransit |
org.mtransit.android.ca_halifax_transit_bus |
Halifax Transit buses for MonTransit.\nSchedule. News. Major Disruptions. |
Aug 20, 2018 |
https://github.com/mtransitapps/ca-halifax-transit-bus-android |
| 747. Halifax Transit Ferry - MonTransit |
org.mtransit.android.ca_halifax_transit_ferry |
Halifax Transit ferries for MonTransit.\nSchedule. News. Major Disruptions. |
Aug 20, 2018 |
https://github.com/mtransitapps/ca-halifax-transit-ferry-android |
| 748. Hamilton HSR Bus - MonTransit |
org.mtransit.android.ca_hamilton_hsr_bus |
Hamilton HSR buses for MonTransit.\nSchedule. News. Alerts. |
Sep 4, 2018 |
https://github.com/mtransitapps/ca-hamilton-hsr-bus-android |
| 749. Hamsi Wallpaper Slideshow |
com.hamsiapps.hamsiwallpaperslideshow |
View your photos as slideshow on home screen wallpaper at a defined interval |
Mar 26, 2017 |
https://github.com/supermurat/hamsi-wallpaper-slideshow |
| 750. Hand and Foot Scores |
com.alderferstudios.handandfootscores |
A score keeper and tutorial for Hand and Foot |
Oct 1, 2017 |
https://github.com/BenAlderfer/hand-and-foot-scores |
| 751. Hangar |
ca.mimic.apphangar |
Access recent and top apps |
2017-01-11 |
https://github.com/corcoran/Hangar |
| 752. Hangboard |
com.dominictracey.hangboard |
Essential training for rock climbing tool |
Sep 15, 2017 |
https://github.com/dominictracey/hangboard |
| 753. Hangoskönyvtár - Magyar Hangoskönyv lejátszó |
com.murati.oszk.audiobook |
The application of the Hungarian Electronic Library Audio player and free catalog |
Aug 12, 2018 |
https://github.com/muratiakos/EKonyvtarAudio |
| 754. Hardware CapsViewer for Vulkan |
de.saschawillems.vulkancapsviewer |
Developer tool to gather hardware implementation details for the Vulkan API. |
May 28, 2017 |
https://github.com/SaschaWillems/VulkanCapsViewer |
| 755. Hash Droid |
com.hobbyone.HashDroid |
Verify file integrity |
2017-10-13 |
https://gitlab.com/f-droid-mirrors/hash_droid.git |
| 756. Hashr - Checksum & Hash Digest Calculator |
com.misker.mike.hasher |
Hashes a file or text to check its integrity |
Aug 15, 2018 |
https://github.com/Miskerest/Hasher |
| 757. Have I Been Pwned? for Android™ |
se.blunden.haveibeenpwned |
See if any of your accounts have been compromised in any known security breach. |
Aug 15, 2018 |
https://github.com/blunden/haveibeenpwned |
| 758. Haven: Keep Watch (BETA) |
org.havenapp.main |
A way to protect personal spaces and possessions without compromising privacy |
Apr 9, 2018 |
https://github.com/guardianproject/phoneypot |
| 759. Hayai Launcher |
com.hayaisoftware.launcher |
Fast and leightweight launcher |
2017-02-12 |
https://github.com/seizonsenryaku/HayaiLauncher |
| 760. Headphone detector |
ch.blinkenlights.android.vanillaplug |
Automatically starts Vanilla Music |
Apr 16, 2018 |
https://github.com/vanilla-music/vanilla-headphone-detector |
| 761. Heads-up Notifications |
codes.simen.l50notifications |
Get the new heads-up notifications from Android Lollipop on any device! |
Dec 13, 2017 |
https://github.com/ja-som/heads-up |
| 762. Heartbeat Fixer for GCM |
io.github.mobodev.heartbeatfixerforgcm |
Tool for fixing Push Notification Delay issue |
Jun 1, 2018 |
https://github.com/shaobin0604/HeartbeatFixerForGCM |
| 763. HeaterRC |
com.dynamite.heaterrc |
HeaterRC remotely controls your auxiliary heating system or any similar devices |
Mar 30, 2018 |
https://github.com/dynamitetuning/com.dynamite.heaterrc |
| 764. Helsinki Testbed Viewer 2.0 |
fi.testbed2 |
View real-time weather maps from Helsinki Testbed in your phone. |
Sep 22, 2018 |
https://github.com/mvestola/helsinki-testbed2-android |
| 765. Heroes Muzei Live Wallpapers |
com.tasomaniac.muzei.comiccovers |
Comic Covers Wallpapers every day on your homescreen |
Oct 8, 2018 |
https://github.com/tasomaniac/MuzeiComicsCovers |
| 766. Hex for Hacker News |
com.hexforhn.hex |
A snappy and fun Hacker News reader. |
Mar 5, 2018 |
https://github.com/longdivision/hex |
| 767. HexColorTime Wallpaper |
com.eneko.hexcolortimewallpaper |
Set the wallpaper color based on time hex value |
2017-02-18 |
https://github.com/jajasuperman/HexColorTime |
| 768. HexShaders |
ru.serjik.hexshaders |
Live wallpaper with some shaders. |
Jul 31, 2018 |
https://github.com/jauseg/HexShaders |
| 769. Hof University |
de.hof.university.app |
Hochschule Hof - Hof University - App |
Jul 14, 2018 |
https://github.com/HochschuleHofStundenplanapp/AndroidStundenplanHof |
| 770. HoldTime |
uncle.android.holdtime |
\Hold time\ is a application, can help you manage the time, away from the lazy |
Aug 29, 2017 |
https://github.com/JohnsonChan/HoldTime |
| 771. Hollows |
gerald1248.hollows |
Arcade game |
Jan 5, 2018 |
https://github.com/gerald1248/hollows |
| 772. HoloKenMod |
com.holokenmod |
KenKen game |
2018-01-05 |
https://github.com/queler/holokenmod |
| 773. Holy Bible |
sk.ksp.riso.svpismo |
The Slovak catholic translation of Holy Bible. |
Aug 23, 2018 |
https://github.com/rkralovic/Holy-Bible |
| 774. Home Assistant |
io.homeassistant.android |
Control your HomeAssistant instance |
2017-09-24 |
https://github.com/Maxr1998/home-assistant-Android |
| 775. Home Button Launcher |
com.dynamicg.homebuttonlauncher |
Home Button Launcher |
May 13, 2018 |
https://github.com/jonlguk/HBL |
| 776. Home Button |
com.pyamsoft.homebutton |
Is your Home button malfunctioning?\nDon't worry, install Home Button today! |
Oct 9, 2018 |
https://github.com/pyamsoft/home-button |
| 777. Home Simulation |
my.myusri.magneto |
MQTT-based home automation using a simulated home on the app |
May 14, 2017 |
https://github.com/myusri/Magneto |
| 778. HomeAssist |
com.axzae.homeassistant |
A clean & colourful Home-Assistant dashboard. |
Feb 11, 2018 |
https://github.com/axzae/homeassist-builder |
| 779. Hoplite Keyboard |
com.philolog.hoplitekeyboard |
A keyboard extension which allows the user to type in Polytonic Greek |
2018-05-28 |
https://github.com/jeremymarch/HoplitePolytonicKeyboardAndroid |
| 780. Hourglass |
com.alaskalinuxuser.hourglass |
Set variable timers with audible alarm and vibration |
2017-12-24 |
https://github.com/alaskalinuxuser/app_hourglass |
| 781. Hourly Reminder |
com.github.axet.hourlyreminder |
Remind you about hours passed |
2018-04-14 |
https://gitlab.com/axet/android-hourly-reminder/tree/HEAD |
| 782. How Long To Beat |
com.nikolasmoya.hltb |
Unofficial app for the amazing How Long to Beat © website |
Dec 2, 2017 |
https://github.com/nmoya/hltb-android-app |
| 783. Hubbub |
com.deange.githubstatus |
Hubbub connects you to your favorite social coding service's health. |
Jan 14, 2018 |
https://github.com/cdeange/hubbub |
| 784. Humans of New York and Others |
com.smartmuki.humans.humansoftheworld |
Get a peek into the lives of humans of New York and others across the world. |
Apr 18, 2018 |
https://github.com/smartmuki/HumansOfTheWorld |
| 785. Humnos Eleos |
com.eleoshumnos |
mobile applications for humnos eleos |
Jun 6, 2017 |
https://github.com/arizto/humnos-mobile |
| 786. HyperRail - NMBS / SNCB Realtime train information |
be.hyperrail.android |
Realtime data for Belgian railways in beatiful, user friendly, and powerful app |
Oct 6, 2018 |
https://github.com/hyperrail/hyperrail-for-android |
| 787. HyperRogue |
com.roguetemple.hyperroid |
a puzzle roguelike on a hyperbolic plane |
Aug 31, 2018 |
https://github.com/zenorogue/hyperrogue |
| 788. I2P |
net.i2p.android.router |
I2P anonymous network |
2018-03-10 |
https://github.com/i2p |
| 789. ICSdroid |
at.bitfire.icsdroid |
Subscribe ics calendars |
2018-05-09 |
https://icsdroid.bitfire.at/source/ |
| 790. IDCT Direct Observation Survey |
org.globalquakemodel.org.idctdo |
Collect building inventory data for seismic or multi-hazard risk assessment |
Mar 30, 2018 |
https://github.com/pslh/testidct |
| 791. IIT Madras Students App |
in.ac.iitm.students |
IIT Madras Official Students App |
Oct 7, 2018 |
https://github.com/InstituteWebOps/students_app |
| 792. INFUSION PROJECT |
com.kostasrotas.infusion |
Drip parameters calculator. It can measure flow rate using camera. |
Jan 16, 2017 |
https://github.com/kostasrotas/INFUSION-PROJECT |
| 793. IPFSDroid |
org.ligi.ipfsdroid |
IPFS Tool |
2017-07-09 |
https://github.com/ligi/IPFSDroid |
| 794. IRMA authentication |
org.irmacard.cardemu |
Authentication made easy, privacy-friendly, and secure |
Oct 16, 2018 |
https://github.com/credentials/irma_android_cardemu |
| 795. ISWiB Explorer |
org.iswib.iswibexplorer |
ISWiB Explorer application has all the information about ISWiB festival. |
Jul 14, 2017 |
https://github.com/ISWiB/android |
| 796. IceCatMobile |
org.gnu.icecat |
Web browser |
2018-03-05 |
https://ftp.gnu.org/gnu/gnuzilla/ |
| 797. Idle Daddy - Game Idler/Card Farmer for Steam™ |
com.steevsapps.idledaddy |
Unlock Steam™ trading cards with your phone |
Oct 17, 2018 |
https://github.com/steevp/UpdogFarmer |
| 798. Ikue - Japanese Dictionary |
com.ikue.japanesedictionary |
Ikue is a 100% offline Japanese-English and English-Japanese dictionary. |
Mar 25, 2017 |
https://github.com/luke-c/Ikue |
| 799. Inbox Pager |
net.inbox.pager |
Read and write e-mails |
2018-05-26 |
https://github.com/itprojects/InboxPager |
| 800. Indic Keyboard |
org.smc.inputmethod.indic |
AOSP Keyboard with Indic language support |
2017-04-27 |
https://gitlab.com/smc/Indic-Keyboard |
| 801. Information about NCBS |
com.rohitsuratekar.NCBSinfo |
General information about NCBS and surroundings. |
Oct 1, 2018 |
https://github.com/rohitsuratekar/NCBSinfo |
| 802. Init.d Light |
x1125io.initdlight |
Add missing init.d support |
2017-12-24 |
https://github.com/x1125/initd-light |
| 803. Intent Intercept |
de.k3b.android.intentintercept |
Dev tool to view inter-app communication |
2018-02-16 |
https://github.com/k3b/intent-intercept |
| 804. InterMine Gene Search |
org.intermine.app |
Search model organism genomics data sets |
Feb 28, 2017 |
https://github.com/stairs/intermine-android |
| 805. Interactive Resume |
com.costa.alex.interactiveresume |
A personal interactive resume application. |
Oct 25, 2017 |
https://github.com/alexcostaluiz/MyInteractiveResume |
| 806. Internet Radio Clock |
ro.antiprotv.radioclock |
A full screen clock that can play Internet radio streams at a touch of button. |
Aug 4, 2018 |
https://github.com/ciuc/InternetRadioClock |
| 807. Internet Radio |
community.peers.internetradio |
Listen to Internet radio stations |
2018-04-14 |
https://notabug.org/metadb-apps/InternetRadio |
| 808. Interval Timer |
org.secuso.privacyfriendlyintervaltimer |
Privacy Friendly App that supports you during circuit exercise sessions |
2018-06-02 |
https://github.com/SecUSo/privacy-friendly-interval-timer |
| 809. Intra |
app.intra |
A safer path to a more open internet |
Oct 2, 2018 |
https://github.com/Jigsaw-Code/Intra |
| 810. InventoryGUI Mobile |
nodom.darkfm.inventoryguimobile |
|
2017-06-23 |
https://github.com/salvadorp2001/Inventory_Taker |
| 811. Inventory |
org.flyve.inventory.agent |
This application is the Android Inventory Agent |
2018-01-15 |
https://github.com/flyve-mdm/android-inventory-agent/ |
| 812. Inventory |
org.wheatgenetics.inventory |
Inventory makes it simple to rapidly capture the name and weight of samples |
Nov 14, 2017 |
https://github.com/PhenoApps/Inventory |
| 813. Inventum |
org.asdtm.fas |
Learn more about your favorite movies and TV shows |
2017-01-25 |
https://github.com/qqq3/inventum |
| 814. Iqra |
com.mmmoussa.iqra |
Iqra is a free application for searching the Quran using speech recognition. |
Jan 15, 2017 |
https://github.com/Crescent-Labs/iqra-android |
| 815. Iven News Reader |
com.iven.lfflfeedreader |
Feed reader for Lffl |
2017-07-19 |
https://github.com/enricocid/lffl-feed-reader |
| 816. JABtalk |
com.jabstone.jabtalk.basic |
JABtalk - Giving every child a voice. |
Jul 16, 2018 |
https://github.com/jabstone/JABtalk |
| 817. JINS MEME BRIDGE／ 手の、声の、足の、代わりに、目を。 |
com.jins_meme.bridge |
JINS MEME BRIDGEは、あなたの目の動きだけで、スマートフォンのカメラからDJソフトまでをコントロールする、Androidアプリです。 |
Apr 2, 2018 |
https://github.com/jins-meme/JinsMemeBRIDGE-Android |
| 818. JKU App |
org.voidsink.anewjkuapp |
Provides information for the students of JKU Linz |
2018-02-20 |
https://github.com/marunjar/anewjkuapp |
| 819. JS Code Run |
me.tacchino.jscoderunner |
Write and run JavaScript code! |
May 11, 2018 |
https://github.com/mtacchino/JSCodeRun |
| 820. JSON Game List Manager |
com.hunterdavis.jsongamelistmanager |
Allows you to view files in the gamelist.JSON format. |
May 30, 2017 |
https://github.com/huntergdavis/json_game_list |
| 821. JY Share - Better sharing apks in Android |
com.janyo.janyoshare |
Extract the system or user installed Apk and give it a meaningful file name. |
Sep 17, 2017 |
https://github.com/Mystery00/JanYoShare |
| 822. Japanese Traditional Time |
com.aragaer.jtt |
Clock widget |
2017-06-13 |
https://github.com/aragaer/jtt_android |
| 823. Japoński pomocnik |
pl.idedyk.android.japaneselearnhelper |
Small modest Japanese midfielder to learn the Japanese language. |
Oct 14, 2018 |
https://github.com/dedyk/JaponskiPomocnik |
| 824. JavNav |
com.senior.javnav |
A all in one application for Texas A&M Kingsville. |
Sep 9, 2018 |
https://github.com/macleod2486/JavNav |
| 825. JayPS for Pebble - Bike GPS |
com.njackson |
Turn your pebble into the GPS sports tracker you have always wanted |
Jul 19, 2017 |
https://github.com/team-mount-ventoux/PebbleVentoo-AndroidApp |
| 826. Jbak Keyboard |
com.jbak.JbakKeyboard |
Fast keyboard with many settings |
Feb 1, 2017 |
https://github.com/NikitaFeodonit/JbakKeyboardFn |
| 827. Jewel Thief |
at.therefactory.jewelthief |
The legendary Jewel Thief game from 1991 is back! |
Sep 1, 2018 |
https://github.com/frittatenbank/jewelthief |
| 828. Ji3an |
dz.btesto.upmc.jiaanapp |
We're all afraid of not having enough food or few ingredients. |
Jan 17, 2017 |
https://github.com/Taybou/JiaanApp |
| 829. Jitsi Meet |
org.jitsi.meet |
Instant video conferences with your teams of family, friends, and colleagues. |
Oct 12, 2018 |
https://github.com/parisjulien/arkadin-jitsimeet |
| 830. Jockey |
com.marverenic.music |
A music player focused on simplicity, performance, and design |
May 29, 2017 |
https://github.com/EngineerKunle/Jockey |
| 831. Joliette CTJM Bus - MonTransit |
org.mtransit.android.ca_joliette_ctjm_bus |
Joliette CTJM buses for MonTransit\nSchedule… |
Jul 28, 2018 |
https://github.com/mtransitapps/ca-joliette-ctjm-bus-android |
| 832. Jota Text Editor |
jp.sblo.pandora.jota |
Jota Text Editor |
Jul 29, 2018 |
https://github.com/jiro-aqua/JotaTextEditor |
| 833. Just Craigslist |
com.alaskalinuxuser.justcraigslist |
Search posts on Craigslist |
2017-05-20 |
https://github.com/alaskalinuxuser/app_justcraigslist |
| 834. Just Notes |
com.alaskalinuxuser.justnotes |
Take notes with import and export features |
2017-05-20 |
https://github.com/alaskalinuxuser/app_justnotes |
| 835. Just Quotes |
com.heed.justquotes |
A minimalistic app to display quotes. |
Jul 20, 2018 |
https://github.com/howard-e/just-quotes-kt |
| 836. Just Search |
co.pxhouse.sas |
Simple Assist app with multiple search providers |
2018-04-03 |
https://github.com/veniosg/JustSearch |
| 837. JustChess |
com.alaskalinuxuser.justchess |
Chess for one or two players |
2018-06-04 |
https://github.com/alaskalinuxuser/app_JustChess |
| 838. K-9 Mail |
com.fsck.k9 |
Full-featured email client |
2018-01-21 |
https://github.com/k9mail/k-9 |
| 839. K2 |
ir.hsn6.k2 |
Catch the moon |
2017-11-14 |
https://github.com/HassanHeydariNasab/k2 |
| 840. K9 Material (unofficial) |
com.fsck.k9.material |
Send and receive mails |
2017-05-15 |
https://github.com/scoute-dich/K9-MailClient |
| 841. KAPPA - die ultimative Kühlschrank-App für Android |
net.ddns.worldofjarcraft.kappa |
Behalten Sie mit Kappa jederzeit die Übersicht über Ihren Kühlschrank! |
Sep 7, 2017 |
https://github.com/WorldofJARcraft/KAPPA |
| 842. KDE Connect |
org.kde.kdeconnect_tp |
KDE Integration |
2018-05-21 |
https://cgit.kde.org/kdeconnect-android.git/ |
| 843. KIBA |
org.schabi.kiba |
A booth attraction app |
2017-08-08 |
https://git.savannah.gnu.org/cgit/kiba.git/tree |
| 844. KIRI Smart Public Transport |
travel.kiri.smarttransportapp |
Public transport guide for Indonesia! |
Aug 19, 2018 |
https://github.com/projectkiri/smartpublictransport-as |
| 845. KISS launcher |
fr.neamar.kiss |
Custom launcher |
2018-06-02 |
https://github.com/Neamar/KISS |
| 846. KStars |
org.kde.kstars.lite |
Rich astronomy planetarium with telescope & camera control in your pocket! |
Oct 18, 2018 |
https://github.com/eric-vickery/kstars |
| 847. KaQui |
org.kaqui |
Learn hiraganas, katakanas, and kanji in form of a quiz |
2018-02-01 |
https://github.com/blastrock/kaqui |
| 848. KakaoBot |
com.suyong.kakaobot |
This is Automatic Bot which send reply the way read notification. |
Oct 5, 2017 |
https://github.com/Su-Yong/NewKakaoBot |
| 849. Kameradan Renk Söyle |
com.hhy.camera.color.teller |
Color-blind and vision were made to say what color the deaf |
Dec 12, 2017 |
https://github.com/hhy89/Kameradan-Renk-Soyle |
| 850. Kamloops Transit System Bus - MonTransit |
org.mtransit.android.ca_kamloops_transit_system_bus |
Kamloops Transit System buses for MonTransit.\nSchedule. Real time. News. |
Oct 3, 2018 |
https://github.com/mtransitapps/ca-kamloops-transit-system-bus-android |
| 851. Kandroid |
in.andres.kandroid |
Manage your projects |
2017-08-15 |
https://github.com/andresth/Kandroid |
| 852. Kantidroid |
com.martin.kantidroid |
The unofficial app for students of the BKS Chur with grade management and more |
Aug 7, 2018 |
https://github.com/martindisch/Kantidroid |
| 853. Kcanotify - KanColle Viewer |
com.antest1.kcanotify |
Viewer Application for KanColle Android |
Oct 13, 2018 |
https://github.com/antest1/kcanotify |
| 854. KeePass DX |
com.kunzisoft.keepass.libre |
KeePass Deluxe, secure and open source password manager |
2018-05-18 |
https://github.com/Kunzisoft/KeePassDX |
| 855. KeePassDroid |
com.android.keepass |
KeePass-compatible password safe |
2018-05-12 |
https://github.com/bpellin/keepassdroid |
| 856. KeePassNFC |
net.lardcave.keepassnfc |
Use your NFC-equipped Android phone to unlock your KeePassDroid database. |
May 9, 2017 |
https://github.com/nfd/KeePassNFC |
| 857. Keen |
org.yegie.keenforandroid |
Free puzzle game with unlimited levels and no ads. |
Sep 20, 2018 |
https://github.com/Yegie/KeenForAndroid |
| 858. Kelowna Regional Transit System Bus - MonTransit |
org.mtransit.android.ca_kelowna_regional_transit_system_bus |
Kelowna Regional Transit System buses for MonTransit.\nSchedule. Real time. News. |
Oct 16, 2018 |
https://github.com/mtransitapps/ca-kelowna-regional-transit-system-bus-android |
| 859. Kernel Adiutor (ROOT) |
com.grarak.kerneladiutor |
Manage your kernel easily with Kernel Adiutor |
Jul 2, 2018 |
https://github.com/mydongistiny/BenzoPerformance |
| 860. Kernel Adiutor |
com.nhellfire.kerneladiutor |
Manage kernel parameters |
2018-02-16 |
https://github.com/NHellFire/KernelAdiutor |
| 861. KeyBlocker |
tool.xfy9326.keyblocker |
This application can do shielding the phone's physical keys to prevent misuse |
Sep 24, 2017 |
https://github.com/XFY9326/KeyBlocker |
| 862. Ki4a - SSH Tunnel |
com.staf621.ki4a |
Ki4a lets you tunnel your android's traffic over SSH in a very easy way. |
Sep 22, 2017 |
https://github.com/staf621/ki4a |
| 863. Kill Camera |
info.aario.killcamera |
Kill camera related processes |
2017-04-04 |
https://github.com/aario/killcamera |
| 864. Kimai |
de.live.gdev.timetracker |
Wrapper for Kimai - Time-Tracking |
2018-04-14 |
https://github.com/gsantner/kimai-android |
| 865. KindMind |
com.sunyata.kindmind |
Bring awareness to what you feel, need, and and how you can be kind to yourself |
Oct 16, 2018 |
https://github.com/SunyataZero/KindMind |
| 866. Kingston Transit Bus - MonTransit |
org.mtransit.android.ca_kingston_transit_bus |
Kingston Transit buses for MonTransit.\nSchedule. Service Alerts. News. |
Sep 28, 2018 |
https://github.com/mtransitapps/ca-kingston-transit-bus-android |
| 867. Kinolog |
git.rrgb.kinolog |
Search and log watched movies |
2017-06-13 |
https://gitlab.com/rrgb/kinolog/tree/HEAD |
| 868. Kitten Tricks |
com.akveo.kittenTricks |
Kitten Tricks is a great start for your next application. |
Jun 28, 2017 |
https://github.com/andry-baka/dapur-ngebul-app |
| 869. Kiwix |
org.kiwix.kiwixmobile |
Offline Wikipedia reader |
2017-03-21 |
https://github.com/kiwix/kiwix |
| 870. Knock the Port |
com.albujer.pere.knocktheport |
Knock the Port is a simple port knocking client for Android. |
Apr 1, 2018 |
https://github.com/P4R/knocktheport |
| 871. Know Your Rights |
org.nakasec.knowyourrights |
Informs immigrants about their basic rights and connects to a hotline. |
Mar 10, 2018 |
https://github.com/krcla/KnowYourRightsApp |
| 872. Kolab Notes |
org.kore.kolabnotes.android |
Write notes and sync them with Kolab |
2018-05-22 |
https://github.com/konradrenner/kolabnotes-android |
| 873. Kontalk |
org.kontalk |
Community-driven messaging |
2018-03-23 |
https://github.com/kontalk/androidclient |
| 874. Kore |
org.xbmc.kore |
Kore, Official Remote for Kodi |
2018-05-28 |
https://github.com/xbmc/Kore |
| 875. Kramerius - Digital Library |
cz.mzk.kramerius.app |
Library in your pocket |
Dec 22, 2017 |
https://github.com/moravianlibrary/kramerius-for-android |
| 876. Kwik DMAP |
player.efis.mfd |
Electronic Flight Information System (DMAP) |
2018-04-08 |
https://github.com/ninelima/kwikEFIS |
| 877. Kwik DataPac (eur.rus) |
player.efis.data.eur.rus |
Electronic Flight Information System (EFIS) Terrain Data |
2017-10-13 |
https://github.com/ninelima/kwikEFIS |
| 878. Kwik DataPac (pan.arg) |
player.efis.data.pan.arg |
Electronic Flight Information System (EFIS) Terrain Data |
2017-11-24 |
https://github.com/ninelima/kwikEFIS |
| 879. Kwik DataPac (sah.jap) |
player.efis.data.sah.jap |
Electronic Flight Information System (EFIS) Terrain Data |
2017-09-24 |
https://github.com/ninelima/kwikEFIS |
| 880. Kwik DataPac (usa.can) |
player.efis.data.usa.can |
Electronic Flight Information System (EFIS) Terrain Data |
2017-06-26 |
https://github.com/ninelima/kwikEFIS |
| 881. Kwik DataPac (zar.aus) |
player.efis.data.zar.aus |
Electronic Flight Information System (EFIS) Terrain Data |
2017-06-26 |
https://github.com/ninelima/kwikEFIS |
| 882. Kwik EFIS |
player.efis.pfd |
Electronic Flight Information System (EFIS) |
2018-04-08 |
https://github.com/ninelima/kwikEFIS |
| 883. Kõnele |
ee.ioc.phon.android.speak |
Speech-to-text module that supports Estonian and grammar-based language models |
Oct 7, 2018 |
https://github.com/Mirieri/HelloGithub |
| 884. L'angolo nerd |
it.langolonerd.app |
Browse L'angolo nerd website in a compact way |
2017-01-13 |
https://github.com/aroblu94/langolonerd_android |
| 885. L-Clock (beta) |
com.pilot51.lclock |
Keep up with upcoming rocket launches with a list, launch clock, and alerts! |
Mar 15, 2017 |
https://github.com/edwn112/lclock |
| 886. LASKmobile |
com.rfo.basic |
Mobile part of the field catalog LASK |
2018-03-26 |
https://github.com/ibinshoid/LASKmobile |
| 887. LDS Reverent Mode |
com.convenienttech.ldsreverentmode |
Automatically silence your phone when you walk into any LDS Chapel. |
Apr 29, 2017 |
https://github.com/Oliver84/ldsReverentMode |
| 888. LISTEN.moe: j-pop, k-pop, and anime music radio |
me.echeung.moemoekyun |
🎵 🎶 Listen to j-pop, k-pop, and anime music ad-free 24/7! 🎶 🎵 |
Sep 9, 2018 |
https://github.com/arkon/LISTEN.moe-Unofficial-Android-App |
| 889. LISTEN.moe |
me.echeung.moemoekyun.fdroid |
Listen to j-pop and anime music radio 24/7 ad-free |
2018-03-19 |
https://github.com/LISTEN-moe/android-app |
| 890. LLRP explorer |
maximsblog.blogspot.com.llrpexplorer |
This is demo app. Reader IP: 192.168.6.190. AntennaID=4. |
Mar 29, 2017 |
https://github.com/mksmbrtsh/LLRPexplorer |
| 891. LabCam |
de.mpg.mpdl.labcam |
LabCam is a tool to upload real-time photos to the associated Keeper account. |
Oct 17, 2018 |
https://github.com/MPDL/MPDL-Cam |
| 892. LabCoat |
com.commit451.gitlab |
GitLab client |
2017-11-28 |
https://gitlab.com/Commit451/LabCoat |
| 893. LanXchange |
de.tobifleig.lxc |
Configuration-free, cross-platform file transfers for your local network |
Apr 17, 2017 |
https://github.com/tfg13/LanXchange |
| 894. Lantern: Better than a VPN |
org.getlantern.lantern |
Can’t access Youtube? Telegram? Other favorite apps? Download Lantern for free! |
Oct 15, 2018 |
https://github.com/getlantern/lantern-mobile |
| 895. LaunchTime |
com.quaap.launchtime |
Organize your homescreen and apps |
2018-04-10 |
https://github.com/quaap/LaunchTime |
| 896. Launcher for XBMC™ |
se.blunden.xbmclauncher |
Turn your Android-powered TV peripheral into an XBMC/Kodi player! |
Nov 25, 2017 |
https://github.com/blunden/XBMCLauncher |
| 897. LaundryView |
com.maths22.laundryview |
Unofficial app for viewing LaundryView laundry machine status on your phone |
Oct 6, 2018 |
https://github.com/maths22/LaundryViewAndroid |
| 898. Laval STL Bus - MonTransit |
org.mtransit.android.ca_laval_stl_bus |
Laval STL buses for MonTransit.\nSchedule. Real time predictions & alerts. |
Aug 25, 2018 |
https://github.com/mtransitapps/ca-laval-stl-bus-android |
| 899. Lawnchair |
ch.deletescape.lawnchair.plah |
Pixel Launcher features plus customizability |
2018-04-12 |
https://github.com/LawnchairLauncher/Lawnchair |
| 900. Le Pont Chaban Delmas Bordeaux |
com.italikdesign.pont.chaban |
Les horaires de levées du Pont Chaban Delmas de Bordeaux avec notifications |
Sep 18, 2018 |
https://github.com/marlenech/PontChabanDelmas |
| 901. LeMonde.fr |
org.mbach.lemonde |
Reads RSS feed from the website LeMonde.fr and fetch articles inside the App |
2018-05-26 |
https://github.com/MBach/LeMondeRssReader |
| 902. LeapFrog |
com.ericabraham.leapfrog |
Location Based Reminder |
Dec 31, 2017 |
https://github.com/theflyingmachine/LeapFrog |
| 903. Leap |
com.antrixgaming.leap |
Leap, Play, Record! Connect with more gamers and compete on a whole new level. |
Nov 1, 2017 |
https://github.com/obramen/Leap |
| 904. Lease Tracker |
com.shawnbusolits.leasetracker |
Track your lease mileage, project total mileage, and estimate overages. |
Aug 4, 2017 |
https://github.com/shawnbuso/Lease-Tracker |
| 905. Leave Me Alone - Call Blocker |
li.doerf.leavemealone |
Call blocker with configurable block lists (manual, downloaded, contacts). |
Aug 26, 2017 |
https://github.com/doerfli/leavemealone |
| 906. Led Assist |
net.xisberto.ledassist |
Turns off the notification led of your phone or tablet when you are at sleep. |
Sep 18, 2018 |
https://github.com/xisberto/ledassist |
| 907. LegeAppen |
net.olejon.mdapp |
Useful and intuitive app for doctors and other health care workers in Norway |
Aug 12, 2018 |
https://github.com/olejon/mdapp |
| 908. Lens Launcher |
nickrout.lenslauncher |
Quickly browse and launch your apps using an adjustable Fisheye Lens. |
Nov 6, 2017 |
https://github.com/nicholasrout/lens-launcher |
| 909. LeoApp |
de.slgdev.leoapp |
Dein digitaler Helfer für den Schulalltag am Leo |
May 9, 2018 |
https://github.com/LCA311/leoapp-sources |
| 910. Lethbridge Transit Bus - MonTransit |
org.mtransit.android.ca_lethbridge_transit_bus |
Lethbridge Transit Bus for MonTransit.\nSchedule… |
Sep 12, 2018 |
https://github.com/mtransitapps/ca-lethbridge-transit-bus-android |
| 911. LetiHome TV Launcher |
hr.envizia.letihome |
Very light launcher optimized for the big screen. No ads. |
Jul 12, 2018 |
https://github.com/qaap/LetiHome |
| 912. Lewis and Short Latin Dictionary |
com.ids1024.lsdict |
A Latin Dictionary by Charlton T. Lewis and Charles Short, Unabridged |
Aug 9, 2018 |
https://github.com/ids1024/lsdict-android |
| 913. Lexica |
com.serwylo.lexica |
Word Game |
2018-05-22 |
https://github.com/lexica/lexica |
| 914. Library |
com.cgogolin.library |
Browse BibTeX files |
2018-05-03 |
https://github.com/cgogolin/library |
| 915. LibreNews |
app.librenews.io.librenews |
Free, fast and decentralized breaking news notification app |
2017-10-01 |
https://github.com/milesmcc/LibreNews-Android |
| 916. LibreTorrent |
org.proninyaroslav.libretorrent |
Manage, download and share files |
2018-04-17 |
https://github.com/proninyaroslav/libretorrent |
| 917. LibreTrivia |
io.github.trytonvanmeer.libretrivia |
An open source trivia game for Android. |
2018-03-05 |
https://github.com/tryton-vanmeer/LibreTrivia |
| 918. Libreflix |
org.libreflix.app |
Stream and watch independent films |
2018-05-29 |
https://notabug.org/kassiano.resende/LibreflixApp |
| 919. License |
community.peers.license |
Search and read software licenses |
2017-05-31 |
https://notabug.org/metadb-apps/License |
| 920. LifeCounter |
com.marceljurtz.lifecounter |
Lifecounter for Magic The Gathering |
2017-07-19 |
https://github.com/MarcelJurtz/MTG_LifeCounter |
| 921. Lightning |
acr.browser.lightning |
Lightweight web browser |
2017-07-01 |
https://github.com/anthonycr/Lightning-Browser |
| 922. Lightstreamer Stock-List Demo FCM |
com.lightstreamer.demo.android.fcm |
Real-Time Data and Push Notifications with Lightstreamer |
Jan 9, 2018 |
https://github.com/Weswit/Lightstreamer-example-MPNStockList-client-android |
| 923. Lightstreamer Stock-List Demo |
com.lightstreamer.simple_demo.android |
Real-Time Data with Lightstreamer |
Jan 9, 2018 |
https://github.com/Weswit/Lightstreamer-example-AdvStockList-client-android |
| 924. LinCal |
felixwiemuth.lincal |
Surprise friends with notifications |
2018-02-16 |
https://github.com/felixwiemuth/LinCal |
| 925. Lines2Polygons |
com.firtzberg.lines2polygons |
Algorithm sample |
Oct 24, 2017 |
https://github.com/Firtzberg/Lines2Polygons |
| 926. Linked Words — A reverse dictionary app |
awais.backworddictionary |
A reverse dictionary app. |
Oct 14, 2018 |
https://github.com/AwaisKing/Linked-Words |
| 927. Linphone |
org.linphone |
SIP (VOIP) phone |
2018-02-16 |
http://www.linphone.org/technical-corner/linphone/downloads |
| 928. Linux Deploy |
ru.meefik.linuxdeploy |
Installing and running a GNU/Linux distribution on your Android device |
Aug 25, 2018 |
https://github.com/prescott66/linuxdeploy |
| 929. List Launcher |
com.amagital.launcher.list |
Simple list of your apps! Free and open source! |
Jun 3, 2017 |
https://github.com/andreyrd/ListLauncher |
| 930. Little Sir Echo |
com.cityfreqs.littlesirecho |
Repeat SMS notifications |
2017-01-11 |
https://github.com/kaputnikGo/LittleSirEcho |
| 931. Lmgtfy Generator |
com.wilderpereira.lmgtfygen |
Generate \How to Google\ tutorials and have fun with your friends! |
Oct 8, 2017 |
https://github.com/WilderPereira/lmgtfyGen |
| 932. LnkShortener |
de.hirtenstrasse.michael.lnkshortener |
Shortens URLs using the Polr API |
2017-04-27 |
https://github.com/michaelachmann/LnkShortener |
| 933. Local Storage |
com.ianhanniballake.localstorage |
Explore your local storage via this sample app for the Storage Access Framework |
Aug 14, 2018 |
https://github.com/ianhanniballake/LocalStorage |
| 934. LocalGsmNlpBackend |
org.fitchfamily.android.gsmlocation |
UnifiedNlp location provider (local GSM database) |
2018-01-29 |
https://github.com/n76/Local-GSM-Backend |
| 935. LocalWifiNlpBackend |
org.fitchfamily.android.wifi_backend |
UnifiedNlp location provider (local WiFi database) |
2018-03-15 |
https://github.com/n76/wifi_backend |
| 936. Location Map Viewer |
de.k3b.android.locationMapViewer |
Display geografic information on a map |
2017-09-24 |
https://github.com/k3b/locationMapViewer |
| 937. Location Saver |
com.locationsaver |
Save your location and get directions to it at a later time |
Apr 20, 2017 |
https://github.com/vaskort/react-native |
| 938. Location Share |
ca.cmetcalfe.locationshare |
Share your current location |
2017-02-07 |
https://github.com/pR0Ps/LocationShare |
| 939. Locator via SMS |
com.wnezros.locatorviasms |
It adds the ability to request the location via SMS. |
Oct 7, 2017 |
https://github.com/WNeZRoS/LocatorViaSms |
| 940. Lock |
name.seguri.android.lock |
Lock the screen |
2017-04-30 |
https://github.com/seguri/lock |
| 941. Locus - add-on Wahoo RFLKT |
cz.nomi.locusRflktAddon |
Connect with Wahoo RFLKT and turn Locus Map into a bike computer |
Jun 27, 2017 |
https://github.com/liskin/locus-rflkt-addon |
| 942. Locus Map - add-on Geocaching4Locus |
com.arcao.geocaching4locus |
Geocaching4Locus is a Locus Map add-on to download geocaches from Geocaching.com |
Jul 8, 2018 |
https://github.com/arcao/Geocaching4Locus |
| 943. Logcat Reader |
com.dp.logcatapp |
A simple app to view logs |
2018-05-12 |
https://github.com/darshanparajuli/LogcatReader |
| 944. Logical Defence |
za.co.lukestonehm.logicaldefence |
Encyclopedia of logical fallacies |
2017-04-23 |
https://github.com/LukeStonehm/LogicalDefence |
| 945. Logs |
com.tananaev.logcat |
Android Logcat without Root |
2018-03-23 |
https://github.com/tananaev/rootless-logcat |
| 946. Loklak Wok |
org.loklak.android.wok |
Twitter Search App and Peer Indexer for Open Data Community |
Sep 2, 2017 |
https://github.com/Yathannsh/LoklakAndroidApp |
| 947. London Trails |
com.hubbardgary.londontrails |
Discover a hidden side of London! |
Oct 29, 2017 |
https://github.com/hubbardgary/LondonTrails |
| 948. London Transit (LTC) Bus - MonTransit |
org.mtransit.android.ca_london_transit_bus |
London Transit Bus for MonTransit.\nSchedule. Real-Time. News. |
Sep 21, 2018 |
https://github.com/mtransitapps/ca-london-transit-bus-android |
| 949. London Transit (LTC) Buses |
org.frasermccrossan.ltc |
Find all live arrivals on all routes at a London Transit bus stop. |
Mar 14, 2018 |
https://github.com/LTBuses/LTB-android |
| 950. Longueuil RTL Bus - MonTransit |
org.mtransit.android.ca_longueuil_rtl_bus |
Longueuil RTL buses for MonTransit\nSchedule. News. |
Aug 20, 2018 |
https://github.com/mtransitapps/ca-longueuil-rtl-bus-android |
| 951. Look Counter |
com.totemsoft.screenlookcount |
Counts how many times your screen was turned on, as well as actually unlocked. |
Aug 26, 2018 |
https://github.com/lomza/screenlookcount |
| 952. Loop Habit Tracker |
org.isoron.uhabits |
Track your habits and long-term goals |
2018-04-24 |
https://github.com/iSoron/uhabits |
| 953. LoopBoard |
com.alexkang.loopboard |
Create your own loopable soundboard, using recorded and imported sounds! |
Oct 31, 2017 |
https://github.com/AlexKang/loopboard |
| 954. Loyalty (Loyalty Card Saver) |
com.abyx.loyalty |
A complete app that enables you to store all your loyalty cards in one place. |
Sep 22, 2017 |
https://github.com/AbyxBelgium/Loyalty |
| 955. Loyalty Card Keychain |
protect.card_locker |
Manages barcode-based store/loyalty cards on your phone |
2018-05-14 |
https://github.com/brarcher/loyalty-card-locker |
| 956. Ludo |
org.secuso.privacyfriendlyludo |
Boardgame for 1 up to 6 players |
2018-06-02 |
https://github.com/SecUSo/privacy-friendly-ludo |
| 957. Lumicall |
org.lumicall.android |
SIP softphone |
2018-01-29 |
https://github.com/opentelecoms-org/lumicall |
| 958. Luminosus - Eos Companion App |
org.luminosuslight.luminosus_qt |
Cue Lists, Fader Banks, Sound2Light, Audio Playback, Effects and more... |
Jan 7, 2018 |
https://github.com/ElectronicTheatreControlsLabs/LuminosusEosEdition |
| 959. Lunary |
com.rehanced.lunary |
Manage and transfer your Ether with ease |
2018-01-26 |
https://github.com/manuelsc/Lunary-Ethereum-Wallet |
| 960. Lyrically |
com.shkmishra.lyrically |
A lyrics app which works everywhere |
2017-07-07 |
https://github.com/shkcodes/Lyrically |
| 961. M.A.L.P. |
org.gateshipone.malp |
M.A.L.P. - MPD Client |
2018-06-04 |
https://github.com/gateship-one/malp |
| 962. MADBike (BiciMAD) |
org.drunkcode.madbike |
Enjoy using the bike service of Madrid! |
Oct 18, 2017 |
https://github.com/Mun0n/MADBike |
| 963. MALClient |
com.drutol.malclient |
Client application for MyAnimeList.net which helps you manage your anime list. |
Oct 7, 2018 |
https://github.com/Drutol/MALClient |
| 964. MAXS Main |
org.projectmaxs.main |
Main component of MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 965. MAXS Module AlarmSet |
org.projectmaxs.module.alarmset |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 966. MAXS Module BluetoothAdmin |
org.projectmaxs.module.bluetoothadmin |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 967. MAXS Module Bluetooth |
org.projectmaxs.module.bluetooth |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 968. MAXS Module Clipboard |
org.projectmaxs.module.clipboard |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 969. MAXS Module ContactsRead |
org.projectmaxs.module.contactsread |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 970. MAXS Module FileRead |
org.projectmaxs.module.fileread |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 971. MAXS Module FileWrite |
org.projectmaxs.module.filewrite |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 972. MAXS Module LocationFine |
org.projectmaxs.module.locationfine |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 973. MAXS Module Misc |
org.projectmaxs.module.misc |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 974. MAXS Module NFC |
org.projectmaxs.module.nfc |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 975. MAXS Module Notification |
org.projectmaxs.module.notification |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 976. MAXS Module PhonestateRead |
org.projectmaxs.module.phonestateread |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 977. MAXS Module Ringermode |
org.projectmaxs.module.ringermode |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 978. MAXS Module Shell |
org.projectmaxs.module.shell |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 979. MAXS Module SmsNotify |
org.projectmaxs.module.smsnotify |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 980. MAXS Module SmsRead |
org.projectmaxs.module.smsread |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 981. MAXS Module SmsSend |
org.projectmaxs.module.smssend |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 982. MAXS Module SmsWrite |
org.projectmaxs.module.smswrite |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 983. MAXS Module WifiAccess |
org.projectmaxs.module.wifiaccess |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 984. MAXS Module WifiChange |
org.projectmaxs.module.wifichange |
A Module for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 985. MAXS Transport XMPP |
org.projectmaxs.transport.xmpp |
XMPP Transport for MAXS |
2018-01-29 |
http://projectmaxs.org/source |
| 986. MGit |
com.manichord.mgit |
View and interact with git repositories |
2018-06-04 |
https://github.com/maks/MGit |
| 987. MIDICtrl |
moe.martini.midictrl |
Control MIDI devices |
2017-01-06 |
https://github.com/MartiniMoe/MIDICtrl |
| 988. MIFARE Classic Tool |
de.syss.MifareClassicTool |
Analyse a type of NFC tag |
2018-02-16 |
https://github.com/ikarus23/MifareClassicTool |
| 989. ML Manager: APK Extractor |
com.javiersantos.mlmanager |
A modern, easy to use and customizable app manager. Extract APKs and more! |
Mar 22, 2018 |
https://github.com/kingslou/MLManager |
| 990. MN Public Access Sites |
com.wheelermarine.publicAccessSites |
Quickly and easily find Minnesota Public Water Access Sites. |
Feb 27, 2017 |
https://github.com/steventwheeler/PublicAccessSites |
| 991. MONITor |
tech.kjpc.monitorapp |
Android app to monitor Monit. |
Aug 7, 2018 |
https://github.com/kjpc-tech/MONITor |
| 992. MPDroid |
com.namelessdev.mpdroid |
MPD (Music Player Daemon) client |
2017-09-03 |
https://github.com/abarisain/dmix |
| 993. MQTT Alarm Control Panel |
com.thanksmister.iot.mqtt.alarmpanel |
A MQTT Alarm Control Panel for Home Assistant and home automation platforms. |
Oct 5, 2018 |
https://github.com/thanksmister/androidthings-mqtt-alarm-panel |
| 994. MTA Fare Buster |
com.samsandberg.mtafarebuster |
Calculate NYC MTA metrocard prices |
2017-05-20 |
https://github.com/loisaidasam/mta-fare-buster-android |
| 995. MTG Familiar |
com.gelakinetic.mtgfam |
Utilities for the game MTG |
2018-05-25 |
https://github.com/AEFeinstein/mtg-familiar |
| 996. MTG Lifecounter |
com.mtglifecounter |
A battery friendly life counter for players of Magic: The Gathering. |
May 12, 2018 |
https://github.com/remypar5/mtg-lifecounter |
| 997. Machinekit |
io.machinekit.appdiscover |
Moves. Controls. Things. |
Mar 1, 2018 |
https://github.com/qtquickvcp/QtQuickVcp |
| 998. Madrid Pollution |
com.greenlionsoft.pollution.madrid |
Check out the Madrid pollution levels in real time and alert notifications |
Dec 19, 2017 |
https://github.com/GreenLionSoft/madrid-pollution-android-app |
| 999. MagiaDNI |
jpf.android.magiadni |
OCR reader for Spanish id cards |
2017-02-24 |
https://git.savannah.gnu.org/cgit/magiadni.git |
| 1000. Magic Twinkle |
com.lamps.lamps |
Use the phone to control the light switch |
Dec 13, 2017 |
https://github.com/stewForAni/Lamp |
| 1001. Mahougen -MagicCircleGenerator |
com.appspot.pistatium.mahougen |
Powerful magic is activated now! |
May 10, 2018 |
https://github.com/pistatium/mahougen |
| 1002. MaidroidPlurk |
idv.brianhsu.maidroid.plurk |
An open source Plurk app with a cute maid! |
May 2, 2017 |
https://github.com/brianhsu/MaidroidPlurk |
| 1003. Makeblock |
cc.makeblock.makeblock |
A Exciting App For Robot Control From Makeblock |
Sep 14, 2018 |
https://github.com/lo0ol/Makeblock-App-For-Android |
| 1004. Man Man |
com.adonai.manman |
View, download and search Linux manpages |
2017-05-10 |
https://github.com/Adonai/Man-Man |
| 1005. MandelGL |
de.tubaf.mandelGL |
Rendering the Mandelbrot set with OpenGL ES |
Jun 28, 2017 |
https://github.com/bnlrnz/MandelGL |
| 1006. Mandelbrot Explorer |
com.dmitrybrant.android.mandelbrot |
Fast and simple Mandelbrot and Julia explorer. |
Oct 14, 2018 |
https://github.com/dbrant/mandelbrot-android |
| 1007. Manyverse |
se.manyver |
A social network off the grid |
Oct 16, 2018 |
https://github.com/staltz/mmmmm-mobile |
| 1008. Map for ValenBisi |
com.systemallica.valenbisi |
Get information about the public bike system of Valencia in real time |
Oct 11, 2018 |
https://github.com/systemallica/ValenBisi |
| 1009. Map of the Internet by Cogeco Peer 1 |
com.peer1.internetmap |
Map of the Internet by Cogeco Peer 1 |
Sep 14, 2017 |
https://github.com/steamclock/internetmap |
| 1010. Mapper |
org.openorienteering.mapper |
Mapper is an orienteering mapmaking program |
2017-03-08 |
https://github.com/OpenOrienteering/mapper/ |
| 1011. Maps Measure |
de.j4velin.mapsmeasure |
Measure the world! Calculate distances, areas and elevations in Google Maps |
May 12, 2018 |
https://github.com/dhootha/MapsMeasure |
| 1012. Maps Parser |
com.marcosdiez.maps_parser |
Open any Maps URL with any GPS Navigation App |
Aug 10, 2017 |
https://github.com/marcosdiez/android_maps_parser |
| 1013. Maps |
com.github.axet.maps |
Offline OpenStreetMap maps |
2018-05-06 |
https://gitlab.com/axet/omim/tree/HEAD |
| 1014. Maritime Bus - MonTransit |
org.mtransit.android.ca_maritime_bus |
Maritime Bus for MonTransit.\nSchedule. News. |
Jul 28, 2018 |
https://github.com/mtransitapps/ca-maritime-bus-android |
| 1015. Market Fanatic |
com.sanchez.fmf |
Find U.S. farmers markets and view details (schedule, products, etc.) about each |
Mar 28, 2018 |
https://github.com/dakotasanchez/farmers-market-finder |
| 1016. Markor |
net.gsantner.markor |
Simple Markdown & Todo.txt Editor |
2018-05-29 |
https://github.com/gsantner/markor |
| 1017. Mars Explorer |
io.github.krtkush.marsexplorer |
Easily browse images captured on Mars by NASA. |
Jul 7, 2018 |
https://github.com/krtkush/MarsExplorer |
| 1018. Marshmallow launcher |
com.firebirdberlin.rocketlaunch |
... a simple app search tool. |
Mar 7, 2017 |
https://github.com/firebirdberlin/rocketlaunch |
| 1019. Mass Text |
com.dallinc.masstext |
Mass (bulk) SMS messages using contacts names and fill-in-the-blank variables |
Feb 7, 2017 |
https://github.com/toehead2001/MassText |
| 1020. Mastalab |
fr.gouv.etalab.mastodon |
Multi-account client for Mastodon |
2018-05-14 |
https://github.com/stom79/mastalab |
| 1021. Master Password |
de.devland.masterpassword |
Never forget your password again! |
Feb 9, 2018 |
https://github.com/dkunzler/masterpassword |
| 1022. Mastobone |
com.mastobone |
Mastobone is open source Mastodon client app barebone, built using React Native. |
May 9, 2017 |
https://github.com/deguchi/mastobone |
| 1023. Material Design Turbo |
id.web.twoh.coolandroiddesign |
Material Design's element example and showcase on Android (since Lollipop) |
Jan 14, 2018 |
https://github.com/twoh/twoh-android-material-design |
| 1024. Material Flashlight |
co.garmax.materialflashlight |
Opensource flashlight with No Ads |
Jul 28, 2018 |
https://github.com/garmax1/material-flashlight |
| 1025. Material Notes |
com.bijoysingh.quicknote |
Quick and beautiful note-taking |
2018-03-10 |
https://github.com/BijoySingh/Material-Notes-Android-App |
| 1026. Material Tea Timer |
org.ligi.materialteatimer |
Time your tea with style |
2017-07-14 |
https://github.com/ligi/MaterialTeaTimer |
| 1027. MaterialFBook |
me.zeeroooo.materialfb |
Browse Facebook |
2018-04-29 |
https://github.com/ZeeRooo/MaterialFBook |
| 1028. MaterialOS |
org.materialos.icons |
Material Design icons for your homescreen |
2018-05-09 |
https://github.com/materialos/android-icon-pack |
| 1029. Materialistic |
io.github.hidroh.materialistic |
Interact with the \Hacker news\ site |
2018-02-13 |
https://github.com/hidroh/materialistic |
| 1030. Math Ninja |
tt.co.justins.mathninja |
This is a simple game for children that aids in learning basic arithmetic. |
May 8, 2017 |
https://github.com/JustinScott/MathNinja |
| 1031. Mather |
org.icasdri.mather |
A powerful expression-based calculator, unit converter, and computation engine |
2017-01-06 |
https://github.com/icasdri/Mather |
| 1032. Matrix Calculator |
com.softminds.matrixcalculator |
A Simple, Powerful, highly Customisable and Open Source Matrix Calculator. |
Sep 28, 2018 |
https://github.com/coder3101/Matrix-Calculator-for-Android |
| 1033. Mattermost Classic |
com.mattermost.mattermost |
Secure, workplace messaging |
2018-05-23 |
https://github.com/mattermost/mattermost-android-classic |
| 1034. MaxLock - Xposed app locker |
de.Maxr1998.xposed.maxlock |
An Xposed app locker with tons of features and customisations |
May 24, 2018 |
https://github.com/Maxr1998/MaxLock |
| 1035. McCabe-Thiele Method |
com.ronaldosanches.mccabethiele |
Graphical McCabe-Thiele Method, for analysis of binary distillation. |
Jun 24, 2018 |
https://github.com/ronaldosanches/McCabe-Thiele-for-Android-Kotlin |
| 1036. Media Button Overlay |
com.mikekorcha.mediabuttonoverlay |
Change your music while browsing or navigating with a single tap! |
Nov 10, 2017 |
https://github.com/mkorcha/MediaButtonOverlay |
| 1037. Media Merger |
com.github.axet.mover |
Merge media files, open-source |
2018-05-25 |
https://gitlab.com/axet/android-media-merger/tree/HEAD |
| 1038. Media Notification |
james.medianotification |
A slightly unstable attempt to create Android O styled media notifications |
Sep 21, 2017 |
https://github.com/TheAndroidMaster/MediaNotification |
| 1039. Medic Log |
org.paladyn.mediclog |
Log basic medical information |
2018-04-21 |
https://github.com/JohnLines/mediclog |
| 1040. Meditation Assistant |
sh.ftp.rocketninelabs.meditationassistant.opensource |
Feature packed meditation session timer and recorder |
2018-01-15 |
https://gitlab.com/tslocum/meditationassistant |
| 1041. Meetup Manager for Organizers |
com.refractored.meetupmanager |
Manage and easily check in your members at Meetup events even if you are offline |
Jun 11, 2017 |
https://github.com/Martz94/MeetupManager |
| 1042. Meikade |
org.nilegroup.Meikade |
Persian poetry application, contains over 60 poets and 50,000 poems. |
Dec 19, 2017 |
https://github.com/NileGroup/Meikade |
| 1043. Melodeon |
org.billthefarmer.melodeon |
Melodeon emulator for tablets |
2018-01-29 |
https://github.com/billthefarmer/melodeon |
| 1044. Meme Locker |
com.arcturusmayer.memescreen |
Fast sound playback |
Jun 21, 2018 |
https://github.com/ArcturusMayer/Meme_Locker |
| 1045. MemeTastic |
io.github.gsantner.memetastic |
Meme Creator - Simple and Ad-Free |
2018-04-10 |
https://github.com/gsantner/memetastic |
| 1046. Memo Game |
org.secuso.privacyfriendlymemory |
Find pairs of cards |
2017-10-24 |
https://github.com/SecUSo/privacy-friendly-memo-game |
| 1047. MemoCutter |
com.recklessracoon.roman.audiocuttertest |
Cut and resend voice messages received via common instant messaging services. |
Sep 1, 2018 |
https://github.com/recklessracoon/memocutter |
| 1048. Mensa Aachen |
com.auxua.mensaapp |
Simple App for Canteens (Mensen) in Aachen |
Sep 23, 2018 |
https://github.com/auxua/MensaApp |
| 1049. Mensa TU/HS Darmstadt |
de.questmaster.tudmensa |
Displays the menus of Darmstadts university cafeterias |
Aug 6, 2018 |
https://github.com/questmaster/TUMensa |
| 1050. Mensa-Guthaben |
de.yazo_games.mensaguthaben |
Check balance of NFC mensa cards |
2017-03-17 |
https://github.com/jakobwenzel/MensaGuthaben |
| 1051. MensaUPB |
de.ironjan.mensaupb |
The menus of the Studentenwerk Paderborn's restaurants for your mobile device. |
Jun 18, 2018 |
https://github.com/ironjan/MensaUPB |
| 1052. Metal Only |
com.codingspezis.android.metalonly.player |
Official Android app to metal-only.de - The only true Metal Radio on the net! |
Dec 1, 2017 |
https://github.com/Codingspezis/metal-only |
| 1053. Meter |
com.androidexperiments.meter |
Turn your wallpaper into a live dashboard. |
Aug 14, 2017 |
https://github.com/googlecreativelab/meter |
| 1054. MetroSong |
com.andreyaleev.metrosong |
Programmable Metronome. Variable BPM track parts. Create your own song |
Sep 20, 2018 |
https://github.com/acinonyxjubatus/MetroSong |
| 1055. Metrodroid |
au.id.micolous.farebot |
Metrodroid can read information from some public transport NFC smartcards |
2017-08-30 |
https://github.com/micolous/metrodroid |
| 1056. Metronome |
com.arnaud.metronome |
A light and reliable metronome |
2017-10-13 |
https://gitlab.com/funkygoby/metronome |
| 1057. Metronome |
tk.radioactivemineral.metronome |
A simple metronome app with tap tempo functionality, and a preset system. |
Apr 23, 2017 |
https://github.com/waelk10/Metronome |
| 1058. Meu Boleto - Sem mais atraso |
com.vsossella.meuboleto |
The app My Billet notify you on the day of the ticket expires. |
Jan 5, 2018 |
https://github.com/ViniciusSossela/meuboleto |
| 1059. Mi Manga Nu |
ar.rulosoft.mimanganu |
Manga reader |
2018-05-22 |
https://github.com/raulhaag/MiMangaNu |
| 1060. MiVotico |
io.kuralabs.mivotico |
The application guides for voters and political parties in Costa Rica |
Jan 14, 2018 |
https://github.com/mivotico/mivotico-android |
| 1061. MiXiT 2017 |
com.ehret.mixit |
MiXiT 17 will be your best friend during the conference on the 20 and 21 April |
Apr 19, 2017 |
https://github.com/javamind/Mixit2014 |
| 1062. Midnight Call |
twilio.com.twilioclient |
The more connected we become, the lonelier we are.\nStart your Midnight Call. |
Jun 10, 2018 |
https://github.com/llSourcell/CallRoulette-Android |
| 1063. MidniteSolar Classic Monitor |
ca.farrelltonsolar.classic |
View solar charging device status |
2017-01-31 |
https://github.com/graham22/Classic |
| 1064. Mighty Knight |
io.github.alketii.mightyknight |
Infinite runner |
2017-11-07 |
https://github.com/alketii/mighty-knight |
| 1065. Milly |
uk.co.channele.milly |
Simple tool to convert between dates/times and milliseconds. |
Jun 14, 2018 |
https://github.com/sk8geek/Milly |
| 1066. Milton Transit Bus - MonTransit |
org.mtransit.android.ca_milton_transit_bus |
Milton Transit Bus for MonTransit.\nSchedule. News. |
Sep 5, 2018 |
https://github.com/mtransitapps/ca-milton-transit-bus-android |
| 1067. MinTube |
com.shapps.mintubeapp |
Play YouTube videos in a minimized, floating window |
2017-04-08 |
https://github.com/imshyam/mintube |
| 1068. Minetest Mods |
com.rubenwardy.minetestmodmanager |
Minetest Mods manager |
2017-08-02 |
https://github.com/rubenwardy/mtmods4android |
| 1069. Minetest |
net.minetest.minetest |
Near infinite world block sandbox game |
2017-10-26 |
https://github.com/minetest/minetest |
| 1070. Mini vMac |
name.osher.gil.minivmac |
A fully functional Mac Plus emulator for the Android platform. |
Aug 27, 2017 |
https://github.com/dolfin/minivmac4android |
| 1071. Minimal Paint - Draw, Doodle! |
cache.wind.minimal.paint |
Minimalism & Minimal Art |
Jul 28, 2018 |
https://github.com/cachewind/MinimalPaint |
| 1072. Minimal Weather |
net.vatt.jal.weather |
A minimal weather application. |
Oct 2, 2017 |
https://github.com/jvatt/rain-android |
| 1073. Ministocks |
nitezh.ministock |
Stock price widget |
2018-03-31 |
https://github.com/niteshpatel/ministocks |
| 1074. Mintzatu |
com.irontec.mintzatu |
Mintzatu euskaraz hitz egiten den munduko lekuen sarea da |
Jan 22, 2018 |
https://github.com/irontec/Mintzatu-mobile |
| 1075. Miracast Screen Sharing/Mirroring Shortcut |
com.mattgmg.miracastwidget |
Share your screen to your smart TV or miracast dongle with NO ADS! |
Feb 7, 2017 |
https://github.com/mattgmg1990/miracast-widget |
| 1076. Mirror Mirror |
org.bitbucket.tickytacky.mirrormirror |
Non-reversing mirror |
2017-07-22 |
https://bitbucket.org/tickytacky/mirrormirror/src |
| 1077. Missed Notifications Reminder |
com.app.missednotificationsreminder |
Periodical sound reminder for missed notifications |
2017-11-28 |
https://github.com/httpdispatch/MissedNotificationsReminder |
| 1078. MissionHub |
com.missionhub |
MissionHub: See God at work and know you are part of it. |
Oct 5, 2018 |
https://github.com/tim11/MissionHub-Android |
| 1079. Mississauga MiWay Bus - MonTransit |
org.mtransit.android.ca_mississauga_miway_bus |
Mississauga MiWay buses for MonTransit.\nSchedule. News. |
Oct 5, 2018 |
https://github.com/mtransitapps/ca-mississauga-miway-bus-android |
| 1080. Mista Reader |
com.mistareader |
Mobile client for offline site mista.ru |
Mar 12, 2018 |
https://github.com/Rexee/MistaReader |
| 1081. Mitsumine はてなブックマーククライアント |
me.kirimin.mitsumine |
はてなブックマークを快適に利用するためシンプルなクライアントアプリです。 |
Sep 27, 2018 |
https://github.com/kirimin/mitsumine |
| 1082. MobiStego |
it.mobistego |
Hide your message... |
Oct 27, 2017 |
https://github.com/paspao/MobiStego |
| 1083. ModPE IDE – Standard Edition |
com.KillerBLS.modpeide |
ModPE IDE – ModPE Script source code editor for Android™. No ADS! |
Oct 2, 2018 |
https://github.com/Light-Team/ModPE-IDE-Source |
| 1084. ModlusCrypt |
com.marcosge.modluscrypt |
Basic Number Theory |
Aug 4, 2018 |
https://github.com/marcosge/ModlusCrypt |
| 1085. Modular Remote (via Network) |
de.spiritcroc.modular_remote |
Create your own remote to control your devices using TCP (and more)! |
Jul 30, 2018 |
https://github.com/SpiritCroc/Modular-Remote |
| 1086. Mommy Saver |
com.mommysaverapp |
Calm & delight your baby : high contrast images, movements, interactions |
Jul 28, 2018 |
https://github.com/jeremydeanlakey/MommySaverAndroidApp |
| 1087. MonTransit |
org.mtransit.android |
Transit information in your pocket\nBike, Bus, Subway, Train…\nOffline & Real-Time |
Aug 30, 2018 |
https://github.com/mtransitapps/mtransit-for-android |
| 1088. Moncton Codiac Transpo Bus - MonTransit |
org.mtransit.android.ca_moncton_codiac_transpo_bus |
Moncton Codiac Transpo Bus for MonTransit.\nSchedule… |
Oct 2, 2018 |
https://github.com/mtransitapps/ca-moncton-codiac-transpo-bus-android |
| 1089. Monger - 문자를 슬랙, 이메일로 알아서 전달! |
com.wanbok.monger |
Monger는 문자를 슬랙(Slack)이나 email로 보내는 아주 간단한 어플리케이션 입니다. |
Oct 7, 2018 |
https://github.com/wanbok/Monger-Android |
| 1090. Mongol Duu МонголДуу MongolDuu |
com.mongolduu.android.ng |
Монгол дууны хамгийн том сан - Mongolduu.com by Asuult.NET |
Dec 19, 2017 |
https://github.com/tugstugi/mongolduu |
| 1091. Monitora, Brasil! |
com.gamfig.monitorabrasil |
Monitor our politicians! App to track who actually do! |
May 17, 2018 |
https://github.com/movibe/monitorabrasil_android |
| 1092. Monotweety - tweet from notification |
net.yslibrary.monotweety |
Open-source Twitter client just for tweeting from notification |
Oct 10, 2018 |
https://github.com/yshrsmz/monotweety |
| 1093. Montreal BIXI Bike - MonTransit |
org.mtransit.android.ca_montreal_bixi_bike |
Montreal BIXI bike sharing for MonTransit\nAvailability. News. |
Aug 2, 2018 |
https://github.com/mtransitapps/ca-montreal-bixi-bike-android |
| 1094. Montreal RTM (AMT) Express Bus - MonTransit |
org.mtransit.android.ca_montreal_amt_bus |
(now in RTL https://goo.gl/dU2es1)\nMontreal RTM Express bus for MonTransit\nSche… |
Aug 20, 2018 |
https://github.com/mtransitapps/ca-montreal-amt-bus-android |
| 1095. Montreal STM Bus - MonTransit |
org.mtransit.android.ca_montreal_stm_bus |
Montreal STM buses for MonTransit.\nSchedule. Real-Time. News. |
Oct 14, 2018 |
https://github.com/mtransitapps/ca-montreal-stm-bus-android |
| 1096. Montreal STM Subway - MonTransit |
org.mtransit.android.ca_montreal_stm_subway |
Montreal STM subways for MonTransit.\nSchedule. Real-Time Serv. Updates. News. |
Oct 14, 2018 |
https://github.com/mtransitapps/ca-montreal-stm-subway-android |
| 1097. Montreal exo Train - MonTransit |
org.mtransit.android.ca_montreal_amt_train |
Montreal exo trains for MonTransit.\nSchedule. Real-Time Service Status. News. |
Sep 14, 2018 |
https://github.com/mtransitapps/ca-montreal-amt-train-android |
| 1098. Moonlight Game Streaming |
com.limelight |
Play games from your PC on Android (NVIDIA-only) |
Oct 5, 2018 |
https://github.com/xsorifc28/moonlight-android |
| 1099. MorScout |
org.team1515.morscout |
Team 1515 MorTorq's FRC Scouting Application |
Mar 20, 2018 |
https://github.com/mortorqrobotics/morscout-android |
| 1100. Moribus - adfærdsaktivering |
edu.virginia.sie.ptl.sensus_Moribus |
Moribus app is part of a PhD study on the therapy form: behavioral activation |
Dec 30, 2017 |
https://github.com/DARdk/IBA |
| 1101. Moscow Wi-Fi autologin |
pw.thedrhax.mosmetro |
Automatically connect to public networks of Moscow public transport |
2017-12-07 |
https://github.com/mosmetro-android/mosmetro-android |
| 1102. MouseApp |
fr.xtof54.mousetodon |
Mastodon multi-instances client |
2017-05-22 |
https://github.com/cerisara/mousetodon |
| 1103. Movian Remote |
com.claha.showtimeremote |
Use your Android device as a remote for Movian. |
Sep 23, 2018 |
https://github.com/claha/movianremote |
| 1104. Movie DB |
org.notabug.lifeuser.moviedb |
Search through movies and series and save them in a local offline database |
2018-05-29 |
https://notabug.org/nvb/MovieDB |
| 1105. MovieList |
com.jamontes79.scala.movielist |
With this app you can manage your movie collection, see trailer, share and more |
Nov 5, 2017 |
https://github.com/jamontes79/movieList |
| 1106. Movim |
com.movim.movim |
Decentralized Social Network |
2017-01-11 |
https://github.com/movim/movim_android |
| 1107. MozillaNlpBackend |
org.microg.nlp.backend.ichnaea |
UnifiedNlp location provider (Mozilla) |
2017-12-24 |
https://github.com/microg/IchnaeaNlpBackend |
| 1108. MqttPublisher Plugin |
com.fr3ts0n.androbd.plugin.mqtt |
# AndrOBD-MQTTPublisher\n\nPlugin for AndrOBD to publish OBD measurements to MQTT |
2018-03-19 |
https://github.com/fr3ts0n/AndrOBD-Plugin |
| 1109. MuPDF viewer |
com.artifex.mupdf.viewer.app |
Lightweight document viewer |
2018-05-23 |
https://git.ghostscript.com/?p=mupdf-android-viewer.git;a=summary |
| 1110. MuPDF |
com.artifex.mupdfdemo |
A fast, lightweight, high quality PDF/XPS/CBZ/EPUB viewer for Android devices. |
Apr 11, 2017 |
https://github.com/on4today/pdfViewer |
| 1111. Muh Triangles Live Wallpaper |
com.dosse.muhtriangles.gdx.android |
Animated Triangles on your Home Screen |
Jan 13, 2017 |
https://github.com/adolfintel/muhtriangles-android |
| 1112. Multi Slim |
org.droidtr.fblite |
Powered by DroidTR |
Dec 3, 2017 |
https://github.com/DroidTR/com.droidtr.fblite |
| 1113. Multicast Tester |
net.liveforcode.multicasttester |
A simple app for testing the receiving and sending of Multicast packets. |
Feb 4, 2017 |
https://github.com/MitchTalmadge/Multicast-Tester |
| 1114. Mupen64Plus AE |
org.mupen64plusae.v3.alpha |
Front end for Mupen64 Plus |
2018-05-31 |
https://github.com/mupen64plus-ae/mupen64plus-ae |
| 1115. Music Player (no ads) |
com.github.beenotung.musicplayer |
Play music under third-party app folder in background |
Mar 23, 2018 |
https://github.com/beenotung/music-player |
| 1116. Music Player Daemon |
org.musicpd |
Server-side application for playing music. |
Aug 17, 2018 |
https://github.com/jwise/musicpd |
| 1117. Music Player Demo |
com.sample.andremion.musicplayer |
From UI Proposal to Code |
Jun 15, 2018 |
https://github.com/coderba/radiom |
| 1118. Music Player GO |
com.iven.musicplayergo |
Very slim music player |
2018-06-04 |
https://github.com/enricocid/Music-Player-GO |
| 1119. Music Player |
com.simplemobiletools.musicplayer |
A clean music player with a customizable widget. |
2018-05-23 |
https://github.com/SimpleMobileTools/Simple-Music-Player |
| 1120. Music Sight Reading II |
com.viks.sire2 |
Music Sight Reading - Android application to improve music sheets reading skills |
Jul 7, 2017 |
https://github.com/ordago/sire |
| 1121. MusicID: MP3 Tag Editor |
io.github.manishsgaikwad.musicid |
Helps you organize your Music\n\nMetadata Editor for Music Files |
Jun 25, 2017 |
https://github.com/manishsgaikwad/MusicID |
| 1122. Muspy for Android |
com.danielme.muspyforandroid |
The easiest way to follow your favourite artists!! |
Mar 26, 2018 |
https://github.com/danielme-com/Muspy-for-Android |
| 1123. Muzei - Bing Image of the Day |
de.devmil.muzei.bingimageofthedayartsource |
A Muzei art source that retrieves the Bing image of the day |
2018-03-10 |
https://github.com/devmil/muzei-bingimageoftheday |
| 1124. Muzei |
net.nurik.roman.muzei |
Live wallpaper of famous art |
2018-02-16 |
https://github.com/romannurik/muzei |
| 1125. My Contacts |
community.fairphone.mycontacts |
Quickly access your contacts |
2017-05-31 |
https://github.com/WeAreFairphone/android_packages_apps_MyContactsWidget |
| 1126. My Expenses |
org.totschnig.myexpenses |
Easy to use personal finance manager: rich functionality and Open Source |
2018-06-02 |
https://github.com/mtotschnig/MyExpenses |
| 1127. My Location |
net.mypapit.mobile.myposition |
Share your location |
2018-06-04 |
https://github.com/gjedeer/mylocation |
| 1128. My Pressure |
pl.pcz.wimii.mind.mypressure |
Pulse and blood pressure journal that allows you to monitor your health |
Aug 7, 2017 |
https://github.com/KajetanSuchanski/MyPressure |
| 1129. MyAdvent - Advent Calendars 2018 |
org.faudroids.myadvent |
Easy & personal online advent calendars for 2018! 🎅☃️ |
Oct 1, 2018 |
https://github.com/FauDroids/XmasCalendar |
| 1130. MyFlightbook for Android |
com.myflightbook.android |
Access your flying logbook from your phone, tablet, or on the web. |
Sep 12, 2018 |
https://github.com/ericberman/MyFlightbookAndroid |
| 1131. MyOwnNotes |
org.aykit.MyOwnNotes |
Notes management for ownCloud |
2017-03-24 |
https://github.com/aykit/MyOwnNotes |
| 1132. Mysplash |
com.wangdaye.mysplash |
View stream of high resolution images |
2018-05-02 |
https://github.com/WangDaYeeeeee/Mysplash |
| 1133. Mythling |
com.oakesville.mythling |
Mobile Client for MythTV |
Aug 19, 2018 |
https://github.com/oakesville/mythling |
| 1134. N.A. Ireland |
ie.nasouth.android.naireland |
Narcotics Anonymous Ireland |
Apr 7, 2018 |
https://github.com/paulnagle/NA-IRELAND-ANDROID-V2 |
| 1135. NASA Images |
atm.nasaimages |
Show images and their info from NASA repository |
2017-06-22 |
https://gitlab.com/atorresm/NASAImages/tree/HEAD |
| 1136. NC Bookmark Viewer |
org.lenchan139.ncbookmark |
This is a lightweight viewer for Nextcloud bookmarks |
2018-06-02 |
https://github.com/lenchan139/NCBookmark |
| 1137. NDN-Opp |
pt.ulusofona.copelabs.ndn |
NDN Forwarding Daemon for Android |
Apr 30, 2018 |
https://github.com/COPELABS-SITI/nfd-android |
| 1138. NFC Message Board |
com.briankhuu.nfcmessageboard |
Decentralized Deaddrop Based NFC Tag Message/Bulletin Board. |
Jan 7, 2018 |
https://github.com/mofosyne/NFCMessageBoard |
| 1139. NFC Reader |
cache.wind.nfc |
NFC Reader can read contactless IC card use NFC hardware. |
Jul 28, 2018 |
https://github.com/cachewind/NfcReader |
| 1140. NFC Reader |
se.anyro.nfc_reader |
Read NFC tag info |
2017-03-03 |
https://github.com/nadam/nfc-reader |
| 1141. NHBooks |
moe.feng.nhentai |
NHBooks is a Material Design NHentai client |
2017-07-19 |
https://github.com/FengMoeTeam/NHentai-android |
| 1142. NPR News |
org.npr.android.news |
NPR News: The NPR and public radio station player for your Android. |
Jul 18, 2018 |
https://github.com/unofficial/npr-android-app |
| 1143. NREMT Practical Flashcards |
com.nremt_practical_flashcards |
Master the National Registry of Emergency Medical Technicians practical. |
Mar 20, 2017 |
https://github.com/sshumway/NREMT_Practical_Flashcards |
| 1144. NYC Subway Card Refill |
com.aczoom.nycmetrocard |
Minimize leftover amounts when refilling NYC MetroCard. |
Apr 4, 2017 |
https://github.com/TakiNAIM/nyc-metrocard-refill |
| 1145. NZSL Dictionary |
com.hewgill.android.nzsldict |
NZ Sign Language - contains 4500+ sign entries with videos and diagrams |
Jun 12, 2018 |
https://github.com/rabid/nzsl-dictionary-android |
| 1146. Nanaimo RDN Transit System Bus - MonTransit |
org.mtransit.android.ca_nanaimo_rdn_transit_system_bus |
Nanaimo RDN Transit System buses for MonTransit.\nSchedule. Real time. News. |
Oct 12, 2018 |
https://github.com/mtransitapps/ca-nanaimo-rdn-transit-system-bus-android |
| 1147. National Geographic for Muzei |
de.msal.muzei.nationalgeographic |
The National Geographic photo of the day for Muzei. |
Aug 18, 2018 |
https://github.com/msal/muzei-nationalgeographic |
| 1148. Native Clipboard Manager |
com.dhm47.nativeclipboard |
Copy and save texts, accessed simply by double tapping any text field to paste. |
Apr 15, 2017 |
https://github.com/DHM47/Native-Clip-Board |
| 1149. Native Root Checker |
com.kozhevin.rootchecks |
It gives an indication of root |
Sep 27, 2017 |
https://github.com/DimaKoz/meat-grinder |
| 1150. NekoSMS - advanced SMS blocker |
com.crossbowffs.nekosms |
An advanced SMS blocker for Android 4.4+ (requires Xposed framework) |
Jun 21, 2018 |
https://github.com/apsun/NekoSMS |
| 1151. Nerdeyim Ben |
com.habertrend.nerdeyimben |
Where you opposite you has never been so easy to tell! |
Dec 21, 2017 |
https://github.com/sezginonline/Nerdeyim-Ben |
| 1152. Net Monitor |
org.secuso.privacyfriendlynetmonitor |
Shows network connections of installed apps |
2018-03-31 |
https://github.com/SecUSo/privacy-friendly-netmonitor |
| 1153. NetGuard |
eu.faircode.netguard |
Block network access |
2018-05-25 |
https://github.com/M66B/NetGuard |
| 1154. NetSwitch |
cz.antecky.netswitch |
Connectivity widget |
2018-04-17 |
https://github.com/tantecky/android/tree/HEAD/NetSwitch |
| 1155. Network Monitor |
ca.rmen.android.networkmonitor |
Check network connectivity |
2017-12-04 |
https://github.com/caarmen/network-monitor |
| 1156. Neural circuit simulation benchmark for Android |
com.nebula.androidneuronsimulator |
Benchmark simulation about neural circuit simulations with android environments |
Jul 23, 2017 |
https://github.com/DaisukeMiyamoto/android-neuron-simulator |
| 1157. Neurodoro |
com.neurodoro |
A dynamic brain-responsive pomodoro timer |
Feb 19, 2018 |
https://github.com/jdpigeon/neurodoro |
| 1158. Neuronify |
net.ovilab.neuronify |
Neural networks in an app |
Feb 26, 2017 |
https://github.com/dragly/hodgkin-huxley |
| 1159. NewPipe |
org.schabi.newpipe |
Lightweight YouTube frontend |
2018-06-04 |
https://github.com/TeamNewPipe/NewPipe |
| 1160. NewsBlur |
com.newsblur |
News reader |
2018-04-24 |
https://github.com/samuelclay/NewsBlur |
| 1161. NextGIS Mobile |
com.nextgis.mobile |
Mobile GIS for field data collection and editing. |
Oct 4, 2018 |
https://github.com/nextgis/nextgismobile |
| 1162. NextINpact (Unofficial) |
com.pcinpact |
Browse NextINpact |
2017-10-18 |
https://github.com/AnaelMobilia/NextINpact-Unofficial |
| 1163. Nextcloud Bookmarks |
org.schabi.nxbookmarks |
A front end for the Nextcloud Bookmark app |
2018-05-12 |
https://github.com/theScrabi/OCBookmarks |
| 1164. Nextcloud News |
de.luhmer.owncloudnewsreader |
News/feed reader |
2018-05-18 |
https://github.com/owncloud/News-Android-App |
| 1165. Nextcloud SMS |
fr.unix_experience.owncloud_sms |
Synchronize your SMS messages with ownCloud |
2018-03-23 |
https://github.com/nerzhul/ownCloud-SMS-App |
| 1166. Nextcloud Talk |
com.nextcloud.talk2 |
Have private video calls and chat using your own server. |
2018-05-21 |
https://github.com/nextcloud/talk-android |
| 1167. Nextcloud dev |
com.nextcloud.android.beta |
Synchronization client |
2018-06-04 |
https://github.com/nextcloud/android |
| 1168. Nextcloud |
com.nextcloud.client |
Synchronization client |
2018-05-31 |
https://github.com/nextcloud/android |
| 1169. Niagara Falls WEGO Bus - MonTransit |
org.mtransit.android.ca_niagara_falls_wego_bus |
Niagara Falls WEGO Bus for MonTransit.\nSchedule. News. |
Aug 9, 2018 |
https://github.com/mtransitapps/ca-niagara-falls-wego-bus-android |
| 1170. Niagara Region Transit Bus - MonTransit |
org.mtransit.android.ca_niagara_region_transit_bus |
Niagara Region Transit Bus for MonTransit.\nSchedule. News. |
Sep 14, 2018 |
https://github.com/mtransitapps/ca-niagara-region-transit-bus-android |
| 1171. Night Light |
com.corphish.nightlight.generic |
An app to adjust blue light intensity, powered by KCAL |
2018-02-16 |
https://github.com/corphish/NightLight |
| 1172. Night Screen |
info.papdt.blackblub |
Prevent your eyes from being hurt by screen light |
2017-12-04 |
https://github.com/fython/Blackbulb |
| 1173. Nita Puzzle |
ru.nitagames.nitapuzzle |
Нит1э пазл - развивающая игра, предназначенная для самых маленьких пользователей |
Feb 4, 2018 |
https://github.com/capone212/AdygaPuzzle |
| 1174. NitroShare |
net.nitroshare.android |
Cross-platform network file transfer |
2018-04-27 |
https://github.com/nitroshare/nitroshare-android |
| 1175. NoCam Camera Blocker |
mandarin.camerablocker |
Open source, super-simple app that blocks your camera system-wide. |
Apr 29, 2017 |
https://github.com/jurijalbegger/camerablocker |
| 1176. Nock Nock (BETA) |
com.afollestad.nocknock |
Monitor your websites for maximum uptime |
2017-10-01 |
https://github.com/afollestad/nock-nock |
| 1177. NoiseCapture |
org.noise_planet.noisecapture |
NoiseCapture is an App dedicated to the measurement of environmental noise. |
Apr 20, 2018 |
https://github.com/Picaut/NoiseCapture |
| 1178. NominatimNlpBackend |
org.microg.nlp.backend.nominatim |
UnifiedNlp geocoding provider (MapQuest Nominatim) |
2017-05-22 |
https://github.com/microg/NominatimGeocoderBackend |
| 1179. Nordschleife Pacenotes |
de.seleven.nordschleifepacenotes |
Master the Nürburgring Nordschleife - the most dangerous race track of the world |
Oct 4, 2018 |
https://github.com/mgrgic/nordschleife |
| 1180. Nori |
io.github.tjg1.nori |
Online tag-based image archive viewer |
2017-07-27 |
https://github.com/tjg1/nori |
| 1181. Notable Plus |
com.icechen1.notable.pro |
Add and manage reminders |
2017-06-03 |
https://github.com/icechen1/Notable |
| 1182. Notas |
victor_gonzalez_ollervidez.notas |
Write, share, enjoy. |
Aug 25, 2018 |
https://github.com/victorOllervidez/Notas |
| 1183. Note Crypt Pro |
com.notecryptpro |
Keep your notes safe and secure |
2017-02-26 |
https://github.com/RyuzakiKK/NoteCrypt |
| 1184. NoteBuddy |
nl.yoerinijs.notebuddy |
Store encrypted notes |
2017-07-19 |
https://github.com/YoeriNijs/NoteBuddy |
| 1185. NoteDirector |
com.amar.NoteDirector |
NoteDirector specially targets students to manage their notes in a few taps!!! |
Oct 15, 2017 |
https://github.com/AMARJITVS/NoteDirector |
| 1186. Notepad JW |
pl.bubson.notepadjw |
Notes manager and editor with live view of entered verses. |
Oct 16, 2018 |
https://github.com/ja-kub/NotepadJW |
| 1187. Notepad for Google Drive™ |
rkr.notepad.drive |
Online and offline text editor for Google Drive™ |
Feb 26, 2018 |
https://github.com/rkkr/drive-notepad |
| 1188. Notepad |
com.farmerbb.notepad |
A simple, bare-bones, no-frills note taking app |
2018-05-21 |
https://github.com/farmerbb/Notepad |
| 1189. Noter - simple and adfree note & todo Material app |
com.bowenchin.android.noter |
A simple note & todo app that stores data locally and privately on your device. |
Sep 25, 2018 |
https://github.com/bowenchin/Remindr |
| 1190. Notes |
com.simplemobiletools.notes |
A simple text field for adding quick notes, without ads. |
2018-05-21 |
https://github.com/SimpleMobileTools/Simple-Notes |
| 1191. Notes |
it.niedermann.owncloud.notes |
View and edit notes on Nextcloud |
2018-05-22 |
https://github.com/stefan-niedermann/nextcloud-notes |
| 1192. Note |
xyz.hanks.note |
Note app for Android |
Oct 13, 2018 |
https://github.com/hanks-zyh/note |
| 1193. Notification Center for Pebble |
com.matejdro.pebblenotificationcenter |
Notification system for Pebble watch |
Nov 18, 2017 |
https://github.com/matejdro/PebbleNotificationCenter-Android |
| 1194. Notification Forwarder Pro |
org.groebl.sms |
View App-Notifications on your Bluetooth-supported Car-Infotainment-System |
Oct 13, 2018 |
https://github.com/BennoGAP/notification-forwarder |
| 1195. Notifications for Facebook |
org.surrel.facebooknotifications |
Reproduce the Facebook Notifications in the Android notifications-drawer |
2017-04-27 |
https://github.com/gsurrel/FacebookNotifications |
| 1196. Nounours and friends |
ca.rmen.nounours |
Nounours the teddy bear and friends |
2017-02-20 |
https://github.com/caarmen/nounours-android |
| 1197. Novelty |
ro.edi.novelty |
Just news. |
Feb 21, 2018 |
https://github.com/ediTLJ/novelty |
| 1198. Nudge |
com.ksp.nudge |
An automated text messaging service |
Sep 29, 2018 |
https://github.com/kwhite17/Nudge |
| 1199. Number Guesser |
com.numguesser.tonio_rpchp.numberguesser |
Guess the right number |
2017-10-18 |
https://github.com/Reepeecheep/NumberGuesser |
| 1200. NyaaPantsu |
cat.pantsu.nyaapantsu |
An app interface interacting with NyaaPantsu |
2017-07-09 |
https://github.com/NyaaPantsu/NyaaPantsu-android-app |
| 1201. OCReader |
email.schaal.ocreader |
Reader for Nextcloud news |
2018-06-02 |
https://github.com/schaal/ocreader |
| 1202. OCS Inventory Agent |
org.ocs.android.agent |
Android agent for OCS Inventory |
Nov 10, 2017 |
https://github.com/OCSInventory-NG/AndroidAgent |
| 1203. ODK Collect |
org.odk.collect.android |
ODK Collect is a phone-based replacement for your paper forms. |
Oct 4, 2018 |
https://github.com/SDRC-India/collect |
| 1204. OGN Viewer - FLARM Radar |
com.meisterschueler.ognviewer |
Visualises the glider traffic of the \Open Glider Network|Sep 10, 2018 |
https://github.com/Meisterschueler/ogn-viewer-android |
|
| 1205. OGS |
com.ogsdroid |
Play Go online |
2017-08-11 |
https://github.com/nathanj/ogsdroid |
| 1206. OI File Manager |
org.openintents.filemanager |
File manager |
2018-05-01 |
https://github.com/openintents/filemanager |
| 1207. OI Flashlight |
org.openintents.flashlight |
Helps you find your way in the dark |
2017-02-18 |
https://github.com/openintents/flashlight |
| 1208. OI Notepad |
org.openintents.notepad |
Take notes |
2017-02-18 |
https://github.com/openintents/notepad |
| 1209. OI Shopping List |
org.openintents.shopping |
Keep track of your shopping items |
2017-05-15 |
https://github.com/openintents/shoppinglist |
| 1210. OONI Probe |
org.openobservatory.ooniprobe |
Open Observatory of Network Interference (OONI) |
2018-02-13 |
https://github.com/TheTorProject/ooniprobe-android |
| 1211. OSM Share Location Plugin |
com.samwhited.opensharelocationplugin |
A location sharing plugin for the instant messenger Conversations. |
May 1, 2018 |
https://github.com/kriztan/OpenShareLocationPlugin |
| 1212. OSMBugs |
org.gittner.osmbugs |
View OpenStreetMap errors |
2017-10-01 |
https://github.com/Gittner/OSMBugs |
| 1213. OSMTracker for Android™ |
net.osmtracker |
Allows you to track your journeys with tags, voice record, and photos. |
Jul 21, 2018 |
https://github.com/nguillaumin/osmtracker-android |
| 1214. OWASP Seraphimdroid security |
org.owasp.seraphimdroid |
OWASP Seraphimdroid is a privacy, anti-virus and security protection app |
Aug 21, 2017 |
https://github.com/cyberintruder/owasp-seraphimdroid |
| 1215. Oakville Transit Bus - MonTransit |
org.mtransit.android.ca_oakville_transit_bus |
Oakville Transit buses for MonTransit.\nSchedule. News. Service Updates. |
Sep 4, 2018 |
https://github.com/mtransitapps/ca-oakville-transit-bus-android |
| 1216. ObscuraCam |
org.witness.sscphase1 |
The Privacy Camera |
2018-04-28 |
https://github.com/guardianproject/ObscuraCam |
| 1217. Occam's Flashlight |
co.ericp.flashlight |
The simplest possible flashlight. |
May 3, 2017 |
https://github.com/epeterson320/flashlight |
| 1218. Ocelot |
org.shirakumo.ocelot |
Lichat client |
2018-03-10 |
https://github.com/Shirakumo/ocelot |
| 1219. OctoDroid |
com.gh4a |
GitHub client |
2018-05-16 |
https://github.com/slapperwan/gh4a |
| 1220. Octodo |
com.gaboratorium.octodo |
A free, easy-to-use, open-source task management app. |
May 20, 2017 |
https://github.com/gaboratorium/octodo |
| 1221. Odyssey |
org.gateshipone.odyssey |
Listen to music files |
2018-04-10 |
https://github.com/gateship-one/odyssey |
| 1222. OgreSampleBrowser |
org.ogre.browser |
Object-Oriented Graphics Rendering Engine - Samples |
2018-02-28 |
https://github.com/OGRECave/ogre |
| 1223. Omni Notes FOSS |
it.feio.android.omninotes.foss |
Note taking open-source application aimed to have both a simple interface but ke |
2018-04-29 |
https://github.com/federicoiosue/Omni-Notes |
| 1224. Omni Notes |
it.feio.android.omninotes |
Opensource note-taking made easy and powerful |
May 28, 2018 |
https://github.com/federicoiosue/Omni-Notes |
| 1225. OmniROM Changelog |
com.bytehamster.changelog |
View recent changes of OmniROM/LineageOS |
2018-02-28 |
https://gitlab.com/ByteHamster/changelog/tree/HEAD |
| 1226. Om |
com.enjoyingfoss.om |
Meditate mindfully for increased emotional intelligence |
2018-05-16 |
https://gitlab.com/enjoyingfoss/om |
| 1227. One Movie |
com.isscroberto.onemovie |
Find the perfect movie to watch! |
Oct 1, 2018 |
https://github.com/robertoissc/OneMovie-Android |
| 1228. OneTimePass |
com.github.onetimepass |
Two-factor (TOTP) authentication |
2018-02-16 |
https://github.com/OneTimePass/OneTimePass |
| 1229. OneTwo |
com.nicue.onetwo |
Provides you with dices, counter and timers |
2017-06-13 |
https://github.com/ndleyton/OneTwo |
| 1230. Onyx - AI bot |
com.element.onyx |
Artificial Intelligence. Personified. |
Dec 30, 2017 |
https://github.com/siddhantvinchurkar/Onyx |
| 1231. Opark |
se.barsk.park |
The nice and easy way to park your car at the HERN Labs Linköping office |
May 21, 2018 |
https://github.com/nibarius/opera-park-android |
| 1232. OpeNoise |
it.piemonte.arpa.openoise |
Noise level meter |
Jun 19, 2018 |
https://github.com/Arpapiemonte/openoise-meter-android |
| 1233. Open Camera |
net.sourceforge.opencamera |
Camera App |
2018-04-27 |
https://sourceforge.net/p/opencamera/code |
| 1234. Open Fit: Open Source Gear Fit |
com.solderbyte.openfit |
Allows Non-Samsung phones to use the Samsung Gear Fit |
May 19, 2018 |
https://github.com/cpvyb/OpenFit |
| 1235. Open Flood |
com.gunshippenguin.openflood |
A simple but addictive flood fill game |
2017-01-29 |
https://github.com/GunshipPenguin/open_flood |
| 1236. Open Foris Collect Mobile |
org.openforis.collect |
Intuitive data collection and validation in the field |
Oct 11, 2018 |
https://github.com/openforis/collect-mobile |
| 1237. Open GPS Tracker |
nl.sogeti.android.gpstracker |
Open Source recording, storing and accessing of your routes: Open GPS Tracker |
May 27, 2017 |
https://github.com/henrycg/GSM-Signal-Tracking- |
| 1238. Open Link With... |
com.tasomaniac.openwith |
Open links in native apps when you're stuck in the browser! 🚀 |
Oct 5, 2018 |
https://github.com/tasomaniac/OpenLinkWith |
| 1239. Open Link With |
com.tasomaniac.openwith.floss |
Open links in native apps when you're stuck in the browser! 🚀 |
2018-04-27 |
https://github.com/tasomaniac/OpenLinkWith |
| 1240. Open Map |
org.osmdroid |
OpenStreetMap map viewer |
2018-04-27 |
https://github.com/osmdroid/osmdroid |
| 1241. Open Note Scanner |
com.todobom.opennotescanner |
Scan documents, handwritten notes or arts |
2018-04-10 |
https://github.com/ctodobom/OpenNoteScanner |
| 1242. Open Pet Food Facts |
org.openpetfoodfacts.scanner |
Look up pet food ingredients, allergens, nutrition facts |
2018-06-02 |
https://github.com/openfoodfacts/openfoodfacts-androidapp |
| 1243. Open Sudoku |
org.moire.opensudoku |
Sudoku game |
2018-06-02 |
https://github.com/ogarcia/opensudoku |
| 1244. Open Texas Method |
bro.tm |
Free and open source Texas Method plan with a variety of tools |
Sep 2, 2017 |
https://github.com/imilas/tm |
| 1245. Open4speed II tech demo |
com.lvonasek.o4s |
Development version opensource racing game. |
Jun 8, 2017 |
https://github.com/lvonasek/Open4speed |
| 1246. OpenAPK |
com.dkanada.openapk |
A material design app manager forked from ML Manager |
2017-12-15 |
https://github.com/dkanada/OpenAPK |
| 1247. OpenArchive |
net.opendasharchive.openarchive.release |
Organize and share media |
2017-12-04 |
https://github.com/OpenArchive/openarchive |
| 1248. OpenBeautyFacts |
openfoodfacts.github.scrachx.openbeauty |
Look up cosmetic |
2018-06-02 |
https://github.com/openfoodfacts/openfoodfacts-androidapp |
| 1249. OpenBikeSharing |
be.brunoparmentier.openbikesharing.app |
Shared bikes availability in your city |
2017-05-12 |
https://github.com/bparmentier/OpenBikeSharing |
| 1250. OpenBmapNlpBackend |
org.openbmap.unifiedNlp |
UnifiedNlp location provider (Openbmap) |
2017-08-23 |
https://github.com/wish7code/org.openbmap.unifiedNlpProvider |
| 1251. OpenFoodFacts |
openfoodfacts.github.scrachx.openfood |
Look up food ingredients, allergens, nutrition facts |
2018-06-02 |
https://github.com/openfoodfacts/openfoodfacts-androidapp |
| 1252. OpenGL ES CapsViewer |
de.saschawillems.glescapsviewer |
Developer tool to gather OpenGL ES hardware implementation details. |
Apr 1, 2018 |
https://github.com/SaschaWillems/glEsCapsViewer |
| 1253. OpenGapps Downloader |
org.opengappsdownloader |
Download OpenGapps zip |
2018-04-28 |
https://github.com/daktak/opengapps_downloader |
| 1254. OpenHub for GitHub |
com.thirtydegreesray.openhub |
An open source GitHub client app, faster and concise. |
Mar 24, 2018 |
https://github.com/ThirtyDegreesRay/OpenHub |
| 1255. OpenKeychain |
org.sufficientlysecure.keychain |
Encrypt your Files and Communications. Compatible with the OpenPGP Standard. |
2018-05-12 |
https://github.com/openpgp-keychain/openpgp-keychain |
| 1256. OpenLauncher |
com.benny.openlauncher |
Launch applications and manage homescreen |
2018-04-14 |
https://github.com/OpenLauncherTeam/openlauncher |
| 1257. OpenL |
com.anthony.deepl.openl |
Unofficial application of DeepL Translator |
2018-06-04 |
https://github.com/Anthony-Reboul/AndroidDeepL |
| 1258. OpenMBTA |
com.kaja.openmbta |
OpenMBTA provides schedule information for the Boston MBTA metro system. |
Apr 15, 2017 |
https://github.com/hyoun98/openmbta-android |
| 1259. OpenManga |
org.nv95.openmanga |
Read your favorit manga |
2017-10-08 |
https://github.com/nv95/OpenManga |
| 1260. OpenMensa |
de.uni_potsdam.hpi.openmensa |
Meals for university canteens |
2018-05-21 |
https://github.com/domoritz/open-mensa-android |
| 1261. OpenMoneyBox |
com.igisw.openmoneybox |
Budget management application |
2017-11-05 |
https://launchpad.net/bilancio |
| 1262. OpenOverlayRouter |
org.openoverlayrouter.noroot |
OpenOverlayRouter ,an open-source appl to create programmable overlay networks |
Jan 31, 2017 |
https://github.com/Lluiso/oor |
| 1263. OpenPad(Notepad) |
com.eskeptor.openTextViewer |
Notepad with only simple note. (Make sure to check the Help after installation.) |
Oct 15, 2018 |
https://github.com/Eskeptor/OpenPad-for-Android |
| 1264. OpenPass |
com.example.openpass |
Reimplementation of SafeNet MobilePass |
2017-08-07 |
https://github.com/ars3niy/openpass |
| 1265. OpenRedmine |
jp.redmine.redmineclient |
Redmine client |
2017-09-06 |
https://github.com/indication/OpenRedmine |
| 1266. OpenSeizureDetector |
uk.org.openseizuredetector |
Epileptic seizure detector / alarm that utilises a Pebble smart-watch. |
Feb 23, 2018 |
https://github.com/OpenSeizureDetector/Android_Pebble_SD |
| 1267. OpenShift |
com.digitalfishfun.openshift |
Adjust screen color values |
2017-06-23 |
https://github.com/joonatoona/OpenShift |
| 1268. OpenSongApp |
com.garethevans.church.opensongtablet |
A portable music songbook for worship leaders and musicians. |
Aug 29, 2018 |
https://github.com/thebigg73/OpenSongTablet |
| 1269. OpenVPN for Android |
de.blinkt.openvpn |
OpenVPN without root |
2018-05-18 |
https://github.com/schwabe/ics-openvpn |
| 1270. OpenVegeMap |
pro.rudloff.openvegemap |
Find vegetarian and vegan restaurants in your city |
2018-05-27 |
https://github.com/Rudloff/openvegemap-cordova |
| 1271. OpenWebNet |
com.github.openwebnet |
OpenWebNet Android client for My Home BTicino and Legrand home automation system |
Apr 15, 2018 |
https://github.com/openwebnet/openwebnet-android |
| 1272. OpenWort |
de.digisocken.openwort |
Einfacher offline Thesaurus (Nachschlagewerk) der deutschen Sprache |
2018-05-25 |
https://github.com/no-go/Wortschatz |
| 1273. Orgzly |
com.orgzly |
Outliner for notes and tasks in plain-text |
2018-05-16 |
https://github.com/orgzly/orgzly-android |
| 1274. Orléans Express Bus - MonTransit |
org.mtransit.android.ca_quebec_orleans_express_bus |
Orléans Express bus for MonTransit.\nSchedules. News. |
Sep 17, 2018 |
https://github.com/mtransitapps/ca-quebec-orleans-express-bus-android |
| 1275. OsMoDroid for OsMo Monitoring, online gps tracker |
com.OsMoDroid |
Exchange your geodata online: your location, points, tracks |
Oct 6, 2018 |
https://github.com/OpenStreetMap-Monitoring/OsMoDroid |
| 1276. Oscilloscope |
org.billthefarmer.scope |
Audio Oscilloscope and Spectrum |
2018-04-24 |
https://github.com/billthefarmer/scope |
| 1277. OsmAnd Contour lines |
net.osmand.srtmPlugin.paid |
Show contour lines in OSMAnd |
2017-11-17 |
https://github.com/osmandapp/Osmand |
| 1278. OsmAnd~ |
net.osmand.plus |
Global Mobile Map Viewing & Navigation for Offline and Online OSM Maps |
2018-05-29 |
https://github.com/osmandapp/Osmand |
| 1279. Ottawa Bus Follower |
net.argilo.busfollower |
See the locations and estimated arrival times of Ottawa buses. |
Aug 31, 2018 |
https://github.com/jfederico/BusFollower |
| 1280. Ottawa OC Transpo Bus - MonTransit |
org.mtransit.android.ca_ottawa_oc_transpo_bus |
Ottawa OC Transpo buses for MonTransit.\nSchedule. Real-time status. News. |
Oct 16, 2018 |
https://github.com/mtransitapps/ca-ottawa-oc-transpo-bus-android |
| 1281. Ottawa OC Transpo OTrain - MonTransit |
org.mtransit.android.ca_ottawa_oc_transpo_train |
Ottawa OC Transpo OTrain for MonTransit.\nSchedule. Real-time status. News. |
Sep 28, 2018 |
https://github.com/mtransitapps/ca-ottawa-oc-transpo-train-android |
| 1282. OurGUS |
io.timsueberkrueb.ourgus |
Unofficial Gymnasium Unterrieden Sindelfingen (GUS) application |
Apr 21, 2018 |
https://github.com/tim-sueberkrueb/ourgus |
| 1283. OurVLE |
com.stoneapp.ourvlemoodle2 |
Provides educational content from all your courses at your fingertips. |
Sep 22, 2017 |
https://github.com/stonaxstudios/OurVLE |
| 1284. Overchan (fork) |
bus.chio.wishmaster |
Browse multiple imageboards |
2018-02-16 |
https://github.com/AliceCA/Overchan-Android |
| 1285. OwnTracks |
org.owntracks.android |
Your location companion |
Jul 5, 2017 |
https://github.com/friesenkiwi/android |
| 1286. OyVer |
org.canthack.tris.oyver |
Oy Client |
Feb 13, 2017 |
https://github.com/tristan2468/OyVer |
| 1287. Oz! Comic Reader |
es.jmoral.ozreader |
The easiest way to save and read your comics |
Jul 25, 2018 |
https://github.com/owniz/OzComicReader |
| 1288. PAT Track |
rectangledbmi.com.pittsburghrealtimetracker |
Track the public transit buses of Pittsburgh Port Authority in realtime! |
Sep 19, 2017 |
https://github.com/rectangle-dbmi/Realtime-Port-Authority |
| 1289. PDF CONVERTER |
swati4star.createpdf |
Easily convert Images to PDF using our PDF Converter application! |
Oct 10, 2018 |
https://github.com/Azooz2014/Images-to-PDF |
| 1290. PDF Creator |
de.baumann.pdfcreator |
Create and edit PDF files |
2017-06-22 |
https://github.com/scoute-dich/PDFCreator |
| 1291. PDF Viewer & Book Reader |
the.pdfviewer3 |
PDF Viewer & Document Reader: Best way to download, read & edit PDFs / documents |
Feb 2, 2018 |
https://github.com/ieee8023/PDFViewer |
| 1292. PDF2Image Plugin |
jp.co.muratec.pdf2image |
This is a plug-in application to print the PDF file in Muratec Mobile app. |
May 9, 2018 |
https://github.com/ce-app-dev/PDF2ImageForEP |
| 1293. PGPAuth |
org.lf_net.pgpunlocker |
Send PGP-verified requests |
2017-05-20 |
https://github.com/PGPAuth/PGPAuth_Android |
| 1294. PGPClipper |
moe.minori.pgpclipper |
Add PGP support via clipboard |
2018-02-20 |
https://github.com/Mnkai/PGPClipper |
| 1295. PIXEL Editor |
com.ledpixelart.pixelesque |
PIXEL Editor |
Jul 12, 2017 |
https://github.com/alinke/PixelEditor |
| 1296. PLEN Connect |
jp.plen.plenconnect2 |
デスクトップ・ヒューマノイド「PLEN」用，コントローラ＆ヴィジュアルプログラミングツール |
May 27, 2018 |
https://github.com/plenprojectcompany/plen-Scenography_Android |
| 1297. PPSSPP - PSP emulator |
org.ppsspp.ppsspp |
Play PSP games on your Android device, at high definition with extra features! |
Jun 5, 2018 |
https://github.com/janbobo/ppsspp |
| 1298. PReVo |
uk.co.busydoingnothing.prevo |
Esperanto dictionary |
2018-02-13 |
https://github.com/bpeel/prevo |
| 1299. PSIAndroid |
com.phpsysinfo |
PSIAndroid is a phpSysInfo client for monitoring your systems |
Aug 7, 2018 |
https://github.com/rk4an/psiandroid |
| 1300. PSLab |
io.pslab |
Experiments with the FOSSASIA Pocket Science App and connect to PSLab Hardware |
Oct 4, 2018 |
https://github.com/CloudyPadmal/pslab-android |
| 1301. PSN中文站 |
com.psnine |
Psnine第三方安卓客户端 |
Feb 5, 2018 |
https://github.com/Smallpath/Psnine |
| 1302. PTSD Aid |
com.tytanapps.ptsd |
Determine if you have PTSD and find the resources to help you manage it |
Jun 4, 2017 |
https://github.com/TylerCarberry/PTSD-Aid |
| 1303. PV Display |
nl.jansipke.pvdisplay |
View your solar panel power and energy data from the PV Output website |
Dec 31, 2017 |
https://github.com/jansipke/pvdisplay |
| 1304. Padland |
com.mikifus.padland |
Etherpad manager |
2017-10-26 |
https://github.com/mikifus/padland |
| 1305. Pain Diary |
org.secuso.privacyfriendlypaindiary |
Helps you tracking pain |
2018-05-16 |
https://github.com/SecUSo/privacy-friendly-pain-diary |
| 1306. Paper Wallet |
ru.valle.btc |
Back up bitcoins |
2017-04-17 |
https://github.com/ValleZ/Paper-Wallet |
| 1307. PaperLaunch |
de.devmil.paperlaunch |
Side launcher in material design that launches apps with one gesture |
2018-03-10 |
https://github.com/devmil/PaperLaunch |
| 1308. Paper |
com.kn.paper_foss_theme |
Icon theme |
2017-11-24 |
https://github.com/beli3ver/Paper-FOSS-Theme |
| 1309. Paradex - Your Companion! |
net.mononz.paragon |
The go to unofficial Paragon companion app! |
Oct 14, 2018 |
https://github.com/mononz/Capstone-Project |
| 1310. Pardus |
at.pardus.android.browser |
Web client with enhanced features for the massive multiplayer online game Pardus |
Aug 19, 2017 |
https://github.com/MrLoick/pardus-android |
| 1311. PariDroid |
fr.ubordeaux.math.paridroid |
PARI/GP computer algebra system |
2018-05-26 |
http://pari.math.u-bordeaux.fr/cgi-bin/gitweb.cgi?p=paridroid.git;a=summary |
| 1312. ParkenDD |
de.jkliemann.parkendd |
Show available parking slots in major cities |
2018-05-07 |
https://github.com/jklmnn/ParkenDD |
| 1313. Parkscan |
uk.co.skatey.parkscan |
Parkrun barcode scanning app |
Sep 16, 2017 |
https://github.com/katiesandford/parkscan |
| 1314. Parrot Call Confirm |
com.sakurafish.parrot.callconfirm |
It is a simple and convenient outgoing call check application. |
Aug 15, 2018 |
https://github.com/sakurabird/Android-ParrotCallConfirm |
| 1315. Particle Constellations Live Wallpaper |
com.doctoror.particleswallpaper |
Flying particles forming constellations customizable live wallpaper |
Aug 5, 2018 |
https://github.com/Doctoror/ParticleConstellationsLiveWallpaper |
| 1316. PassAndroid |
org.ligi.passandroid |
View Passbook files |
2018-04-08 |
https://github.com/ligi/PassAndroid |
| 1317. Passarola Brewing |
pt.passarola |
Find out where you can drink your Passarola Brewing beer. |
Jan 15, 2017 |
https://github.com/ruigoncalo/passarola |
| 1318. PasseGares |
fr.nocle.passegares |
Voyager à travers les gares pour tamponner votre visa ! |
2018-03-10 |
https://framagit.org/JonathanMM/passegares |
| 1319. PasswdSafe - Password Safe |
com.jefftharris.passwdsafe |
PasswdSafe is a port of Password Safe (http://pwsafe.org) to Android |
May 28, 2018 |
https://github.com/tml/passwdsafe-code |
| 1320. Password Generator |
org.secuso.privacyfriendlypasswordgenerator |
Generate passwords |
2018-03-23 |
https://github.com/SecUSo/privacy-friendly-passwordgenerator |
| 1321. Password Hash |
com.uploadedlobster.PwdHash |
Create passwords for each website |
2018-05-12 |
https://github.com/phw/Android-PwdHash |
| 1322. Password Store |
com.zeapo.pwdstore |
Manage your passwords |
2018-04-03 |
https://github.com/zeapo/Android-Password-Store |
| 1323. Paste It |
org.teamblueridge.pasteitapp |
Paste It pastes any text to a Stikked installation on the web. |
Sep 15, 2017 |
https://github.com/teamblueridge/PasteIt |
| 1324. Pathfinder Dice Calculator |
processing.test.dice_calculator |
Quickly sum dice rolls! |
Jun 2, 2017 |
https://github.com/JosephSamela/Pathfinder-Dice-Calculator |
| 1325. Pauling |
fr.tailordev.pauling |
Scientific posters on the go! |
Oct 19, 2017 |
https://github.com/TailorDev/pauling |
| 1326. Paws and Stripes |
com.pawsandstripesnativeapp |
Paws and Stripes volunteer time tracking app |
Aug 8, 2017 |
https://github.com/mike-bynum/PawsAndStripesNativeApp |
| 1327. Peasant Simulator |
com.michaelfotiadis.advuncedpeasants |
A semi-realistic medieval fantasy RPG |
Oct 10, 2017 |
https://github.com/MikeFot/Android--Advunced-Peasants |
| 1328. Pedometer |
de.j4velin.pedometer |
Count your steps |
2018-03-31 |
https://github.com/j4velin/Pedometer |
| 1329. Pedometer |
org.secuso.privacyfriendlyactivitytracker |
Count steps |
2017-03-17 |
https://github.com/SecUSo/privacy-friendly-pedometer |
| 1330. Peg City Transit |
jessevivanco.com.pegcitytransit |
Find transit bus stops, and check upcoming stop schedules in Winnipeg. |
May 17, 2018 |
https://github.com/jvivanco28/PegCityTransit |
| 1331. Penn Mobile |
com.pennapps.labs.pennmobile |
Penn Mobile - University of Pennsylvania |
Aug 24, 2018 |
https://github.com/pennlabs/penn-mobile-android |
| 1332. Pentobi |
net.sf.pentobi |
Computer opponent for the board game Blokus. |
Oct 11, 2018 |
https://github.com/enz/pentobi |
| 1333. Perfect Pizza Dough Forever |
net.arpcentral.pizzadoh |
Making the perfect pizza begins with perfect dough. So make it perfect. |
Sep 18, 2018 |
https://github.com/j-arp/perfect-pizza |
| 1334. Perfect Viewer PDF&DJVU Plugin |
com.rookiestudio.perfectviewer.pdfplugin |
This is a Perfect Viewer plugin.\nLet Perfect Viewer support PDF & DJVU files. |
Apr 24, 2017 |
https://github.com/kiha-la/perfect-viewer-pdf-plugin |
| 1335. Periodical |
de.arnowelzel.android.periodical |
Menstrual/period calendar |
2018-03-27 |
https://github.com/arnowelzel/periodical |
| 1336. Periodicos Dominicanos |
com.wmendez.diariolibre |
Lee los principales periodicos de Republica Dominicana en una sola Aplicacion! |
Nov 4, 2017 |
https://github.com/wm3ndez/NewsReaders |
| 1337. Persian Calendar |
com.byagowi.persiancalendar |
View the Persian calendar |
2017-09-24 |
https://github.com/ebraminio/DroidPersianCalendar |
| 1338. Phone Profiles Plus |
sk.henrichg.phoneprofilesplus |
Automatically configure the device for life situations. |
Oct 18, 2018 |
https://github.com/Janfy/PhoneProfilesPlus |
| 1339. Phone Saver |
link.standen.michael.phonesaver |
Save files via Share menu |
2018-05-03 |
https://github.com/ScreamingHawk/phone-saver |
| 1340. PhoneFoneFun |
com.quaap.phonefonefun |
A playphone for toddlers |
2017-07-18 |
https://github.com/quaap/PhoneFoneFun |
| 1341. Phonetrax GPS tracker |
com.px |
Track phones GPS on maps using your web browser without killing battery life. |
Apr 11, 2018 |
https://github.com/samuelngs/px |
| 1342. Phonograph Music Player |
com.kabouzeid.gramophone |
Phonograph is an open source and material designed music player for Android. |
Aug 28, 2018 |
https://github.com/Xorok/Phonograph |
| 1343. PhotoLinkViewer |
net.nonylene.photolinkviewer |
You can preview various photos (twitter, flickr, ... ) by this app from URL. |
Aug 4, 2017 |
https://github.com/nonylene/PhotoLinkViewer |
| 1344. PhotoMon |
com.appiphany.nacc |
Detect environmental change with the PhotoMon App. |
Apr 24, 2018 |
https://github.com/NACC-Aus/Photomon-Android |
| 1345. PhotoPhase |
com.ruesga.android.wallpapers.photophase |
Tiled images wallpaper |
2018-02-20 |
https://github.com/jruesga/PhotoPhase |
| 1346. Physics Formulae |
com.physicsformulae.app |
Various physics formulae at your finger tips. |
Oct 11, 2017 |
https://github.com/wburhan2/PhysicsFormulae |
| 1347. Pi Trainer |
com.teinproductions.tein.pitrainer |
Helps you memorize irrational numbers |
Oct 1, 2018 |
https://github.com/teinvdlugt/PiTrainer |
| 1348. Picture Trainer |
at.hgz.picturetrainer |
Trainer for remembering names of things or persons. |
Oct 17, 2018 |
https://github.com/hgzojer/picturetrainer |
| 1349. Pig Latin Translator |
com.github.wbiddy.piglatintranslator |
Translate text into Pig Latin! |
Feb 19, 2017 |
https://github.com/willbiddy/piglatin |
| 1350. PinPoi |
io.github.fvasco.pinpoi |
Import and manage points of interest |
2018-04-27 |
https://github.com/fvasco/pinpoi |
| 1351. Pinboard |
com.pindroid |
Bookmark manager |
2017-02-08 |
https://github.com/maxpower47/PinDroid |
| 1352. Pinger network tool |
com.wt.pinger |
App to test ping |
Oct 11, 2018 |
https://github.com/kenumir/Pinger |
| 1353. PirateBox |
de.fun2code.android.piratebox |
PirateBox for Android |
May 19, 2018 |
https://github.com/joschi70/AndroidPirateBox |
| 1354. Pisa bike sharing - CicloPi |
com.whiterabbit.pisabike |
App non ufficiale di CicloPi, il servizio di bike sharing di Pisa |
May 7, 2017 |
https://github.com/fedepaol/BikeSharing |
| 1355. Pixel Filter |
screen.dimmer.pixelfilter |
Screen dimmer for AMOLED screens |
Jan 17, 2018 |
https://github.com/pelya/screen-dimmer-pixel-filter |
| 1356. PixelKnot |
info.guardianproject.pixelknot |
Hide messages inside files |
2017-02-18 |
https://github.com/guardianproject/PixelKnot |
| 1357. Pixiv for Muzei |
com.pixiv.muzei.pixivsource |
Muzei art source extension for Pixiv |
2018-03-05 |
https://github.com/dahlia/muzei-pixiv |
| 1358. Pjuu |
com.pjuu.otterdroid |
Access the Pjuu social network |
2017-01-13 |
https://github.com/pjuu/droidotter/ |
| 1359. Plain Wallpaper |
au.id.rlac.plainwall |
A simple, lightweight plain color live wallpaper. |
Oct 7, 2017 |
https://github.com/rlac/plainwall |
| 1360. Planet's Position |
planets.position |
Planet's positions and solar/lunar eclipse calculations. |
Aug 5, 2018 |
https://github.com/timgaddis/Planets-Position |
| 1361. PlanetCon |
com.dftec.planetcon |
Play a turn based strategy game |
2017-03-17 |
https://github.com/dftec-es/planetcon |
| 1362. Planning Poker |
saschpe.poker |
Planning Poker for phone, tablet and wear devices |
2017-11-17 |
https://github.com/saschpe/PlanningPoker |
| 1363. Play Music Exporter |
re.jcg.playmusicexporter |
Export music from Play Music |
2017-04-17 |
https://github.com/jcgruenhage/PlayMusicExporter |
| 1364. PlaylisTV Plugin Demo |
tv.playlis.plugin |
PlaylisTV Plugin Sample |
Mar 26, 2017 |
https://github.com/migueltarga/PlaylisTV-Plugin |
| 1365. Playlist Manager |
com.reissgrvs.spotifyplaylisttool |
Playlist Manager is a playlist management tool for Spotify. |
Dec 23, 2017 |
https://github.com/reissGRVS/SpotifyPlaylistTool |
| 1366. Playr |
biz.playr |
Player for digital signage content |
Jun 29, 2018 |
https://github.com/bizplay/playr-android-app |
| 1367. Pocket AMC Reader |
com.holdingscythe.pocketamcreader |
Android viewer for desktop application Ant Movie Catalog. |
Aug 12, 2018 |
https://github.com/elman22/pocket-amc-reader |
| 1368. Pocket Gopher |
com.gmail.afonsotrepa.pocketgopher |
A fast, elegant and modern Gopher Client |
2017-12-07 |
https://github.com/afonsotrepa/PocketGopher |
| 1369. Pocket Query Creator |
org.pquery |
Easily creates Geocaching.com Pocket Queries |
Oct 18, 2018 |
https://github.com/robneild/pocket-query-creator |
| 1370. Pocket Server(For MCPE) |
net.fengberd.minecraftpe_server |
*** READ THE DESCRIPTION BEFORE USING THIS APPLICATION. *** |
Sep 30, 2018 |
https://github.com/fengberd/MinecraftPEServer |
| 1371. Pocket Up |
com.jarsilio.android.pocketup |
Turn the display on by waving |
2018-04-14 |
https://gitlab.com/juanitobananas/pocket-up/tree/HEAD |
| 1372. PocketMaps |
com.junjunguo.pocketmaps |
View maps and use offline routing and navigation system |
2018-03-31 |
https://github.com/junjunguo/PocketMaps |
| 1373. PodEmu - iPod Emulator |
com.rp.podemu |
PodEmu allows to connect Android device to iPod docking station or car audio. |
Aug 27, 2018 |
https://github.com/xtensa/PodEmu |
| 1374. Podcasts RAC1 - No Oficial |
cat.xojan.random1 |
Escolta i descarrega't els podcasts dels programes de RAC1 |
Aug 4, 2018 |
https://github.com/joan-domingo/Podcasts-RAC1-Android |
| 1375. Podkicker Pro |
com.podkicker |
fast, simple and intuitive podcast manager |
Nov 3, 2017 |
https://github.com/qvga/MorphingTextView |
| 1376. Poet Assistant |
ca.rmen.android.poetassistant |
Dictionary and TTS tools for editing poems |
2018-05-02 |
https://github.com/caarmen/poet-assistant |
| 1377. Points Buraco |
com.marco97pa.puntiburraco |
More than a simple scorekeeper |
Sep 26, 2018 |
https://github.com/marco97pa/punti-burraco |
| 1378. Pola. Zabierz ją na zakupy |
pl.pola_app |
Taking Pola shopping you support the Polish economy. |
Aug 24, 2018 |
https://github.com/KlubJagiellonski/pola-android |
| 1379. Polar Clock |
eu.polarclock |
A polar clock |
2018-03-15 |
https://github.com/beriain/PolarClock |
| 1380. Polipoid |
com.polipoid |
Wrapper for the polipo proxy |
2017-06-13 |
https://github.com/splondike/polipoid |
| 1381. Polite - Automatically Silence Your Phone |
me.camsteffen.polite |
Automatically silence your phone at the right times |
May 23, 2018 |
https://github.com/camsteffen/polite |
| 1382. Polling Station |
com.digitalvotingpass.digitalvotingpass |
Polling Station app to redeem the suffrage on the blockchain. |
Jun 28, 2017 |
https://github.com/digital-voting-pass/digital-voting-pass-app |
| 1383. Pollywog |
org.strawberryforum.pollywog |
Minimal utilities menu for the LeapFrog Epic |
2017-03-15 |
https://github.com/huckleberrypie/pollywog |
| 1384. Ponderizer |
net.danmercer.ponderizer |
An app that helps you ponder and memorize (\ponderize) scriptures. |
May 16, 2017 |
https://github.com/drmercer/Ponderizer |
| 1385. PopCorn |
com.hitanshudhawan.popcorn |
Find and Discover your favourite Movies, TV Shows, Actors and more. |
Jul 18, 2018 |
https://github.com/hitanshu-dhawan/PopCorn |
| 1386. Port Authority |
com.aaronjwood.portauthority |
Port scanner |
2018-03-31 |
https://github.com/aaronjwood/PortAuthority |
| 1387. Port Knocker |
com.xargsgrep.portknocker |
Port Knocker Client |
2017-03-03 |
https://github.com/xargsgrep/PortKnocker |
| 1388. Portal Login Helper for NJU |
tk.mygod.portal.helper.nju |
Login into p.nju.edu.cn automatically with your Android device. |
Apr 8, 2017 |
https://github.com/Mygod/nju-portal-login-android |
| 1389. Portal for Binusmaya |
com.directdev.portal |
A 3rd party app that provides fast and easy on/offline access to Binusmaya |
Sep 22, 2018 |
https://github.com/chrsep/Kingfish |
| 1390. Postcode |
net.tevp.postcode |
Get your postcode (UK only) |
2017-04-13 |
https://github.com/palfrey/postcode |
| 1391. Power Ampache |
com.antoniotari.reactiveampacheapp |
A material design player for Ampache |
2018-03-15 |
https://gitlab.com/antoniotari/reactive-ampache/ |
| 1392. PowerGit - Powerful GitHub Client |
com.duyp.architecture.mvvm |
A powerful GitHub client on Android (sample project, open source), UI by FastHub |
Nov 2, 2017 |
https://github.com/duyp/mvvm-template |
| 1393. Prayer Times (Islamic Tools) |
com.metinkale.prayer |
Useful application with a set of tools needed by any muslim |
2018-01-29 |
https://github.com/metinkale38/namaz-vakti-android |
| 1394. Prey Anti Theft: Find My Phone & Mobile Security |
com.prey |
Android Mobile security solution for tracking & protecting phones & tablets |
Oct 9, 2018 |
https://github.com/eric-stanley/prey-android-client |
| 1395. Primary |
com.quaap.primary |
A simple educational practice game for kids (and adults). |
2017-10-18 |
https://github.com/quaap/Primary |
| 1396. Prince George Transit System Bus - MonTransit |
org.mtransit.android.ca_prince_george_transit_system_bus |
Prince George Transit System buses for MonTransit.\nSchedule. Alerts. News. |
Sep 4, 2018 |
https://github.com/mtransitapps/ca-prince-george-transit-system-bus-android |
| 1397. Prismi |
com.valiantdots.prismi |
Easily Create Color Palettes with HSL & RGB Color Conversion |
Oct 19, 2017 |
https://github.com/KPar/Prismi |
| 1398. Prism |
org.us.andriod |
Demonstrates the basics of ray diagrams |
2017-01-30 |
https://github.com/andviane/prism |
| 1399. Privacy Browser |
com.stoutner.privacybrowser.standard |
A web browser that respects your privacy. |
2018-05-26 |
https://git.stoutner.com/?p=PrivacyBrowser.git;a=summary |
| 1400. Programming - Get the Code |
com.amanmehara.programming.android |
Code Snippets & Algorithms in various Programming Languages |
Oct 28, 2017 |
https://github.com/CCNITSilchar/the-bot-project |
| 1401. Programming Cheat Sheets |
net.egordmitriev.cheatsheets |
Programming Cheat Sheets to boost your productivity. |
Sep 3, 2017 |
https://github.com/EgorDm/CheatSheetsApp |
| 1402. Proj4 |
com.topodroid.proj4 |
proj4 coordinate converter |
Sep 13, 2018 |
https://github.com/marcocorvi/proj4 |
| 1403. ProjectBASS - Bandwidth and Signal Statistics |
org.projectbass.bass |
Improve the state of local internet quality in the Philippines. |
Oct 26, 2017 |
https://github.com/bassph/bassph-app-android |
| 1404. Protect Baby Monitor |
protect.babymonitor |
Baby Monitor |
2018-02-20 |
https://github.com/brarcher/protect-baby-monitor |
| 1405. Proxer.Me - Anime und Manga |
me.proxer.app |
Your anime and manga community! |
Oct 9, 2018 |
https://github.com/proxer/ProxerAndroid |
| 1406. Psalter |
com.jrvermeer.psalter |
The Psalter (of 1912) |
Jul 23, 2018 |
https://github.com/jrvermeer/Psalter |
| 1407. Psycho Test |
bteelse.com.br.amipyscho |
A Psychopath test. |
Jun 6, 2017 |
https://github.com/felipexmitz/PsychoTest |
| 1408. Punchline Bingo |
com.pierreduchemin.punchlinebingo |
A configurable bingo grid |
2017-04-17 |
https://gitlab.com/pierreduchemin/punchline-bingo |
| 1409. Purdue Laundry |
xyz.jhughes.laundry |
Get real-time updates for Purdue's dorm laundry machines right to your phone! |
Apr 5, 2018 |
https://github.com/Purdue-ACM-SIGAPP/PurdueLaundry-android |
| 1410. Push Notification Tester |
com.firstrowria.pushnotificationtester |
This App allows you to test whether Push Notifications are working properly |
May 20, 2018 |
https://github.com/bbindreiter/PushNotificationTester_App |
| 1411. Pushe-Demo |
co.ronash.pushesample |
A demo application to test Pushe.co panel. |
Sep 12, 2017 |
https://github.com/ronashco/pushe-sample |
| 1412. Put.io |
com.stevenschoen.putionew |
The cloud storage service with a certain gravity |
Jun 27, 2018 |
https://github.com/DSteve595/Put.io |
| 1413. PxView |
com.utopia.pxview |
Discover wide variety of anime, manga artworks in your hand |
Jul 30, 2018 |
https://github.com/alphasp/pxview |
| 1414. PySolFC |
org.lufebe16.pysolfc |
A collection of solitaire card games |
2018-04-28 |
https://github.com/shlomif/PySolFC |
| 1415. Pálida Muerte (poemas) |
ca.rmen.android.palidamuerte |
Poemas sobre la muerte, tanto de personas como de mascotas. |
Jul 10, 2017 |
https://github.com/caarmen/PalidaMuerte |
| 1416. Přibližný čas |
cz.corkscreewe.pribliznycas.app |
Approximate time is the most accurate you need. |
Jan 7, 2018 |
https://github.com/PavelVanecek/pribliznycas-android |
| 1417. QCM FFVL |
fr.airnux.qcmffvl |
Official multiple choice test for (French) paragliding and hang gliding pilots |
Sep 27, 2018 |
https://github.com/sativouf/qcmffvl |
| 1418. QField for QGIS - EXPERIMENTAL |
ch.opengis.qfield |
Mobile GIS tool to use QGIS projects in the field and get your work done quickly |
Oct 8, 2018 |
https://github.com/opengisch/QField |
| 1419. QGroundControl |
org.mavlink.qgroundcontrol |
Open Source Micro Air Vehicle Ground Control Station |
Sep 26, 2018 |
https://github.com/ethz-asl/qgc_asl |
| 1420. QKSMS |
com.moez.QKSMS |
Messaging app |
2018-06-02 |
https://github.com/qklabs/qksms |
| 1421. QR Code Reader |
com.qrcodereader |
The fastest and most powerful QR code reader and barcode scanner. |
Feb 2, 2018 |
https://github.com/Gutyn/camera2QRcodeReader |
| 1422. QmidiCtl |
org.rncbc.qmidictl |
A MIDI Remote Controller via UDP/IP Multicast |
Jun 30, 2018 |
https://github.com/rncbc/qmidictl |
| 1423. Qt World Summit 2018 Conference App |
org.ekkescorner.c2g.qtws |
The QtWS app -- Your window to the Qt World Summit 2018 in Boston and Berlin |
Oct 8, 2018 |
https://github.com/ekke/c2gQtWS_x |
| 1424. Quasseldroid |
com.iskrembilen.quasseldroid |
Client for Quassel IRC |
2017-02-06 |
https://github.com/sandsmark/QuasselDroid |
| 1425. Quebec City RTC Bus - MonTransit |
org.mtransit.android.ca_quebec_rtc_bus |
Quebec City RTC bus for MonTransit.\nSchedules. News. |
Sep 26, 2018 |
https://github.com/mtransitapps/ca-quebec-rtc-bus-android |
| 1426. Quelea Mobile Remote |
org.quelea.mobileremote |
Remote control app for the projection software Quelea |
Oct 4, 2018 |
https://github.com/QueleaMobile/quelea-mobile-remote |
| 1427. Quick Draw Everywhere |
com.tomer.draw |
Draw and take notes everywhere on your device |
2017-09-27 |
https://github.com/rosenpin/QuickDrawEverywhere |
| 1428. Quick Remind - Reminder App |
com.orangemuffin.quickremind |
Never forget your important tasks! |
Jul 27, 2017 |
https://github.com/stevetcm/quickremind |
| 1429. Quick3D |
org.theiner.quick3d |
A simple photo app for taking and saving 3D photographs |
Feb 19, 2017 |
https://github.com/devnull69/quick3d |
| 1430. QuickBeer – Beer Reviews |
quickbeer.android |
QuickBeer is a beautiful and sleek app for finding beer details and reviews. |
Nov 30, 2017 |
https://github.com/apoi/quickbeer-android |
| 1431. QuickDic |
de.reimardoeffinger.quickdic |
Offline translation dictionary |
2018-04-20 |
https://github.com/rdoeffinger/Dictionary |
| 1432. QuickLyric Romanisation Plugin |
com.quicklyric.romanizer |
Provides romanisation capabilities for QuickLyric 3.0 and up |
Jul 28, 2017 |
https://github.com/QuickLyric/Romanizer |
| 1433. QuickLyric |
com.geecko.QuickLyric |
Fetch and display song lyrics |
2017-04-08 |
https://github.com/geecko86/QuickLyric |
| 1434. Quit Smoking |
de.baumann.quitsmoking |
Application to help smokers to quit smoking |
2017-06-17 |
https://github.com/scoute-dich/QuitSmoking |
| 1435. QuizUp |
com.quizup.core |
The biggest trivia game in the world! |
Oct 17, 2018 |
https://github.com/mmmsplay10/QuizUpWinner |
| 1436. Quran For My Android |
com.frrahat.quransimple |
Shows Quran text or word by word translation |
2018-02-16 |
https://github.com/frrahat/Quran-For-My-Android |
| 1437. Qz |
com.vonglasow.michael.qz |
Receive live traffic news via Traffic Message Channel (TMC) |
2018-05-06 |
https://gitlab.com/mvglasow/qz |
| 1438. R/a/dio |
io.r_a_d.radio |
The official r/a/dio Android app! |
Apr 17, 2018 |
https://github.com/R-a-dio/R-a-dio-Amazing-Android-App |
| 1439. RADIO SOL PODER DE DIOS |
com.commandocoder.test.streaming |
Radio evangelist who carries the message of salvation to all people from Bolivia |
May 21, 2018 |
https://github.com/CommandoCoder/StreamingService |
| 1440. RGB/HEX Converter |
com.stenofh.rgbhexconverter |
Conversor de cores RGB/HEX criado para auxiliar desenvolvedores Front-End. |
Apr 30, 2017 |
https://github.com/lfnasc/rgb2hexconverter |
| 1441. RISE Weather |
sse.in.weather |
Demo App from the RISE Workshop about Mobile Technologies at the SSE Puttaparthi |
Feb 2, 2017 |
https://github.com/spipau/workshop-on-mobile-technologies |
| 1442. RKFRead |
se.norenh.rkfread |
Transport card reader |
2017-08-07 |
https://github.com/norenh/RKFRead |
| 1443. ROM Patcher |
com.xperia64.rompatcher |
Apply (nearly) any patch |
Jul 7, 2017 |
https://github.com/xperia64/android-rom-patcher |
| 1444. ROS Bag |
org.lamerman.rosandroidbag |
Bag package for Robot Operating System |
May 16, 2017 |
https://github.com/lamerman/ros_android_bag |
| 1445. RPG NPC Generator |
me.kerooker.rpgcharactergenerator |
Generate completely random NPC personalities to use in your TableTop Rpg Games!! |
May 30, 2017 |
https://github.com/Kerooker/rpg-npc-generator |
| 1446. RPN |
org.scoutant.rpn |
Very easy to use RPN Calculator |
2017-07-07 |
https://github.com/scoutant/rpn |
| 1447. RPi Camera Viewer |
ca.frozen.rpicameraviewer |
Plays a raw H.264 video stream from a Raspberry Pi camera. |
Sep 30, 2017 |
https://github.com/ShawnBaker/RPiCameraViewer |
| 1448. RWifi Controller |
labsi.roowificontroller |
RWifi Controller is an android application to control your RooWifi card. |
Nov 29, 2017 |
https://github.com/LAB-SI/RooWifi-Controller |
| 1449. Rabbit Escape |
net.artificialworlds.rabbitescape |
Lemmings-like puzzle/action game |
2017-01-30 |
https://github.com/andybalaam/rabbit-escape |
| 1450. RadioDroid |
net.programmierecke.radiodroid2 |
Browse and stream internet radios |
2018-05-28 |
https://github.com/segler-alex/RadioDroid |
| 1451. RadioRec+ |
com.rothconsulting.android.radiorec |
Worldwide mobile local Radios. Listen an record as mp3. All in one free app. |
Aug 16, 2018 |
https://github.com/konir/RadioRecPlus |
| 1452. Raffler - Text and Win Free Prizes |
com.raffler.app |
Win free prizes by texting on Raffler! The more you text, the more you win. |
Jun 12, 2018 |
https://github.com/AppHero2/Raffler-Android |
| 1453. RainTime |
nl.implode.regenalarm |
Two hour rain forecast in The Netherlands |
2017-07-18 |
https://github.com/sanderbaas/rainalarm-android |
| 1454. Rando 4Me |
com.github.randoapp |
Rando 4Me - easily exchange photos with strangers all over the world |
Jul 16, 2018 |
https://github.com/RandoApp/Rando-android |
| 1455. Random Contact |
com.ae.apps.randomcontact |
\What we have here is a failure to communicate.Communicate with a Random friend |
Jul 6, 2018 |
https://github.com/midhunhk/random-contact |
| 1456. Random Emoji Keyboard |
com.maxtimkovich.randomemojikeyboard |
The best way to communicate |
Sep 1, 2017 |
https://github.com/mtimkovich/RandomEmojiKeyboard |
| 1457. RapidPro Surveyor |
io.rapidpro.surveyor |
Run RapidPro flows offline. |
Sep 24, 2018 |
https://github.com/rapidpro/surveyor |
| 1458. Raspberry Jam Mod |
mobi.omegacentauri.rjm |
Mod for Minecraft PE to implement most of the Raspberry PI Minecraft API |
Mar 16, 2017 |
https://github.com/arpruss/raspberryjam-pe |
| 1459. ReLaunchX |
com.gacode.relaunchx |
Launcher for eInk/eBook devices |
2018-03-26 |
https://github.com/Leszek111/ReLaunchX |
| 1460. React Native Starter App |
com.reactnativestarterapp |
It is the cross platform starter App built on React Native |
Jun 7, 2017 |
https://github.com/CodeRowerSoftware/react-native-starter-app |
| 1461. ReactNative BG Geolocation |
com.transistorsoft.backgroundgeolocation.react |
Demo app for React Native Background Geolocation module. |
May 25, 2018 |
https://github.com/transistorsoft/rn-background-geolocation-demo |
| 1462. Read4SpeechExperiments |
com.prhlt.aemus.Read4SpeechExperiments |
Read for Automatic Speech Recognition Experiments |
2017-12-04 |
https://gitlab.com/egranell/Read4SpeechExperiments/tree/HEAD |
| 1463. Reader for Pepper&Carrot |
nightlock.peppercarrot |
A multi-language reader for CC-BY licensed Pepper & Carrot Webcomic |
2018-05-22 |
https://framagit.org/peppercarrot/e-reader |
| 1464. Readify - RSS News feeder |
ahmaabdo.readify.rss |
Free app keeps you inform by fetching your favorites websites/blogs news. |
Jan 17, 2018 |
https://github.com/ahmaabdo/ReadifyRSS |
| 1465. Real AI |
com.oblivionburn.nlp |
Natural Language Processor - The Real AI |
Aug 29, 2018 |
https://github.com/Oblivionburn/realai |
| 1466. Reality Retreat |
org.godivinity.realityretreat |
An app that aids your daily meditation routine using 6-3-2 technique |
Jul 7, 2017 |
https://github.com/godivinity/RealityRetreatAndroid |
| 1467. Realtime Bitcoin Calculator |
com.kfpun.bitcoin |
Realtime Bitcoin Calculator\n\nEasily, realtime, auto-refresh with any currencies. |
Jan 20, 2017 |
https://github.com/7kfpun/BitcoinReactNative |
| 1468. Reckoning Skills |
org.secuso.privacyfriendlyrecknoningskills |
Helps you improving your mental calculation skills |
2018-06-02 |
https://github.com/SecUSo/privacy-friendly-reckoning-skills |
| 1469. Rectball – Puzzle Bubble Game 🔵 |
es.danirod.rectball.android |
Make combinations and earn points on this interactive puzzle bubble game! |
Sep 3, 2017 |
https://github.com/danirod/rectball |
| 1470. Red Deer Transit Bus - MonTransit |
org.mtransit.android.ca_red_deer_transit_bus |
Red Deer Transit Bus for MonTransit.\nSchedule… |
Aug 20, 2018 |
https://github.com/mtransitapps/ca-red-deer-transit-bus-android |
| 1471. Red Moon |
com.jmstudios.redmoon |
Screen filter for night time phone use |
2017-10-11 |
https://github.com/raatmarien/red-moon |
| 1472. RedReader |
org.quantumbadger.redreader |
Client for reddit.com |
2018-04-28 |
https://github.com/QuantumBadger/RedReader |
| 1473. Reddinator |
au.com.wallaceit.reddinator |
Reddit Widget |
2018-02-16 |
https://github.com/micwallace/reddinator |
| 1474. Redface - client HFR |
com.ayuget.redface |
Customer to view the HFR forum |
Dec 14, 2017 |
https://github.com/Ayuget/Redface |
| 1475. Reedy. Intelligent reader |
azagroup.reedy |
Read books, articles, any web pages comfortably\n★ Speed reading, Text-to-Speech! |
Aug 17, 2017 |
https://github.com/ReedyReader/Reedy-Android-Translations |
| 1476. Reef Angel Status |
info.curtbinder.reefangel.phone |
Reef Angel |
Mar 4, 2018 |
https://github.com/curtbinder/AndroidStatus |
| 1477. Regina Transit Bus - MonTransit |
org.mtransit.android.ca_regina_transit_bus |
Regina Transit buses for MonTransit.\nSchedule. Real-Time. News. |
Sep 26, 2018 |
https://github.com/mtransitapps/ca-regina-transit-bus-android |
| 1478. Remember Names |
me.anky.connectid |
This app helps you put a name to a face and boost your social skills. |
May 13, 2018 |
https://github.com/anky21/Remember-Names |
| 1479. ReminderMail |
nl.jqno.remindermail |
Quickly mail reminders to yourself! |
Feb 12, 2017 |
https://github.com/jqno/remindermail |
| 1480. Remindy - Get tasks done |
ve.com.abicelis.remindy |
Organize your life by setting tasks and using smart reminders! |
Sep 19, 2018 |
https://github.com/abicelis/Remindy |
| 1481. Remixed Dungeon |
com.nyrds.pixeldungeon.ml |
This is an open source rogue-like game with pixel style graphics |
Sep 13, 2018 |
https://github.com/NYRDS/pixel-dungeon-remix |
| 1482. Remote Control PC |
me.varunon9.remotecontrolpc |
Control Laptop using Android (Live computer screen supported) |
Sep 28, 2017 |
https://github.com/varunon9/Remote-Control-PC |
| 1483. Rental Calc |
protect.rentalcalc |
Evaluate rental property investment prospects |
2017-09-18 |
https://github.com/brarcher/rental-calc |
| 1484. ReoTwé |
de.digisocken.reotwe |
minimalistic microblogging client for twitter |
2018-04-27 |
https://github.com/no-go/ReoTwe |
| 1485. RepWifi |
fil.libre.repwifiapp |
Connect to Wi-Fi using an external USB adapter |
2018-02-16 |
https://git.replicant.us/contrib/Fil/RepWifiApp |
| 1486. Retribution Launcher |
com.nbehary.retribution |
Replacement App Launcher. |
Jul 12, 2018 |
https://github.com/nbehary/Retribution |
| 1487. Retro Breaker |
br.usp.ime.retrobreaker |
A brick breaker game with a retro style |
Sep 9, 2018 |
https://github.com/m45t3r/retrobreaker |
| 1488. Retro Text Editor |
click.dummer.textthing |
Edit text files |
2017-11-03 |
https://github.com/no-go/TextThing |
| 1489. RetroArch |
com.retroarch |
Retro games and emulators on your phone! |
Oct 1, 2018 |
https://github.com/palfrey/RetroArch |
| 1490. RetroShare |
org.retroshare.android.qml_app |
RetroShare Android Chat Prototype |
2018-04-05 |
https://github.com/RetroShare/RetroShare |
| 1491. Retroboy |
se.embargo.retroboy |
Retroboy provides vintage imaging technology |
2017-06-17 |
https://github.com/mikljohansson/retroboy |
| 1492. Revolumote |
com.obooklage.revolumote |
Encore une télécommande pour freebox revolution ! |
Dec 31, 2017 |
https://github.com/obook/revolumote |
| 1493. Revolution IRC |
io.mrarm.irc |
The next-generation IRC client |
2017-12-24 |
https://github.com/MCMrARM/revolution-irc |
| 1494. Rick App |
click.dummer.rickapp |
play automatic burp in silent situations |
2017-01-29 |
https://github.com/no-go/RickApp |
| 1495. RingCentral Phone |
com.ringcentral.android |
RingCentral Phone — take your business calls, voice messages, and faxes—anywhere |
Aug 26, 2018 |
https://github.com/vyshakhbabji/ringcentral-android |
| 1496. Ringdroid |
com.ringdroid |
Ringtone editor |
2017-06-23 |
https://github.com/google/ringdroid/ |
| 1497. Ring |
cx.ring |
Secure and distributed communication platform |
2018-05-06 |
|
| 1498. Riot.im |
im.vector.alpha |
Open team collaboration |
2018-05-26 |
https://github.com/vector-im/riot-android |
| 1499. Ripple |
info.guardianproject.ripple |
Trigger apps to protect your privacy when in anxious or panic situations |
2017-12-07 |
https://github.com/guardianproject/ripple |
| 1500. RoMote |
wseemann.media.romote |
Roku remote |
2018-04-16 |
https://github.com/wseemann/RoMote |
| 1501. Roaming Info |
com.brapeba.roaminginfo |
Shows the logo of your current mobile carrier in the status bar. |
Apr 29, 2018 |
https://github.com/jbardera/RoamingInfo |
| 1502. RoboPad |
com.bq.robotic.robopad |
RoboPad lets you control your robot with a mobile phone or tablet! |
Jul 7, 2017 |
https://github.com/bq/robopad |
| 1503. Rocket Guardian |
atm.rocketguardian |
Do your duty and destroy the zombies |
2017-03-17 |
https://gitlab.com/atorresm/rocket-guardian/tree/HEAD |
| 1504. Root Validator |
eu.thedarken.rootvalidator |
Do you have root? |
Apr 12, 2018 |
https://github.com/miumok98/rootvalidator |
| 1505. Rounded Screen |
com.jidogoon.roundedscreen |
Make screen rounded like Galaxy S8, LG G6 |
May 28, 2017 |
https://github.com/jidogoon/RoundedScreen |
| 1506. Router Keygen YoloSec |
net.yolosec.routerkeygen2 |
Generate default WPA/WEP keys |
2018-05-12 |
https://github.com/yolosec/routerkeygenAndroid |
| 1507. Rtl-sdr driver |
marto.rtl_tcp_andro |
Port of rtl-sdr's rtl_tcp |
2017-09-13 |
https://github.com/martinmarinov/rtl_tcp_andro- |
| 1508. Ruine |
com.soleilgames |
Vous avez trouvé l'entrée, arriverez-vous à trouver la sortie ? |
Oct 31, 2017 |
https://github.com/soleilgames/ruine |
| 1509. Ruk-A-Tuk |
com.rukatuk.app |
The official app for Ruk-A-Tuk Promotions |
Jun 11, 2018 |
https://github.com/akilb/rukatuk-mobile |
| 1510. RunnerUp |
org.runnerup |
RunnerUp - an open source run tracker. Lots of features, no ads & 100% free! |
Aug 6, 2017 |
https://github.com/callesol/runnerup |
| 1511. Rutgers University |
edu.rutgers.css.Rutgers |
Access the University on the go: check campus bus times, dining hall menus, etc. |
Sep 10, 2018 |
https://github.com/rutgersmobile/android-client |
| 1512. S1 Next Goose |
me.ykrank.s1next |
STAGE1 mobile client. S1Next subsequent upgrades. |
Oct 9, 2018 |
https://github.com/ykrank/S1-Next |
| 1513. SASAbus |
it.sasabz.android.sasabus |
SASAbus is the official app of SASA providing the bus schedules in realtime. |
Sep 12, 2017 |
https://github.com/paolodongilli/SASAbus |
| 1514. SD Scanner |
com.gmail.jerickson314.sdscanner |
Rescan storage media |
2017-08-30 |
https://github.com/jerickson314/sdscanner |
| 1515. SELinuxModeChanger |
com.mrbimc.selinux |
Set SELinux mode on boot |
2017-11-03 |
https://github.com/MrBIMC/SELinuxModeChanger |
| 1516. SEPTA |
org.septa.android.app |
The SEPTA Android app. |
Aug 27, 2018 |
https://github.com/septadev/SEPTA-Android |
| 1517. SIP Switch |
eu.siebeck.sipswitch |
Access Internet call settings |
2017-02-26 |
https://github.com/robert7k/sipswitch |
| 1518. SMS Backup+ |
com.zegoggles.smssync |
Backup SMS, MMS and call history to IMAP |
2018-04-24 |
https://github.com/jberkel/sms-backup-plus |
| 1519. SMS Ping |
com.itds.sms.ping |
Send silent SMS |
2018-04-10 |
https://github.com/itds-consulting/android-silent-ping-sms |
| 1520. SMS Relay |
com.advarisk.smsrelay |
SMS Relay forwards incoming SMS to a HTTP server. |
Jan 30, 2017 |
https://github.com/advarisk/smsrelay |
| 1521. SMS Scheduler |
com.github.yeriomin.smsscheduler |
Lets you schedule an sms to be sent at a specific time |
2017-08-09 |
https://github.com/yeriomin/SmsScheduler |
| 1522. SMSSync SMS Gateway |
org.addhen.smssync |
SMSSync allows you to turn your Android powered phone into an SMS gateway. |
Feb 20, 2017 |
https://github.com/medic/SMSSync |
| 1523. SMSdroid |
de.ub0r.android.smsdroid |
SMSdroid let's you read text messages. |
Jul 1, 2018 |
https://github.com/cybtron/smsdroid |
| 1524. SMXL |
com.aerolitec.SMXL |
The very first app able to estimate your exact size among your favorite makes ! |
Mar 3, 2018 |
https://github.com/clvacher/SMXL |
| 1525. SNISI |
com.yeleman.snisidroid |
Système Numérique d'Information Sanitaire Intégré |
Oct 12, 2017 |
https://github.com/yeleman/SNISI-droid |
| 1526. SNotepad |
info.aario.snotepad |
Take notes |
2017-04-04 |
https://github.com/aario/snotepad |
| 1527. SSH Remote Executer |
org.pxpert.remoteexecuter |
Connect to a Server, login and execute specific commands in a click! |
Jan 20, 2017 |
https://github.com/PxPert/RemoteExecuter |
| 1528. SSTV Encoder |
om.sstvencoder |
This app sends images via Slow Scan Television (SSTV). |
Jul 16, 2018 |
https://github.com/olgamiller/SSTVEncoder2 |
| 1529. STHLM Traveling - SL Planner |
com.markupartist.sthlmtraveling |
Real-time trip planner for SL, Stockholm – Walk, Bike, Bus, Metro, Train & Tram |
Feb 26, 2018 |
https://github.com/victorhaggqvist/sthlmtraveling |
| 1530. SUPLA |
org.supla.android |
Internet of things in your home! |
Sep 20, 2018 |
https://github.com/game-libgdx-unity/Gradle-Supla |
| 1531. SWADroid |
es.ugr.swad.swadroid |
SWADroid is an application to access SWAD (http://openswad.org). |
Feb 25, 2018 |
https://github.com/Amab/SWADroid |
| 1532. SWAN |
interdroid.swan |
SWAN is a framework for building context-aware apps. |
Mar 25, 2018 |
https://github.com/interdroid/interdroid-swan |
| 1533. Salaat Time |
com.alimuzaffar.ramadanalarm |
Salaat times, alarms and in ramadan suhoor and Iftar alarm. |
Feb 3, 2017 |
https://github.com/alphamu/PrayTime-Android |
| 1534. Samba Test App |
com.angiellorivas.androidsambatestapp |
This is a test application to learn how you can use smb within android |
Oct 25, 2017 |
https://github.com/sk8darr/AndroidSambaTestApp |
| 1535. Saskatoon Transit Bus - MonTransit |
org.mtransit.android.ca_saskatoon_transit_bus |
Saskatoon Transit buses for MonTransit.\nSchedule. News. Service Alerts. |
Oct 14, 2018 |
https://github.com/mtransitapps/ca-saskatoon-transit-bus-android |
| 1536. SatStat |
com.vonglasow.michael.satstat |
GPS, sensor and network status |
2018-03-31 |
https://github.com/mvglasow/satstat |
| 1537. Save the bunny! |
es.seastorm.merlin |
Save Merlin the bunny! Will you reach your burrow without being caught? |
Mar 5, 2017 |
https://github.com/pabloalba/SaveTheBunny |
| 1538. Save to Nextcloud Bookmarks |
com.tttdevs.stncbookmarks |
Save bookmarks on a NextCloud server |
2017-04-23 |
https://github.com/TTTDevs/NextCloudBookmarksAndroid |
| 1539. Say It - Pronunciation Tool |
com.cesarsk.say_it |
SAY IT! - SOUND LIKE A NATIVE! PRACTICING YOUR ENGLISH HAS NEVER BEEN EASIER! |
Jan 14, 2018 |
https://github.com/Cesarsk/Say_it |
| 1540. Scoot Media Streamer |
com.scooter1556.sms.android |
The official client for Scoot Media Streamer. |
Jan 27, 2018 |
https://github.com/scoot-software/sms-android |
| 1541. Score It - Score Keeper |
com.sbgapps.scoreit |
Simple and beautiful score keeper. |
Oct 2, 2018 |
https://github.com/miguelespinoza/ScoreItProject |
| 1542. Scorekeeper |
com.amandafarrell.www.scorekeeper |
Simple design. No ads. |
Aug 14, 2017 |
https://github.com/bluepandadev/Scorekeeper |
| 1543. Scrambled Exif |
com.jarsilio.android.scrambledeggsif |
Remove metadata from your pics before sharing them |
2018-04-10 |
https://gitlab.com/juanitobananas/scrambled-exif/tree/HEAD |
| 1544. Screen Off |
com.nego.screenoff |
Simple & Minimalistic App to turn off the Screen |
Mar 20, 2018 |
https://github.com/tommasoberlose/screen-off |
| 1545. Screen Off |
gr.ictpro.jsalatas.screenoff |
Turn off and lock the screen without violating the PIN unlock security policy. |
Sep 19, 2018 |
https://github.com/jsalatas/ScreenOff |
| 1546. Screen Shift |
com.sagar.screenshift2 |
Change screen resolution, density and overscan |
2017-01-17 |
https://github.com/aravindsagar/ScreenShift |
| 1547. Screen Stream |
info.dvkr.screenstream |
Screen streaming over HTTP |
2018-02-16 |
https://github.com/dkrivoruchko/ScreenStream |
| 1548. ScreenCam |
com.orpheusdroid.screenrecorder |
lightweight and functional screen recorder |
2018-05-06 |
https://github.com/vijai1996/screenrecorder |
| 1549. Screenshot sharer |
com.tomer.screenshotsharer |
Share screenshots quickly |
2017-10-01 |
https://github.com/rosenpin/Screenshot-Sharer |
| 1550. Screens |
uk.co.keepawayfromfire.screens |
Multi Window Manager |
2017-02-02 |
https://github.com/Cj-Malone/Screens |
| 1551. Scroball for Last.fm |
com.peterjosling.scroball |
Universal Last.fm scrobbler. Tracks plays from Google Play, Apple Music and more |
Oct 1, 2018 |
https://github.com/peterjosling/scroball |
| 1552. Scrum Chatter |
ca.rmen.android.scrumchatter |
Time members while they speak at meetings |
2018-03-19 |
https://github.com/caarmen/scrumchatter |
| 1553. ScummVM |
org.scummvm.scummvm |
Runs many old point-and-click adventure games (games not included). |
Jan 2, 2018 |
https://github.com/blorente/scummvm |
| 1554. SeaMapDroid |
org.seamapdroid |
Browse OpenSeaMap on your phone |
2018-05-31 |
https://github.com/marcoM32/SeaMapDroid |
| 1555. Seafile |
com.seafile.seadroid2 |
File synchronization |
2018-04-14 |
https://github.com/haiwen/seadroid |
| 1556. Seafood Berserker! |
com.quaap.fishberserker |
Seafood Berserker |
2017-11-05 |
https://github.com/quaap/SeafoodBerserker |
| 1557. SealNote |
com.twistedplane.sealnote |
Simple, safe and easy to use notepad |
2017-03-15 |
https://github.com/vishesh/sealnote |
| 1558. Search Based Launcher |
com.vackosar.searchbasedlauncher |
Minimalistic home-screen |
2017-01-02 |
https://github.com/vackosar/search-based-launcher/ |
| 1559. Search for Reddit |
chaitanya.im.searchforreddit |
Share a link & find Reddit threads about it while never leaving your current app |
Jul 23, 2017 |
https://github.com/chaitanyanettem/SearchforReddit |
| 1560. Search'em All |
camelcase.searchemall |
Open source Meta search app. |
May 16, 2017 |
https://github.com/CamelCase11/Search-em-All |
| 1561. Searchable RecyclerView Demo |
com.github.wrdlbrnft.searchablerecyclerviewdemo |
This is an open-source app to demonstrate a searchable RecyclerView. |
Jan 14, 2018 |
https://github.com/Wrdlbrnft/Searchable-RecyclerView-Demo |
| 1562. SecScanQR |
de.t_dankworth.secscanqr |
The QR code scanner/generator that cares about your privacy |
2018-05-28 |
https://github.com/Fr4gorSoftware/SecScanQR |
| 1563. Seccy |
eleriaqueen.seccy |
Section ID Calculator for Phantasy Star Online games |
Oct 12, 2018 |
https://github.com/eleriaqueen/Seccy |
| 1564. SecondScreen |
com.farmerbb.secondscreen.free |
Better screen mirroring |
2018-05-28 |
https://github.com/farmerbb/SecondScreen |
| 1565. Secure photo viewer |
com.gtp.showapicturetoyourfriend |
A media-viewer that functions ontop of your lockscreen |
2018-05-07 |
https://github.com/Somethingweirdhere/Secure-Photo-Viewer |
| 1566. Seguime |
pc.javier.seguime |
Follow where your device goes without being followed by you |
2018-05-12 |
https://gitlab.com/javipc/seguime |
| 1567. Seizure Speed |
com.dylanburati.seizurespeed |
Tap as many times as you can in 10 seconds. |
Oct 2, 2017 |
https://github.com/dylanburati/seizurespeed-android |
| 1568. Selfie Camera HD [ Professional & High Quality ] |
com.tafayor.selfcamerashot |
Professional camera which takes excellent quality pictures and videos |
Sep 16, 2018 |
https://github.com/joseliko7/Snapmatic-Life |
| 1569. Selfie Camera HD |
com.pov.hd.selfiecamera |
Add Stickers while take photo.\nCute, Funny Sticker Collections. |
Sep 21, 2018 |
https://github.com/pov1912/Selfie-Camera |
| 1570. Send Reduced Free |
mobi.omegacentauri.SendReduced |
Send reduced resolution photos by email with minimum number of taps. |
Jan 11, 2017 |
https://github.com/lazyjarvis/sendreduced |
| 1571. Senreta Vortaro |
org.mcxa.vortaro |
Simple, offline English-Esperanto dictionary |
2017-09-06 |
https://github.com/ianmcxa/vortaro |
| 1572. Sensor Visualization |
com.michaeltroger.sensorvisualization |
Shows all of the phone's sensors in real time in form of a graph. |
Sep 22, 2017 |
https://github.com/michaeltroger/sensor-visualization |
| 1573. Sensors2OSC |
org.sensors2.osc |
Send sensor data via Open Sound Control (OSC). |
2018-03-19 |
https://github.com/SensorApps/Sensors2OSC |
| 1574. Sensors2Pd |
org.sensors2.pd |
Use sensor data in Puredata patches |
2017-03-08 |
https://github.com/SensorApps/Sensors2Pd |
| 1575. Sensors |
com.calintat.sensors |
Sensor dashboard and logger for Android |
Aug 15, 2017 |
https://github.com/calintat/sensors |
| 1576. Sensus |
edu.virginia.sie.ptl.sensus |
A Cross-Platform System for Mobile Sensing |
Oct 11, 2018 |
https://github.com/jtb8vm/sensus |
| 1577. Sentinel |
com.samourai.sentinel |
Watch Only Bitcoin Wallet. Track your cold storage & hardware wallet |
Sep 29, 2018 |
https://github.com/Samourai-Wallet/sentinel-android |
| 1578. Sequence Hunt |
com.monead.games.android.sequence |
A challenging game that requires logic to determine a sequence of colors. |
Aug 3, 2018 |
https://github.com/DaveRead/SequenceHunt |
| 1579. Serval Mesh |
org.servalproject |
Peer to peer communications |
2017-06-03 |
https://github.com/servalproject/batphone |
| 1580. Sesame |
net.af0.sesame |
A simple, secure, encrypted password manager. |
Aug 21, 2017 |
https://github.com/danmarg/sesame |
| 1581. SexyTopo |
org.hwyl.sexytopo |
Assist in cave surveying |
2017-07-09 |
https://github.com/richsmith/sexytopo |
| 1582. Señales Del Fin |
com.senalesdelfinrna |
This app is in spanish. Una aplicación de noticias, estudios y lectura bíblica. |
Jan 14, 2017 |
https://github.com/fakerabbit/SenalesDelFinRNA |
| 1583. Shaarlier |
com.dimtion.shaarlier |
Share links on Shaarli |
2017-07-14 |
https://github.com/dimtion/Shaarlier |
| 1584. Shader Editor |
de.markusfisch.android.shadereditor |
Create and edit GLSL shaders |
2018-05-06 |
https://github.com/markusfisch/ShaderEditor |
| 1585. Share Location Plugin |
eu.siacs.conversations.sharelocation |
A plugin that adds location sharing capabilities to Conversations |
Nov 29, 2017 |
https://github.com/siacs/ShareLocationPlugin |
| 1586. Share To Clipboard |
com.github.singleunderscore.sharetoclipboard |
Copy text/link when shared |
Apr 24, 2017 |
https://github.com/qxu/ShareToClipboard |
| 1587. Share to Clipboard |
com.tengu.sharetoclipboard |
A way to copy to clipboard straight from the share menu! |
2018-03-15 |
https://github.com/tengusw/share_to_clipboard |
| 1588. Share via HTTP |
com.MarcosDiez.shareviahttp |
File sharing tool |
2017-08-22 |
https://github.com/marcosdiez/shareviahttp |
| 1589. Shattered Pixel Dungeon |
com.shatteredpixel.shatteredpixeldungeon |
Play a rogue-like game |
2018-05-22 |
https://github.com/00-Evan/shattered-pixel-dungeon |
| 1590. Shawinigan RTCS Bus - MonTransit |
org.mtransit.android.ca_shawinigan_rtcs_bus |
Shawinigan RTCS Bus for MonTransit.\nSchedule… |
Sep 11, 2018 |
https://github.com/mtransitapps/ca-shawinigan-rtcs-bus-android |
| 1591. Sheeps Go Home! |
com.tumblr.svetylk0.sheepsgohome.android |
Lead the sheep back home, collect all badges and become the Sheep Master! |
Sep 23, 2017 |
https://github.com/LittleLightCz/SheepsGoHome |
| 1592. ShellMS |
com.android.shellms |
Send SMS via Android SDK |
2018-05-28 |
https://github.com/try2codesecure/ShellMS |
| 1593. ShellsMP |
org.jsl.shmp |
Play shells game with your friends |
2017-03-08 |
https://github.com/js-labs/ShellsMP |
| 1594. Sherbrooke STS Bus - MonTransit |
org.mtransit.android.ca_sherbrooke_sts_bus |
Sherbrooke STS buses for MonTransit.\nSchedule. News. |
Aug 20, 2018 |
https://github.com/mtransitapps/ca-sherbrooke-sts-bus-android |
| 1595. Ship Captain and Crew |
com.alaskalinuxuser.shipcaptainandcrew |
Play a classic dice game for up to 4 players |
2017-05-23 |
https://github.com/alaskalinuxuser/app_ship_capt_crew |
| 1596. Ships - Receive AIS data from air |
net.videgro.ships |
Plots AIS ship information received from DVB-T-DAB-FM / RTL-SDR receiver. |
Sep 30, 2018 |
https://github.com/videgro/Ships |
| 1597. Shopping List |
com.woefe.shoppinglist |
Manage (grocery) lists |
2018-06-02 |
https://github.com/woefe/ShoppingList |
| 1598. Shopping List |
privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist |
Create and manage shopping lists |
2017-07-01 |
https://github.com/SecUSo/privacy-friendly-shopping-list |
| 1599. Shortyz |
com.totsp.crossword.shortyz |
Crossword game |
2018-02-16 |
https://github.com/kebernet/shortyz |
| 1600. Shorty |
org.billthefarmer.shorty |
Shortcuts for Intent Radio |
2017-09-24 |
https://github.com/billthefarmer/shorty |
| 1601. Should I Wear A Coat? |
coatapp.coat |
Tells you whether the weather is coat-weather. |
Sep 22, 2018 |
https://github.com/xlpnic/coat |
| 1602. Show Mem |
community.fairphone.fplauncher3 |
Fairphone Lancher 3 originally developed for Fairphone 2 |
2018-05-07 |
https://github.com/WeAreFairphone/android_packages_apps_FairphoneLauncher3 |
| 1603. ShowsRage |
com.mgaetan89.showsrage |
Your Shows. Everywhere. |
Jul 9, 2018 |
https://github.com/MGaetan89/ShowsRage |
| 1604. ShutUp! - Stay Lazy |
com.laughingstock.ritwick.shutup |
I help you be lazy.\nNow, rate me. |
Aug 3, 2017 |
https://github.com/RitwickVerma/ShutUp |
| 1605. SicMu Player |
souch.smp |
Tree view based music player |
2018-06-02 |
https://github.com/souch/SMP |
| 1606. Sieben |
de.baumann.sieben |
Helps to organize and perform workouts |
2017-05-10 |
https://github.com/scoute-dich/Sieben |
| 1607. SigLocate |
org.faudroids.foodcube |
Der einfachste Weg seinen Standort in der Cafete / Mensa der TechFak zu teilen! |
May 15, 2018 |
https://github.com/FauDroids/SigLocate |
| 1608. Signal Generator |
org.billthefarmer.siggen |
Signal Generator for tablets |
2018-02-20 |
https://github.com/billthefarmer/sig-gen |
| 1609. Signal Private Messenger |
org.thoughtcrime.securesms |
Signal makes privacy simple. Send text, photos, and group messages for free! |
Sep 25, 2018 |
https://github.com/ndtom/Signull |
| 1610. Signature Spoofing Checker |
lanchon.sigspoof.checker |
Test the signature spoofing capability of your OS |
2018-04-10 |
https://github.com/Lanchon/sigspoof-checker |
| 1611. Silence |
org.smssecure.smssecure |
Encrypted SMS/MMS conversations made easy! |
2018-03-26 |
https://github.com/SilenceIM/Silence |
| 1612. SilicaGel |
me.siketyan.silicagel |
Tweets your listening music from notifications of music player apps. |
Jun 30, 2018 |
https://github.com/Siketyan/SilicaGel-for-CloudPlayer |
| 1613. SilverScreener |
bapspatil.silverscreener |
See the details of the most popular & highest-rated movies on your phone! |
Dec 26, 2017 |
https://github.com/bapspatil/SilverScreener |
| 1614. Silverfish Launcher |
com.launcher.silverfish |
A launcher with focus on a simple UI |
2017-07-19 |
https://github.com/stanipintjuk/Silverfish |
| 1615. Simlar - free and secure calls |
org.simlar |
Protect your privacy and make free mobile phone calls over the internet. |
Jul 15, 2018 |
https://github.com/simlar/simlar-android |
| 1616. Simone - Simon Says Game |
app.simone |
Have you ever played Simon Says? The classic memory game has become digital. |
Jan 23, 2018 |
https://github.com/nicorsm/S3-16-simone |
| 1617. Simple ADB - Debug Over WiFi |
xyz.garywzh.simpleadb |
Debug your app over WiFi, leave the USB cable away.\nneeds ROOT |
Feb 16, 2017 |
https://github.com/garywzh/SimpleADB |
| 1618. Simple Accounting |
com.emmanuelmess.simpleaccounting |
Manage your money easily |
2018-06-02 |
https://github.com/EmmanuelMess/Simple-Accounting |
| 1619. Simple Bitcoin Cash Widget |
com.brentpanther.bitcoincashwidget |
Show current bitcoin Cash exchange prices |
2018-01-15 |
https://github.com/hwki/SimpleBitcoinWidget |
| 1620. Simple Bitcoin Widget |
com.brentpanther.bitcoinwidget |
Show current Bitcoin exchange prices |
2018-05-03 |
https://github.com/hwki/SimpleBitcoinWidget |
| 1621. Simple Brick Games |
de.tobiasbielefeld.brickgames |
Imitates handhelds from the past |
2017-10-01 |
https://github.com/TobiasBielefeld/Simple-Brick-Games |
| 1622. Simple Dilbert |
com.mareksebera.simpledilbert |
Comic strip reader |
2018-03-19 |
https://github.com/smarek/Simple-Dilbert |
| 1623. Simple Ethereum Widget |
com.brentpanther.ethereumwidget |
Show current Ethereum exchange prices |
2018-01-15 |
https://github.com/hwki/SimpleBitcoinWidget |
| 1624. Simple IRC |
tk.jordynsmediagroup.simpleirc.fdroid |
Connect to an IRC server |
2017-01-06 |
https://github.com/jcjordyn130/simpleirc |
| 1625. Simple Japanese Gojuon |
com.limitfan.gojuuon |
An app supports the writing and pronouncing of gojuon. |
Jan 23, 2017 |
https://github.com/limitfan/Simple-Japanese-Gojuon |
| 1626. Simple Keyboard |
rkr.simplekeyboard.inputmethod |
Simply keyboard and nothing more |
2018-06-02 |
https://github.com/rkkr/simple-keyboard |
| 1627. Simple Last.fm Scrobbler |
com.adam.aslfms |
Last.fm/Libre.fm Scrobbler |
2018-02-06 |
https://github.com/tgwizard/sls |
| 1628. Simple Litecoin Widget |
com.brentpanther.litecoinwidget |
Show current Litecoin exchange prices |
2018-01-15 |
https://github.com/hwki/SimpleBitcoinWidget |
| 1629. Simple Password Generator |
br.com.doublelogic.spg |
Simple and quick tool to generate passwords of varying size and quantity. |
Aug 28, 2017 |
https://github.com/diego-said/simple_password_generator |
| 1630. Simple Philosopherstone Widget |
com.toxtox.philosopherstonewidget |
tracking continuously the Philosopherstone (crypto coin) price on your mobile ph |
2018-02-22 |
https://github.com/toxtox/SimplePhilosopherstoneWidget |
| 1631. Simple Protocol Player |
com.kaytat.simpleprotocolplayer |
Audio player for PulseAudio's simple protocol module |
Oct 2, 2017 |
https://github.com/kaytat/SimpleProtocolPlayer |
| 1632. Simple Reboot |
simple.reboot.com |
Reboot your device |
2017-04-30 |
https://github.com/franciscofranco/Simple-Reboot-app |
| 1633. Simple Search |
de.tobiasbielefeld.searchbar |
Open source search app with a widget |
Jul 1, 2018 |
https://github.com/TobiasBielefeld/Simple-Search |
| 1634. Simple Snake |
be.martin.boris.snake |
A minimalist version of the classic game |
Nov 2, 2017 |
https://github.com/bisthebis/Android_Snake |
| 1635. Simple Solitaire Collection |
de.tobiasbielefeld.solitaire |
Solitaire game collection with 14 games |
2018-05-14 |
https://github.com/TobiasBielefeld/Simple-Solitaire |
| 1636. Simple TV Launcher |
org.cosinus.launchertv |
A very simple TV Launcher ! |
Jan 17, 2017 |
https://github.com/alescdb/LauncherTV |
| 1637. Simple Weather |
com.a5corp.weather |
Get weather information |
2018-02-06 |
https://github.com/Sparker0i/Weather |
| 1638. Simple Z-score Calculator |
com.matterofbiz.simple.z_score.calculator |
Analysts first assess financial viability of businesses using Altman’s Z-score |
Oct 2, 2018 |
https://github.com/matterofbiz/simple-zscore-calculator |
| 1639. Simple sms remote |
tranquvis.simplesmsremote |
Control your device by sending text messages |
2017-12-07 |
https://github.com/tranquvis/SimpleSmsRemote |
| 1640. SimpleStatsWidget |
de.simplestatswidget |
Displays simple statistics on phone calls and sms |
2018-05-14 |
https://github.com/Chessmasterrr/SimpleStatsWidget |
| 1641. Simpletask |
nl.mpcjanssen.simpletask |
Todo list manager |
2018-04-08 |
https://github.com/mpcjanssen/simpletask-android |
| 1642. Simplicity - Web Browser |
com.creativetrends.simplicity.app |
Simply Fast. Simply Secure. |
Sep 6, 2018 |
https://github.com/creativetrendsapps/SimplicityBrowser |
| 1643. Simply Solid |
com.enrico.earthquake |
Set solid colors as background |
2017-08-15 |
https://github.com/enricocid/Simply-Solid |
| 1644. Sipdroid |
org.sipdroid.sipua |
Free SIP/VoIP Client |
Jun 25, 2018 |
https://github.com/goldtie/push-to-talk |
| 1645. Site Monitor |
org.site_monitor |
Monitoring your website everywhere you are\nBe notified when your server down |
Nov 21, 2017 |
https://github.com/norbertmartin12/site-monitor |
| 1646. Siteswap Generator |
namlit.siteswapgenerator |
Generate juggling siteswaps for passing |
2018-05-14 |
https://github.com/namlit/siteswap_generator |
| 1647. Sketcher FREE |
org.sketcher |
Sketcher FREE procedural drawing tool |
Mar 15, 2017 |
https://github.com/nicolas-raoul/Sketcher |
| 1648. Sky Map |
com.google.android.stardroid |
Sky Map to explore the skies |
2017-05-20 |
https://github.com/sky-map-team/stardroid |
| 1649. SkyReigen |
de.gdoeppert.sky |
Ephemeris App for Sun, Moon and Planets |
Jun 20, 2018 |
https://github.com/gdoepp/skyreigen |
| 1650. SkyTube |
free.rm.skytube.oss |
A simple and feature-rich YouTube player |
2018-03-26 |
https://github.com/ram-on/SkyTube |
| 1651. SkyeTracker |
com.skye.skyetracker |
Controls an arduino nano based solar tracker using linear actuators |
Oct 7, 2018 |
https://github.com/graham22/SkyeTracker |
| 1652. SlideItLoud |
de.mangelow.slideitloud |
Turns on loud speaker if the keyboard is opened |
2017-02-12 |
https://github.com/scheich/SlideItLoud |
| 1653. Slideshow |
link.standen.michael.slideshow |
View a slideshow of your images |
2018-04-05 |
https://github.com/ScreamingHawk/android-slideshow |
| 1654. Slide |
me.ccrama.redditslide |
Companion app for reddit |
2018-04-24 |
https://github.com/ccrama/Slide |
| 1655. SlimSocial for Twitter |
it.rignanese.leo.slimtwitter |
Access Twitter |
2017-05-27 |
https://github.com/rignaneseleo/SlimSocial-for-Twitter |
| 1656. SlimSocial |
it.rignanese.leo.slimfacebook |
Browse Facebook |
2018-02-20 |
https://github.com/rignaneseleo/SlimSocial-for-Facebook |
| 1657. SmallBASIC |
net.sourceforge.smallbasic |
SmallBASIC is a fast and easy to learn BASIC programming language interpreter. |
Oct 13, 2018 |
https://github.com/chrisws/SmallBASIC |
| 1658. Smart Contact Reminder: Call, messages |
me.barta.stayintouch |
Get contact reminders to stay in touch with important people in your life. |
Sep 29, 2018 |
https://github.com/mbarta/scr-redesign |
| 1659. Smart Gadget |
com.sensirion.smartgadget |
Connect to your Sensirion Smart Gadget via BLE |
2017-09-01 |
https://github.com/Sensirion/SmartGadget-Android |
| 1660. Smart Power Control |
oly.netpowerctrl |
Have full control over your switchable network outlets from ANEL-Elektronik AG. |
Nov 7, 2017 |
https://github.com/davidgraeff/Android-NetPowerctrl |
| 1661. Smart Traffic |
org.scoutant.tf |
Display traffic jams in France |
Jun 20, 2018 |
https://github.com/scoutant/tf |
| 1662. Smart UFPA |
br.ufpa.smartufpa |
Use an interactive map to locate points and routes in UFPA. |
Mar 20, 2018 |
https://github.com/smartufpa/SmartCampusUFPA |
| 1663. Smite Scoreboard |
com.onthefencedevelopment.smitescoreboard |
Scoreboard for the Smite Garden Game |
Sep 3, 2018 |
https://github.com/OnTheFenceDevelopment/SmiteScoreboard |
| 1664. Smsonline: Sms on web browser |
fr.codazzi.smsonline |
Smsonline: Read and write SMS from a web browser, even away from your phone. |
Apr 22, 2017 |
https://github.com/stephane-/SmsOnline |
| 1665. Snake 3 |
ru.srcblog.litesoftteam.mysnake |
A computer game that arose in the middle or late 1970s |
Aug 23, 2017 |
https://github.com/javavirys/MySnake |
| 1666. SneakyBus |
com.conorodonnell.bus |
Dublin bus times |
Sep 20, 2018 |
https://github.com/ronocod/bus |
| 1667. Snooder 21 |
ru.exlmoto.snood21 |
remake of Motorola's standard card game Snood™ 21 |
2017-07-09 |
https://github.com/EXL/Snooder21 |
| 1668. SnoopSnitch |
de.srlabs.snoopsnitch |
Check mobile network security |
2017-10-21 |
https://opensource.srlabs.de/projects/snoopsnitch/repository/revisions/master/show |
| 1669. Social App |
com.rozdoum.socialcomponents |
With this app you can create posts, add likes and comments. |
Aug 6, 2018 |
https://github.com/rozdoum/social-app-android |
| 1670. Sofia Public Transport |
com.bearenterprises.sofiatraffic |
Get the arrival times for public transportation in Sofia. |
Jul 12, 2018 |
https://github.com/thalvadzhi/Sofia-Traffic |
| 1671. SolitaireCG |
net.sourceforge.solitaire_cg |
Solitaire Card Games |
2018-02-16 |
https://sourceforge.net/p/solitairecg/code |
| 1672. Son of Hunky Punk |
org.andglkmod.hunkypunk |
Interactive fiction player |
2017-03-24 |
https://github.com/retrobits/son_of_hunkypunk |
| 1673. Sound Recorder |
com.danielkim.soundrecorder |
Record audio files |
2017-05-25 |
https://github.com/dkim0419/SoundRecorder |
| 1674. Sound Wave |
com.synaptik.soundwave |
A very basic application that shows the sound wave of whatever it hears. |
Oct 1, 2018 |
https://github.com/synaptik-/SoundWave |
| 1675. SoundWaves |
org.bottiger.podcast |
Manage and listen to podcasts |
2018-02-22 |
https://github.com/bottiger/SoundWaves |
| 1676. Speaker Boost - Volume Booster |
mobi.omegacentauri.SpeakerBoost |
🔊 Free volume booster and music booster for your speakers and headphones 🔊 |
Oct 12, 2018 |
https://github.com/ilvu/speakerboost |
| 1677. Speaker Phone |
com.github.nahratzah.speakerphone |
A text to speech/AAC application. |
Nov 24, 2017 |
https://github.com/nahratzah/speaker_phone |
| 1678. SpeckSensor |
org.cmucreatelab.tasota.airprototype |
Reports air quality from your current location and in locations across the US. |
Aug 9, 2017 |
https://github.com/CMU-CREATE-Lab/airqualitytracker-android |
| 1679. Speed Touch |
jotace.org.speedtouch |
Speed Touch is the best App to save and call all your favorite contacts! |
Nov 2, 2017 |
https://github.com/juliorendon/speedtouch |
| 1680. Speed of Sound |
net.codechunk.speedofsound |
Keep your eyes on the road! Let Speed of Sound adjust your volume. |
May 8, 2018 |
https://github.com/jpeddicord/speedofsound |
| 1681. SpeedScout17 |
dkt01.speedscout17 |
FRC scouting made easy! |
Apr 24, 2017 |
https://github.com/FRC1756-Argos/SpeedScout17-Android |
| 1682. Speedmeter |
fly.speedmeter.grub |
Lightweight speed meter |
2017-03-08 |
https://github.com/flyingrub/SpeedMeter |
| 1683. Spending Tracker |
com.spendingtracker.app |
Spending Tracker is a simple, yet beautiful expense calculator app. |
Oct 11, 2017 |
https://github.com/wburhan2/SpendingTracker |
| 1684. Spike Recorder |
com.backyardbrains |
Records and analyzes neurons and muscle activity from your Spikerbox |
Oct 12, 2018 |
https://github.com/BackyardBrains/Backyard-Brains-Android-App |
| 1685. Sporting Skills: DL Calculator |
com.sportsoutclass.outclassdl |
A Duckworth and Lewis calculator for Cricket |
Oct 11, 2018 |
https://github.com/sachindayl/OutclassDL |
| 1686. SpotCommander |
net.olejon.spotcommander |
The most intuitive and feature-rich remote control for Spotify for Linux |
Apr 23, 2018 |
https://github.com/olejon/spotcommander |
| 1687. SpotiQ - Party Jukebox for Spotify |
se.zinokader.spotiq |
Make a real-time collaborative playlist for Spotify - with friends! |
Aug 18, 2017 |
https://github.com/ZinoKader/SpotiQ |
| 1688. Squamish Transit System Bus - MonTransit |
org.mtransit.android.ca_squamish_transit_system_bus |
Squamish Transit System buses for MonTransit.\nSchedule. Real time. News. |
Sep 14, 2018 |
https://github.com/mtransitapps/ca-squamish-transit-system-bus-android |
| 1689. SshClient |
com.outerworldapps.sshclient |
Ssh client with shell, file transfer, tunnel and VNC capabilities. |
Aug 19, 2017 |
https://github.com/mrieker/SshClient |
| 1690. St Albert Transit Bus - MonTransit |
org.mtransit.android.ca_st_albert_transit_bus |
St Albert Transit buses for MonTransit.\nSchedule… |
Sep 4, 2018 |
https://github.com/mtransitapps/ca-st-albert-transit-bus-android |
| 1691. St Catharines Transit Bus - MonTransit |
org.mtransit.android.ca_st_catharines_transit_bus |
St Catharines Transit Bus for MonTransit.\nSchedule. Real-Time. News. |
Sep 14, 2018 |
https://github.com/mtransitapps/ca-st-catharines-transit-bus-android |
| 1692. St John's Metrobus Transit Bus - MonTransit |
org.mtransit.android.ca_st_john_s_metrobus_transit_bus |
St John's Metrobus Transit buses for MonTransit.\nSchedule. News. Bulletins. |
Sep 26, 2018 |
https://github.com/mtransitapps/ca-st-john-s-metrobus-transit-bus-android |
| 1693. StageFever |
com.fr3ts0n.stagefever |
Display stage notes, AMP/effect settings etc |
2017-01-10 |
https://github.com/fr3ts0n/StageFever |
| 1694. Stamp Music Player |
com.sjn.stamp |
Music player studies music playback history and reminds memories. |
Oct 1, 2018 |
https://github.com/sjnyag/stamp |
| 1695. Stanley |
fr.xgouchet.packageexplorer |
An application explorer for developers |
2018-02-22 |
https://github.com/xgouchet/Stanley |
| 1696. Starke Verben |
org.sw24softwares.starkeverben |
Learn your German strong verbs |
2018-05-27 |
https://github.com/Sw24Softwares/StarkeVerben |
| 1697. Starun |
atm.starun.game |
Follow a cute star's travel |
2017-03-02 |
https://gitlab.com/atorresm/Starun/tree/HEAD |
| 1698. StashCache |
com.geekeclectic.android.stashcache |
Manage your cross stitching stash, easily produce a shopping list, and more! |
Jun 10, 2017 |
https://github.com/sylkai/stash_cache |
| 1699. Stately for NationStates |
com.lloydtorres.stately |
An unofficial app for NationStates — a political nation simulation game. |
Aug 14, 2018 |
https://github.com/lloydtorres/stately |
| 1700. Statistici Romania |
com.statisticiromania.app |
O modalitate usoara de a accesa date statistice |
Sep 8, 2018 |
https://github.com/OvidiuCaba/StatisticsRomania |
| 1701. Status Bar Speedometer |
ch.rmy.android.statusbar_tacho |
Displays your current speed in your status bar |
Mar 4, 2018 |
https://github.com/Waboodoo/Status-Bar-Tachometer |
| 1702. Status |
com.james.status |
A simple yet customizable status bar replacement. No root needed. |
Feb 9, 2018 |
https://github.com/TheAndroidMaster/Status |
| 1703. Stay-awake on adb |
nl.renedegroot.android.adbawake |
ADB notifications will trigger a wake lock to keep screen and phone on |
Jan 22, 2017 |
https://github.com/ontherunvaro/adb-awake |
| 1704. Stellarium Mobile Sky Map |
com.noctuasoftware.stellarium |
The most realistic sky map to observe stars, planets and constellations! |
Jul 24, 2018 |
https://github.com/chengxinlun/Stellarium-android |
| 1705. Step and Height counter |
grmpl.mk.stepandheightcounter |
Counting Steps and Elevation gain on Nexus 5X |
2017-02-10 |
https://github.com/grmpl/StepandHeightcounter |
| 1706. Stew |
net.stew.stew |
A simple soup.io app |
Jun 13, 2018 |
https://github.com/exviva/stew |
| 1707. Stitch Counter |
io.github.annaharri89.stitchcounter |
Keep track of those stitches, whether they be knit or crochet! |
Aug 21, 2017 |
https://github.com/annaharri89/stitchCounter |
| 1708. Stocked! |
com.anshulvyas.csc780.grocerymanagr |
To better manage groceries! |
Feb 22, 2018 |
https://github.com/av-7/GroceryManagR |
| 1709. Stocks Widget |
com.github.premnirmal.tickerwidget |
Stock market ticker widget |
2018-05-22 |
https://github.com/premnirmal/StockTicker |
| 1710. Storj-HostStats |
com.steinbacher.storj_hoststats_app |
Monitors your Storj-Nodes, tracks their data, alerts you if they go offline. |
Mar 13, 2018 |
https://github.com/geckogecko/storj_hoststats_app |
| 1711. Strathcona County Transit Bus - MonTransit |
org.mtransit.android.ca_strathcona_county_transit_bus |
Strathcona County Transit buses for MonTransit.\nSchedule… |
Aug 30, 2018 |
https://github.com/mtransitapps/ca-strathcona-county-transit-bus-android |
| 1712. Streetlight Seattle Reporter |
org.codeforseattle.streetlightseattlereporter |
Easily alert Seattle City Light to streetlight problems upon discovering them. |
Jun 15, 2017 |
https://github.com/jsfrost/StreetlightSeattleReporter |
| 1713. StreetComplete |
de.westnordost.streetcomplete |
OpenStreetMap surveyor app |
2018-05-07 |
https://github.com/westnordost/StreetComplete |
| 1714. Stringlate |
io.github.lonamiwebs.stringlate |
Help translating FOSS applications |
2018-06-04 |
https://github.com/LonamiWebs/Stringlate |
| 1715. Stroke Rate Coach |
com.batyanko.strokeratecoach |
Rowing metronome that beeps with desired stroke rate per minute (SPM) |
Jan 27, 2018 |
https://github.com/batyanko/stroke-rate-coach |
| 1716. Student Search IITK |
com.studentsearch.xoodle.studentsearch |
An app giving IITK student details |
Aug 24, 2017 |
https://github.com/xoodle/frost |
| 1717. SudoQ |
de.sudoq |
SudoQ is the ultimate sudoku app. Many sudoku types, zero ads, open source. |
Aug 7, 2017 |
https://github.com/peervalhoegen/SudoQ |
| 1718. Sudoku Bot Solver |
com.everettsprojects.sudokubotsolver |
Instant solutions to any sudoku. |
Mar 8, 2017 |
https://github.com/evjrob/SudokuBotSolver |
| 1719. Sudoku |
org.secuso.privacyfriendlysudoku |
Play Sudoku logic puzzle |
2017-07-01 |
https://github.com/SecUSo/privacy-friendly-sudoku |
| 1720. Sugarizer |
org.olpc_france.sugarizer |
Use Sugar learning platform |
2018-05-14 |
https://github.com/llaske/Sugarizer |
| 1721. Suntimes |
com.forrestguice.suntimeswidget |
Display sunrise, sunset, and twilight times |
2018-06-02 |
https://github.com/forrestguice/SuntimesWidget |
| 1722. SuperGenPass |
info.staticfree.SuperGenPass |
SuperGenPass — a database-free password manager |
Mar 19, 2018 |
https://github.com/xxv/SuperGenPass |
| 1723. Survival Manual |
org.ligi.survivalmanual |
Learn how to survive |
2018-04-16 |
https://github.com/ligi/SurvivalManual |
| 1724. Swedish-Hungarian dictionary |
io.github.tomszilagyi.svhu1972 |
Swedish-Hungarian dictionary. Entirely offline, speedy lookups, handy bookmarks. |
Jun 6, 2017 |
https://github.com/tomszilagyi/svhu1972 |
| 1725. SwiftBraille |
com.mbanna.swiftbraille |
Swift Braille Soft Keyboard ●→●→● Connect The Dots |
Oct 8, 2018 |
https://github.com/MohammadAlBanna/Swift-Braille-Soft-keyboard |
| 1726. Swiftnotes |
com.moonpi.swiftnotes |
Take notes |
2017-04-30 |
https://github.com/adrianchifor/Swiftnotes |
| 1727. Swipe Them |
com.mauriciotogneri.swipethem |
Swipe the tiles in the direction of the arrows. You have only 60 seconds! |
Sep 19, 2018 |
https://github.com/vndly/swipethem |
| 1728. SwpieView |
org.voidptr.swpieview |
Minimalist image viewer with GIF support |
2017-12-15 |
https://github.com/err4nt/SwpieView |
| 1729. Symphony |
org.fitchfamily.android.symphony |
A genre and album based music player |
2018-05-27 |
https://github.com/n76/Symphony |
| 1730. Sync Settings Locale-Plugin |
de.spiritcroc.syncsettings |
Create actions in Locale/Tasker to apply sync settings. |
Jul 27, 2018 |
https://github.com/SpiritCroc/SyncSettings |
| 1731. SyncOnWifi |
org.t2.synconwifi |
Synchronize accounts only on specific networks |
2017-07-14 |
https://github.com/Kadabash/SyncOnWifi |
| 1732. SyncOrg |
com.coste.syncorg |
Take and organize notes |
2017-01-25 |
https://github.com/wizmer/syncorg |
| 1733. SyncPlayer |
io.github.powerinside.syncplay |
Unofficial syncplay client |
2017-10-03 |
https://github.com/PowerInside/syncplayer |
| 1734. SyncWifi |
de.mangelow.syncwifi |
Control account authorities by connection |
2017-02-20 |
https://github.com/scheich/SyncWifi |
| 1735. Syncloud |
org.syncloud.android |
Manage your Syncloud devices. |
Aug 27, 2018 |
https://github.com/syncloud/android |
| 1736. Syncopoli |
org.amoradi.syncopoli |
An rsync client that works |
2018-05-21 |
https://gitlab.com/fengshaun/syncopoli/tree/HEAD |
| 1737. Syncthing Lite |
net.syncthing.lite |
File synchronization |
2018-02-22 |
https://github.com/syncthing/syncthing-lite |
| 1738. Syncthing |
com.nutomic.syncthingandroid |
File synchronization |
2018-05-18 |
https://github.com/syncthing/syncthing-android |
| 1739. SysLog |
com.tortel.syslog |
Capture log files |
2018-04-27 |
https://github.com/Tortel/SysLog |
| 1740. System Trigger |
com.timelesssky.systemtrigger |
A simple Android tool to run command on bootup and shutdown. |
Oct 14, 2017 |
https://github.com/skyleecm/systemtrigger |
| 1741. SystemUI Tuner |
com.zacharee1.systemuituner |
PLEASE READ ENTIRE DESCRIPTION BEFORE INSTALLING |
Oct 4, 2018 |
https://github.com/zacharee/SystemUITuner2 |
| 1742. T-UI |
ohi.andre.consolelauncher |
Terminal based launcher |
2018-04-03 |
https://github.com/Andre1299/TUI-ConsoleLauncher |
| 1743. T.T.S. 北科學生App |
com.Ntut |
臺北科技大學學生App\n找課表？找活動？找特約商店?\n用T.T.S.就對了~\n為北科學生建立方便的資訊管道\n由北科程設社 x 北科學生會聯合開發 |
Aug 6, 2018 |
https://github.com/Taipei-Tech-Student-Application/TaipeiTechStudentAndroid |
| 1744. TAsteroids |
com.blogspot.tasteroids |
TAsteroids is a classic space shooter arcade game. |
May 11, 2018 |
https://github.com/taiko000/TAsteroids |
| 1745. TEdit |
com.atr.tedit |
A simple text editor |
2018-06-04 |
https://github.com/ATryder/TEdit |
| 1746. THIRD RPG dice roller |
au.id.swords.third2 |
That's How I Roll Dice: A dice rolling app for roleplaying nerds. |
Feb 24, 2017 |
https://github.com/direvus/third |
| 1747. TREZOR Manager |
io.trezor.app |
TREZOR hardware wallet Manager |
2018-04-12 |
https://github.com/trezor/trezor-android |
| 1748. TRIfA |
com.zoffcc.applications.trifa |
TRIfA Tox Client |
2018-05-09 |
https://github.com/zoff99/ToxAndroidRefImpl |
| 1749. TTRSS-Reader |
org.ttrssreader |
An RSS reader for Tiny Tiny RSS |
2018-05-12 |
https://github.com/nilsbraden/ttrss-reader-fork |
| 1750. TUC WLAN |
de.tu_chemnitz.wlan |
Secure configuration of eduroam at TU Chemnitz |
2018-03-05 |
https://gitlab.hrz.tu-chemnitz.de/urz-anwendungen/TucWLAN |
| 1751. TUM Campus App |
de.tum.in.tumcampus |
Die App von Studierenden für Studierende |
Oct 16, 2018 |
https://github.com/thomasbley/tum-campus |
| 1752. TV KILL |
com.redirectapps.tvkill |
Turn off TVs |
2017-09-06 |
https://github.com/42SK/TVKILL |
| 1753. TV Show Tracker |
com.yrazlik.tvseriestracker |
Track all your favorite TV shows, discover popular ones with a clean & simple UI |
Jan 13, 2018 |
https://github.com/yrazlik/TV-Series-Tracker |
| 1754. TVHClient |
org.tvheadend.tvhclient |
TVHClient, the program to watch, schedule and manage your individual TV program! |
Jan 29, 2018 |
https://github.com/bigbig6/TVHClient |
| 1755. Tachiyomi |
eu.kanade.tachiyomi |
Manga reader |
2018-05-14 |
https://github.com/inorichi/tachiyomi |
| 1756. Taiwan AQI - realtime & push |
com.kfpun.twaqi |
trusted by 8000 users everyday |
Sep 14, 2018 |
https://github.com/7kfpun/TWAQIReactNative |
| 1757. Taiwan Animal Adoption |
com.taa |
Taiwan Animal Adoption (TAA) app will randomly display 10 pen Taiwan's claim to be raising an animal, click on the item to open its details. |
Apr 26, 2017 |
https://github.com/MrMYHuang/taa |
| 1758. TalkBack |
com.android.talkback |
Accessibility improvements |
2018-04-16 |
https://github.com/google/talkback |
| 1759. TamTime |
flying.grub.tamtime |
Horaires de Tram et Bus sur Montpellier. |
Apr 9, 2018 |
https://github.com/flyingrub/TamTime |
| 1760. Tamil Christian Worship Songs |
org.worshipsongs |
All the Tamil Christian lyrics you need in an elegantly designed ad free app. |
Jul 22, 2018 |
https://github.com/mcruncher/worshipsongs-android |
| 1761. Tanks of Freedom |
in.p1x.tanks_of_freedom |
Indie Turn Based Strategy in Isometric Pixel Art |
2017-03-21 |
https://github.com/w84death/Tanks-of-Freedom |
| 1762. Tap 'n' Turn |
com.gabm.screenrotationcontrol |
Confirm before the screen orientation gets applied |
2017-09-06 |
https://github.com/gabm/TapAndTurn |
| 1763. Tap'n'Turn |
com.gabm.tapandturn |
A simple App to help with auto-rotation |
Sep 3, 2017 |
https://github.com/gabm/TapAndTurn |
| 1764. Tapad |
com.bedrock.padder |
Remixing X Material Design |
Jun 24, 2018 |
https://github.com/berict/Tapad |
| 1765. Taponium |
wsdfhjxc.taponium |
Reflex-oriented arcade game |
2018-03-19 |
https://github.com/wsdfhjxc/taponium |
| 1766. Tarpon Calculator |
com.polytrout.tarpon |
Get approx weight from length and girth.\nUses \The new formula\ (Ault & Luo) |
Aug 19, 2018 |
https://github.com/oggust/tarpon-calculator |
| 1767. Taskbar |
com.farmerbb.taskbar |
Use a start menu to access apps |
2017-10-18 |
https://github.com/farmerbb/Taskbar |
| 1768. Taskkeeper |
io.gitlab.allenb1.todolist |
Keep track of to-dos |
2018-05-28 |
https://gitlab.com/AllenB1/taskeeper |
| 1769. Tasks |
org.dmfs.tasks |
Keep track of your list of goals |
2018-02-01 |
https://github.com/dmfs/opentasks |
| 1770. Tasks |
org.tasks |
Fork of Astrid Tasks & To-Do List |
2018-05-07 |
https://github.com/tasks/tasks |
| 1771. Tasty Cocktails |
com.dimowner.tastycocktails |
More than 550 drinks in the library. Find the best one for you |
Oct 14, 2018 |
https://github.com/Dimowner/TastyCocktails |
| 1772. Taxi Bulgaria |
com.opentaxi.android |
Open source taxi platform designed for connection between client and taxicab |
Aug 16, 2017 |
https://github.com/sytolk/TaxiAndroidOpen |
| 1773. TeaCup |
net.chilon.matt.teacup |
Configurable music widget |
2017-09-24 |
https://github.com/yourealwaysbe/teacup |
| 1774. Teaching Skills |
ve.com.ennerperez.teaching.skills |
Digital Skills for Teacher Update |
Sep 13, 2017 |
https://github.com/ennerperez/teaching-skills |
| 1775. TeamCityApp |
com.github.vase4kin.teamcityapp |
TeamCity in your pocket |
Oct 1, 2018 |
https://github.com/vase4kin/TeamCityApp |
| 1776. TeamOn |
com.newmediamarketingagency.teamon |
TeamOn is an open-source mobile app. |
Sep 1, 2017 |
https://github.com/teamOnHQ/TeamOn |
| 1777. Telegram |
org.telegram.messenger |
Telegram is a messaging app with a focus on speed and security. |
2018-04-21 |
https://github.com/Telegram-FOSS-Team/Telegram-FOSS |
| 1778. Telldus Live! mobile |
com.telldus.live.mobile |
Automate your home with Telldus TellStick |
May 8, 2018 |
https://github.com/telldus/telldus-live-mobile-v3 |
| 1779. Tempo Widget |
tempo.khopa.com.tempo |
A widget to see the color Tempo EDF on your Android home screen. |
Nov 30, 2017 |
https://github.com/Khopa/tempo-edf |
| 1780. Tension Tunnel |
com.mauriciotogneri.tensiontunnel |
Fly across the tunnel avoiding all the obstacles! |
Sep 19, 2018 |
https://github.com/mauriciotogneri/tensiontunnel |
| 1781. TermBot |
org.sufficientlysecure.termbot |
SSH client for use with smart cards |
2018-05-21 |
https://github.com/open-keychain/termbot |
| 1782. Terminal Emulator |
jackpal.androidterm |
Access Android's built-in Linux command line shell. Unleash your inner geek! |
2017-07-18 |
https://github.com/jackpal/Android-Terminal-Emulator |
| 1783. Terminightor |
org.schabi.terminightor |
Alarm clock based on NFC tags |
2017-04-23 |
https://github.com/theScrabi/Terminightor |
| 1784. TermoWidget |
com.fomichev.termowidget |
Widget for Android displays the temperature of the battery. |
Apr 16, 2018 |
https://github.com/7554732/TermoWidget |
| 1785. Termux:API |
com.termux.api |
Access Android functions from Termux |
2018-04-12 |
https://github.com/termux/termux-api |
| 1786. Termux:Boot |
com.termux.boot |
Termux add-on app allowing programs to be run at boot |
2017-12-04 |
https://github.com/termux/termux-boot |
| 1787. Termux:Float |
com.termux.window |
Use Termux in a floating terminal window |
2017-12-04 |
https://github.com/termux/termux-float |
| 1788. Termux:Styling |
com.termux.styling |
Customize your Termux terminal |
2017-12-04 |
https://github.com/termux/termux-styling |
| 1789. Termux:Task |
com.termux.tasker |
Tasker plug-in to run Termux scripts from Tasker |
2017-12-04 |
https://github.com/termux/termux-tasker |
| 1790. Termux:Widget |
com.termux.widget |
Launch Termux commands from the homescreen |
2017-12-04 |
https://github.com/termux/termux-widget |
| 1791. Termux |
com.termux |
Terminal emulator with packages |
2018-01-29 |
https://github.com/termux/termux-app |
| 1792. Test DPC |
com.afwsamples.testdpc |
Test DPC is a sample device policy controller for use with Android Enterprise. |
Jun 13, 2018 |
https://github.com/googlesamples/android-testdpc |
| 1793. Test Deep Links & Deep linking |
com.manoj.dlt |
Test and verify deep links from your laptop browser or phone - WITHOUT ADB. |
Sep 24, 2018 |
https://github.com/ManojMadanmohan/dlt |
| 1794. Text Scanner (OCR) |
com.ltapps.textscanner |
The open source text scanner using tesseract. |
Aug 31, 2018 |
https://github.com/testica/text-scanner |
| 1795. Thank You |
com.simplemobiletools.thankyou |
A paid app for people who want to support us, not doing much yet. |
2018-05-12 |
https://github.com/SimpleMobileTools/Simple-Thank-You |
| 1796. The Attendance |
com.attendance |
An app for teachers that want to take attendances classes using their phones. |
Apr 28, 2017 |
https://github.com/yifeizhou/Attendance |
| 1797. The Blue Alliance |
com.thebluealliance.androidclient |
An Android app for accessing information about the FIRST Robotics Competition.🤖 |
Apr 10, 2018 |
https://github.com/1fish2/the-blue-alliance-android |
| 1798. The Comedy Companion |
com.comedycompanion |
Manage your Jokes, Set Lists, and Performances all in one place! |
Mar 19, 2018 |
https://github.com/dereksweet/ComedyCompanion |
| 1799. The Italian Said |
italian.said.fran.theitaliansaid |
Italian proverbs in English |
2017-07-18 |
https://github.com/francescosoave/TIS_android |
| 1800. The Jump Rope Tricktionary |
trictionary.jumproper.com.jumpropetrictionary |
A video dictionary of 158 jump rope tricks from basic to masters level skills. |
Sep 8, 2018 |
https://github.com/the-tricktionary/android |
| 1801. The Learning Lock |
io.alstonlin.thelearninglock |
A lock screen that learns how you draw your pattern to detect and stop impostors |
May 6, 2017 |
https://github.com/AlstonLin/TheLearningLock |
| 1802. The Light |
org.hlwd.bible |
Bible multi languages, free, offline, no advertising |
2018-05-07 |
https://gitlab.com/hotlittlewhitedog/BibleMultiTheLight/tree/HEAD |
| 1803. The Movies |
com.sen.john.mythemovies |
Info and details, characters, trailers, recommended, reviews and custom searches |
May 14, 2017 |
https://github.com/JonathandelaSen/TheMovies |
| 1804. Theia Icon Theme |
com.elementarytoday.theia |
Icon theme |
2018-01-15 |
https://github.com/varlesh/theia-icon-theme |
| 1805. Themeify IconPack |
me.iacn.mbestyle |
Themeify IconPack have line and great colorful icons with beautiful wallpapers |
Oct 21, 2018 |
https://github.com/iAcn/MBEStyle |
| 1806. Thermocouples |
com.southerntemp.thermocouples |
Thermocouple Reference, Information and Calculations |
Sep 16, 2017 |
https://github.com/ssddanbrown/Thermocouples |
| 1807. ThinkQuick |
ch.hslu.mobpro.proj.thinkquick |
Variation of Rock-Paper-Scissor |
Apr 19, 2018 |
https://github.com/jaunerc/ThinkQuick |
| 1808. Three D Radio Player |
com.threedradio.player |
Listen to Three D Radio on demand wherever you are in the world! |
May 27, 2018 |
https://github.com/ThreeDRadio/AndroidPlayer |
| 1809. Throughput |
de.mangelow.throughput |
Notification monitor for network throughput |
2017-03-17 |
https://github.com/scheich/Throughput |
| 1810. Thugaim |
info.meoblast001.thugaim |
A 2D space shooter game |
2017-01-17 |
https://github.com/meoblast001/thugaim |
| 1811. Thunder Bay Transit Bus - MonTransit |
org.mtransit.android.ca_thunder_bay_transit_bus |
Thunder Bay Transit buses for MonTransit.\nSchedule. Alerts. News. |
Oct 10, 2018 |
https://github.com/mtransitapps/ca-thunder-bay-transit-bus-android |
| 1812. ThunderScout - Scout with power |
com.team980.thunderscout |
Now updated for 2018's FIRST POWER UP! |
Mar 12, 2018 |
https://github.com/Team980/ThunderScout-Android |
| 1813. Tic Tac Toe Squared |
com.diusrex.tictactoe |
A twist on Tic Tac Toe that makes the game more challenging and fun. |
Feb 18, 2017 |
https://github.com/Diusrex/Tic-Tac-Toe-Squared |
| 1814. Tickmate |
de.smasi.tickmate |
One bit journal |
2017-09-13 |
https://github.com/lordi/tickmate |
| 1815. TilelessMap |
org.tilelessmap.app |
An offline only map client, reading from SQLite and rendering in openGL es2 |
2018-03-15 |
https://github.com/TilelessMap/TilelessMap |
| 1816. Timecrypt for Android |
co.timecrypt.android |
Timecrypt is an open-source, non-realtime communication API for secret messaging |
Apr 6, 2018 |
https://github.com/milosmns/Timecrypt |
| 1817. TimerDroid - Timer App |
com.tomatodev.timerdroid |
Timer app with categories for your own configurable timers. |
May 21, 2018 |
https://github.com/hoffimar/timerdroid |
| 1818. Timezone Updater |
ru.meefik.tzupdater |
Automatic update a time zones on Android |
Aug 26, 2017 |
https://github.com/meefik/tzupdater |
| 1819. Tinc |
org.pacien.tincapp |
A mesh VPN daemon |
2018-05-27 |
https://github.com/pacien/tincapp |
| 1820. Tinfoil for Facebook |
com.danvelazco.fbwrapper |
Facebook browser with privacy |
2017-05-06 |
https://github.com/velazcod/Tinfoil-Facebook |
| 1821. Tiny Tiny Feed - Setup |
org.poopeeland.tinytinyfeed |
Widget client for TTRSS |
2018-05-12 |
https://github.com/fistons/TinyTinyFeed |
| 1822. Tiny Tiny RSS |
org.fox.tttrss |
Client to connect to TinyTinyRSS |
2018-05-09 |
https://github.com/theScrabi/tttrsss/ |
| 1823. Tiny Travel Tracker |
com.rareventure.gps2 |
Secure long term GPS tracker and log |
2018-05-26 |
https://github.com/redfish64/TinyTravelTracker |
| 1824. TinyKeePass |
org.sorz.lab.tinykeepass |
Another simple read-only KeePass app |
2018-05-14 |
https://github.com/sorz/TinyKeePass |
| 1825. Titan Companion |
pt.joaomneto.titancompanion |
Stat sheet and rules engine for all Fighting Fantasy gamebooks |
2018-06-02 |
https://github.com/joaomneto/TitanCompanion |
| 1826. To-Do List |
org.secuso.privacyfriendlytodolist |
Keep a list of tasks |
2018-04-05 |
https://github.com/SecUSo/privacy-friendly-todo-list |
| 1827. ToGoZip |
de.k3b.android.toGoZip |
ToGoZip: Add to Zip for android-s share/send menu. |
2018-05-16 |
https://github.com/k3b/toGoZip |
| 1828. Today In Tech |
com.wilsonburhan.todayintech |
Keep yourself up to date with the latest tech news. |
Oct 11, 2017 |
https://github.com/wburhan2/TodayInTech |
| 1829. TogetterOpener |
jp.eagan.togetteropener |
It will open a link to togetter.com in Togetter app. |
Jun 3, 2017 |
https://github.com/eagan/TogetterOpener |
| 1830. Toggl Time Tracker, Timesheet |
com.toggl.timer |
Toggl is an online time tracking tool. It helps you see where your time goes. |
Oct 3, 2018 |
https://github.com/masterrr/mobile |
| 1831. Togoparts |
sg.togoparts |
Singapore’s most additive bicycle marketplace is now on Android! |
Jun 13, 2018 |
https://github.com/haipn/togoparts |
| 1832. ToneGenerator.class |
com.github.axet.tonegenerator |
ToneGenerator class preview app, open-source |
2018-03-05 |
https://gitlab.com/axet/android-tone-generator/tree/HEAD |
| 1833. TopoSuite |
ch.hgdev.toposuite |
Tool for land surveyors |
2017-01-17 |
https://github.com/hgdev-ch/toposuite-android |
| 1834. Torchie |
in.blogspot.anselmbros.torchie |
Access LED flashlight from the Volume buttons |
2017-12-15 |
https://github.com/anselm94/Torchie-Android |
| 1835. Torchlight |
com.fake.android.torchlight |
Use the flash of your camera as a light |
2018-05-23 |
https://github.com/kaeptmblaubaer1000/android-torchlight |
| 1836. Toronto TTC Bus - MonTransit |
org.mtransit.android.ca_toronto_ttc_bus |
Toronto TTC buses for MonTransit.\nSchedule. Real-Time. Service Alerts. News. |
Sep 28, 2018 |
https://github.com/mtransitapps/ca-toronto-ttc-bus-android |
| 1837. Toronto TTC Streetcar - MonTransit |
org.mtransit.android.ca_toronto_ttc_light_rail |
Toronto TTC streetcars for MonTransit.\nSchedule. Real-Time. Alerts. News. |
Sep 28, 2018 |
https://github.com/mtransitapps/ca-toronto-ttc-light-rail-android |
| 1838. Toronto TTC Subway - MonTransit |
org.mtransit.android.ca_toronto_ttc_subway |
Toronto TTC subways for MonTransit.\nSchedule. Service Alerts. News. |
Sep 28, 2018 |
https://github.com/mtransitapps/ca-toronto-ttc-subway-android |
| 1839. Torrent Client |
com.github.axet.torrentclient |
Download torrent files |
2018-06-02 |
https://gitlab.com/axet/android-torrent-client/tree/HEAD |
| 1840. Touch Screen Fix - OnePlus One |
com.kozaxinan.fixoposcreen |
Are you tired of unintentionally opening of notification panel during a call? |
Mar 19, 2017 |
https://github.com/kozaxinan/OnePlus-One-Screen-Fix |
| 1841. TouchDetector |
com.msapps.touchdetector |
Show touches on screen |
2017-01-14 |
https://github.com/sujithkanna/TouchDetector |
| 1842. TourCount |
com.wmstein.tourcount |
Species-specific counting of butterflies in nature |
2018-05-06 |
https://github.com/wistein/TourCount |
| 1843. Tower Collector |
info.zamojski.soft.towercollector |
|
2018-06-02 |
https://github.com/zamojski/TowerCollector |
| 1844. Traccar Client |
org.traccar.client |
Track your location |
2018-04-10 |
https://github.com/tananaev/traccar-client-android |
| 1845. Track Work Time |
org.zephyrsoft.trackworktime |
Track your work time |
2017-02-18 |
https://github.com/mathisdt/trackworktime |
| 1846. Trackbook |
org.y20k.trackbook |
Record your movement |
2018-05-25 |
https://github.com/y20k/trackbook |
| 1847. Tracker Capture for DHIS 2 |
org.hisp.dhis.android.trackercapture |
Tracker Capture for DHIS 2 |
Aug 6, 2018 |
https://github.com/arthurgwatidzo/RSA-DHIS2-Trackercapture |
| 1848. Tracman |
us.keithirwin.tracman |
Show your realtime GPS location on a personal online map. |
Jan 31, 2018 |
https://github.com/Tracman-org/Android |
| 1849. TranSapp |
cl.smartcities.isci.transportinspector |
Juntos podemos hacer un mejor Transantiago 💪 |
Oct 17, 2018 |
https://github.com/InspectorIncognito/androidApp |
| 1850. Transdroid Torrent Search |
org.transdroid.search |
Plugin for Transdroid |
2018-02-28 |
https://github.com/erickok/transdroid-search |
| 1851. Transdroid |
org.transdroid.full |
Manage BitTorrent clients |
2018-03-10 |
https://github.com/erickok/transdroid |
| 1852. Transdrone |
org.transdroid.lite |
Manage BitTorrent clients |
2018-03-31 |
https://github.com/erickok/transdroid |
| 1853. TransektCount |
com.wmstein.transektcount |
Transect counting according to the Butterfly Monitoring Scheme methodology |
2018-05-06 |
https://github.com/wistein/TransektCount |
| 1854. Transistor |
org.y20k.transistor |
Listen to radio streams |
2018-04-14 |
https://github.com/y20k/transistor |
| 1855. Transit Windsor Bus - MonTransit |
org.mtransit.android.ca_windsor_transit_bus |
Transit Windsor Bus for MonTransit.\nSchedule. Real time. |
Oct 3, 2018 |
https://github.com/mtransitapps/ca-windsor-transit-bus-android |
| 1856. Transportr |
de.grobox.liberario |
Public Transport Companion |
2018-02-20 |
https://github.com/grote/Transportr |
| 1857. Trans |
ir.hsn6.trans |
A escaping game |
2017-10-01 |
https://github.com/HassanHeydariNasab/trans |
| 1858. Travel Mate |
io.github.project_travel_mate |
A complete travel guide! |
Oct 18, 2018 |
https://github.com/Swati4star/Travel-Mate |
| 1859. TrebleShot |
com.genonbeta.TrebleShot |
Send and receive files over available connections |
2018-05-27 |
https://github.com/genonbeta/TrebleShot |
| 1860. TreeLogy |
com.payinekereg.treelogy |
Leaf-Based Tree Identification System |
Sep 10, 2017 |
https://github.com/cuguilke/Treelogy |
| 1861. Treebolic |
org.treebolic |
Rendering of trees in a display space that is subject to a hyperbolic curvature |
Jan 7, 2018 |
https://github.com/1313ou/Treebolic |
| 1862. TrekAdvisor |
com.peterlaurence.trekadvisor |
Offline topographic maps, using USGS, France IGN, OpenStreetMap, etc. |
Oct 14, 2018 |
https://github.com/peterLaurence/TrekAdvisor |
| 1863. Tremotesf |
org.equeim.tremotesf |
Remote-control Transmission BitTorrent client |
2018-05-14 |
https://github.com/equeim/tremotesf-android |
| 1864. Tri-Valley Buses |
io.github.whirish.tvbuses |
View and track Tri-Valley Wheels bus locations, stop times, and routes |
2017-05-10 |
https://github.com/whirish/Tri-Valley-Buses |
| 1865. TriesteinBus |
it.fabmazz.triestebus |
Arrival times for Trieste public transport |
2018-02-20 |
https://github.com/fabmazz/triesteinbus |
| 1866. TripSit |
me.tripsit.tripmobile |
Information, combination charts and a live help chat for recreational drugs |
2017-03-08 |
https://github.com/TripSit/tripmobile |
| 1867. TripleCamel |
com.ebaschiera.triplecamel |
Check price history of Amazon products |
2018-06-02 |
https://github.com/ebaschiera/TripleCamel |
| 1868. Trudnoća i razvoj bebe |
com.mhalka.babytracker |
Praćenje trudnoće i razvoja bebe |
Sep 29, 2018 |
https://github.com/almir/babytracker |
| 1869. TrumpBot |
co.brookesoftware.mike.trumpbot |
Have a conversation with the real life fake Donald Trump chat bot! |
Jan 27, 2017 |
https://github.com/MikeCroall/TrumpBot |
| 1870. TryCamel |
com.cstewart.android.trycamel |
Send any Amazon link to CamelCamelCamel |
Nov 19, 2017 |
https://github.com/cstew/TryCamel |
| 1871. Trycorder |
net.ddns.mlsoftlaberge.trycorder |
Upgrade your mobile device to a full-fledged tricorder |
2017-04-08 |
https://github.com/mlsoft/Trycorder5 |
| 1872. Tuner |
org.billthefarmer.tuner |
Musical instrument pitch tuning |
2018-03-10 |
https://github.com/billthefarmer/tuner |
| 1873. TurboToast |
com.bhb27.turbotoast |
A simple app to toast \Turbo Charger Connected\ when Turbo* charger is connected |
Oct 2, 2018 |
https://github.com/translucentfocus/turbotoast |
| 1874. Turo |
ir.hsn6.turo |
Build a Tower |
2018-03-15 |
https://github.com/HassanHeydariNasab/turo |
| 1875. Turris |
cz.nic.turris |
Turris Omnia companion app |
2017-12-24 |
https://gitlab.labs.nic.cz/turris/turris-android/ |
| 1876. Turtl |
org.xphnx.iconsubmit |
Request missing icons in your icon pack |
2018-05-25 |
https://gitlab.com/xphnx/icon-request-tool |
| 1877. Tusky |
com.keylesspalace.tusky |
Material Design Mastodon Client |
2018-05-12 |
https://github.com/tuskyapp/Tusky |
| 1878. Tutanota: simply secure emails |
de.tutao.tutanota |
Take back your privacy: Open source end-to-end encrypted email app. |
Sep 27, 2018 |
https://github.com/tutao/tutanota |
| 1879. Tux Paint |
org.tuxpaint |
A drawing program for children. |
2018-04-05 |
https://github.com/tux4kids/Tuxpaint-Android |
| 1880. Tweetings for Twitter |
com.dwdesign.tweetings |
Powerful & gorgeous ad-free Twitter client with a chronological timeline |
Sep 25, 2018 |
https://github.com/keverets/tweetings |
| 1881. Twidere |
org.mariotaku.twidere |
Microblogging client |
2017-11-17 |
https://github.com/TwidereProject/Twidere-Android |
| 1882. UART Smartwatch |
click.dummer.UartSmartwatch |
Bluetooth App for a UART-Smartwatch |
2017-08-02 |
https://github.com/no-go/UART-Smartwatch |
| 1883. UC San Diego |
edu.ucsd |
The official UC San Diego Mobile app connects you to the UC San Diego campus. |
Jun 21, 2018 |
https://github.com/UCSD/now-mobile |
| 1884. UCI Transit |
com.robsterthelobster.ucibustracker |
Quickly view the nearest Anteater Express shuttle times. |
Oct 31, 2017 |
https://github.com/tripleducke/Capstone-Project |
| 1885. UCOmove |
com.gnzlt.ucotren |
La aplicación de transporte para el Campus Universitario de Rabanales de la UCO |
Mar 7, 2018 |
https://github.com/Gnzlt/UCOmove |
| 1886. UNCmorfi |
com.uncmorfi |
Aplicación NO oficial del comedor universitario de la UNC |
Aug 19, 2018 |
https://github.com/AIDEA775/UNCmorfi |
| 1887. UOregon |
edu.uoregon |
UOregon is the official Android app of the University of Oregon. |
Sep 24, 2018 |
https://github.com/dmundra/cis650completestreets |
| 1888. USB Device Info |
aws.apps.usbDeviceEnumerator |
List USB Devices |
2017-05-15 |
https://github.com/alt236/USB-Device-Info---Android |
| 1889. USB Mountr |
streetwalrus.usbmountr |
Use your device as a USB flash drive |
2018-05-22 |
https://github.com/Streetwalrus/android_usb_msd |
| 1890. USB Serial Console |
jp.sugnakys.usbserialconsole |
USB Serial Console is a USB serial communication application. |
Mar 1, 2017 |
https://github.com/sugnakys/UsbSerialConsole |
| 1891. USSD Codes Shortkeys |
mobi.koni.ussd |
Use your phone carrier's USSD short key codes |
Aug 16, 2018 |
https://github.com/konir/USSD |
| 1892. UT Utilities |
com.nasageek.utexasutilities |
Unofficial app for UT students |
Dec 22, 2017 |
https://github.com/NasaGeek/utexas-utilities |
| 1893. Ubuntu Countdown Widget |
com.leinardi.ubuntucountdownwidget |
Keep an eye on the days remaining before the new release of Ubuntu! |
Dec 12, 2017 |
https://github.com/debgor/ubuntu-countdown-widget |
| 1894. UltraSonic |
org.moire.ultrasonic |
A music streaming client for Subsonic servers |
2018-02-22 |
https://github.com/ultrasonic/ultrasonic |
| 1895. Umbrella: Security made easy |
org.secfirst.umbrella |
Digital and physical security for people at risk. (BETA) |
Feb 28, 2018 |
https://github.com/securityfirst/Umbrella_android |
| 1896. Umweltzone (low emission zone) |
de.avpptr.umweltzone |
Know where a low emission zone is! Avoid a ticket because of a wrong sticker |
May 23, 2018 |
https://github.com/johnjohndoe/Umweltzone |
| 1897. Uncle Finney's Poker |
com.liveplayergames.finneypoker |
Play head-to-head poker and bet Ether |
2017-05-22 |
https://github.com/liveplayergames/UFP |
| 1898. UniPatcher |
org.emunix.unipatcher |
Utility to apply patches to ROMs |
2018-02-20 |
https://github.com/btimofeev/UniPatcher |
| 1899. UnifiedNlp (GAPPS) |
org.microg.nlp |
Location provider middleware (UnifiedNlp) |
2017-01-17 |
https://github.com/microg/android_packages_apps_UnifiedNlp |
| 1900. UnifiedNlp (no GAPPS) (legacy) |
com.google.android.location |
Location provider middleware (UnifiedNlp) |
2017-01-17 |
https://github.com/microg/android_packages_apps_UnifiedNlp |
| 1901. UnifiedNlp (no GAPPS) |
com.google.android.gms |
Location provider middleware (UnifiedNlp) |
2017-01-17 |
https://github.com/microg/android_packages_apps_UnifiedNlp |
| 1902. Union Pearson Express Train - MonTransit |
org.mtransit.android.ca_gta_up_express_train |
Greater Toronto Area Union Pearson Express train for MonTransit.\nSchedule. News. |
Oct 3, 2018 |
https://github.com/mtransitapps/ca-gta-up-express-train-android |
| 1903. Unit Converter Ultimate |
com.physphil.android.unitconverterultimate |
Convert between units with ease |
2017-03-30 |
https://github.com/physphil/UnitConverterUltimate |
| 1904. Unit Converter |
au.id.rlac.unitconverter |
Basic unit conversion between commonly used US and metric units. |
Jan 7, 2017 |
https://github.com/rlac/unitconverter |
| 1905. Units |
com.calintat.units |
Simple unit converter |
Aug 15, 2017 |
https://github.com/calintat/Units |
| 1906. Univerzitet u Novom Sadu |
rs.ac.uns |
An application that provides useful information for university and student life. |
Jun 27, 2017 |
https://github.com/unsftn/unsmobile |
| 1907. Unpopular Music Player |
de.kromke.andreas.unpopmusicplayerfree |
A plain music player especially for classical music |
2018-04-21 |
https://gitlab.com/AndreasK/unpopular-music-player |
| 1908. UoB Timetable |
com.ak.uobtimetable |
Timetable app for the University of Bedfordshire. |
Oct 9, 2017 |
https://github.com/adriankeenan/uob-timetable-android |
| 1909. Updater for Spotify |
ru.ra66it.updaterforspotify |
Download the latest version of Spotify |
2018-05-07 |
https://github.com/2Ra66it/updater-for-spotify |
| 1910. V2EX+ |
com.czbix.v2ex |
V2EX tailored to the client. |
Apr 19, 2018 |
https://github.com/CzBiX/v2ex-android |
| 1911. VEX Scouter |
com.mkalash.vexscouter |
A drafting tool for the Vex Robotics Competition. |
Jan 9, 2018 |
https://github.com/mustafakalash/vexscouter |
| 1912. VISCompass |
com.viscompass.visompass |
An audio compass for visually impaired sailors |
Jun 24, 2018 |
https://github.com/mattclarkdotnet/viscompass |
| 1913. VNDB Android |
com.booboot.vndbandroid |
Android client for the Visual Novel Database ( VNDB - https://vndb.org ) |
May 1, 2017 |
https://github.com/herbeth1u/VNDB-Android |
| 1914. VNote |
com.tassadar.vnote |
Simple note application that opens .VNT files. |
Aug 25, 2017 |
https://github.com/Tasssadar/vnote |
| 1915. VPN Hotspot |
be.mygod.vpnhotspot |
Share your VPN connection over hotspot or repeater |
2018-06-04 |
https://github.com/Mygod/VPNHotspot |
| 1916. VRM |
nl.victronenergy |
Monitor and manage your Victron Energy systems with Victron VRM. |
Sep 19, 2018 |
https://github.com/victronenergy/apps_vrm_android |
| 1917. Vancouver Mobi Bike - MonTransit |
org.mtransit.android.ca_vancouver_mobi_bike |
Vancouver Mobi Bike Share for MonTransit.\nAvailability. News. |
Aug 2, 2018 |
https://github.com/mtransitapps/ca-vancouver-mobi-bike-android |
| 1918. Vancouver Transit Bus - MonTransit |
org.mtransit.android.ca_vancouver_translink_bus |
Vancouver buses for MonTransit.\nSchedule. Real-Time. Alerts. News. |
Oct 14, 2018 |
https://github.com/mtransitapps/ca-vancouver-translink-bus-android |
| 1919. Vancouver Transit Ferry - MonTransit |
org.mtransit.android.ca_vancouver_translink_ferry2 |
Vancouver ferries for MonTransit.\nSchedule. Alerts. News. |
Sep 3, 2018 |
https://github.com/mtransitapps/ca-vancouver-translink-ferry-android |
| 1920. Vancouver Transit Train - MonTransit |
org.mtransit.android.ca_vancouver_translink_train |
Vancouver trains for MonTransit.\nSchedule. Alerts. News. |
Sep 3, 2018 |
https://github.com/mtransitapps/ca-vancouver-translink-train-android |
| 1921. Vanilla Cover Fetch |
com.kanedias.vanilla.coverfetch |
Vanilla Music player Cover Fetch plugin |
2017-10-18 |
https://github.com/vanilla-music/vanilla-music-cover-fetch |
| 1922. Vanilla Lyrics Search |
com.kanedias.vanilla.lyrics |
Vanilla Music player Lyrics Search plugin |
2017-12-07 |
https://github.com/vanilla-music/vanilla-music-lyrics-search |
| 1923. Vanilla Music |
ch.blinkenlights.android.vanilla |
Listen to and manage songs |
2018-05-14 |
https://github.com/vanilla-music/vanilla |
| 1924. Vanilla Tag Editor |
com.kanedias.vanilla.audiotag |
Vanilla Music player Tag Editor plugin |
2017-11-17 |
https://github.com/vanilla-music/vanilla-music-tag-editor |
| 1925. Varis |
com.khmelenko.lab.varis |
Unofficial client for Travis CI service |
Oct 7, 2017 |
https://github.com/DreierF/TravisClient-Android |
| 1926. Velociraptor - Speed Limits & Speedometer |
com.pluscubed.velociraptor |
Floating speed limit monitor that automatically displays in maps |
Feb 3, 2018 |
https://github.com/plusCubed/velociraptor |
| 1927. Velocity Calculator |
ch.jiikuy.velocitycalculator |
Calculate the speed of an object in a video |
2018-02-11 |
https://github.com/jiikuy/velocitycalculator |
| 1928. Veneto Meteo |
eu.lucazanini.arpav |
Weather forecast for all locations in Veneto |
Dec 26, 2017 |
https://github.com/luni66/Arpav |
| 1929. Verbiste Android |
com.allansimon.verbisteandroid |
Conjugate French verbs |
2017-01-20 |
https://github.com/allan-simon/verbiste-android |
| 1930. Verse By Verse Ministry |
com.erpdevelopment.vbvm |
The free all-in-one Bible study app featuring the teaching of Stephen Armstrong |
Oct 12, 2018 |
https://github.com/VBVMI/VerseByVerse-Android |
| 1931. Vespapp |
com.habitissimo.vespapp |
Vespapp: citizen science for detection of the Asian hornet |
May 28, 2017 |
https://github.com/CarlosTenorio/vespapp-android |
| 1932. Vespucci |
de.blau.android |
OpenStreetMap editor |
2018-05-12 |
https://github.com/MarcusWolschon/osmeditor4android |
| 1933. Vialer |
com.voipgrid.vialer |
With Vialer you dial out with your smartphone using your business phone number. |
Jul 30, 2018 |
https://github.com/VoIPGRID/vialer-android |
| 1934. Vibora-Feed |
de.vibora.viborafeed |
reader for one feed and Vibora.de Blog |
2017-02-26 |
https://github.com/no-go/ViboraFeed |
| 1935. Victor Navigator |
pl.org.seva.navigator |
Share your location with your friends. |
Aug 8, 2018 |
https://github.com/syrop/Wiktor-Navigator |
| 1936. Victoria Regional Transit System Bus - MonTransit |
org.mtransit.android.ca_victoria_regional_transit_system_bus |
Victoria Regional Transit System buses for MonTransit.\nSchedule. Alerts. News. |
Sep 4, 2018 |
https://github.com/mtransitapps/ca-victoria-regional-transit-system-bus-android |
| 1937. Video Transcoder |
protect.videoeditor |
Video transcoding between common formats |
2018-05-22 |
https://github.com/brarcher/video-transcoder |
| 1938. Villains & Heroes |
com.andremion.heroes |
Explore Villains & Heroes provided by Marvel Comics. © 2016 MARVEL |
Jul 5, 2017 |
https://github.com/andremion/Villains-and-Heroes |
| 1939. Vinyl Music Player |
com.poupa.vinylmusicplayer |
Light and slick material design music player |
2018-05-02 |
https://github.com/AdrienPoupa/VinylMusicPlayer |
| 1940. Vision Training for babies |
com.tarlic.vision |
Simply funny. Train the vision of your baby easily! |
Aug 21, 2018 |
https://github.com/ftena/vision |
| 1941. Visual React - 2 Player |
sneakycoders.visualreact |
Challenge your friends and discover who has the fastest reflexes! |
Oct 25, 2017 |
https://github.com/JSidrach/visual-react |
| 1942. Vlille Checker |
com.vlille.checker |
Bicycle info for Lille |
2017-04-30 |
https://github.com/ojacquemart/vlilleChecker |
| 1943. VoIP.ms SMS |
net.kourlas.voipms_sms |
Send and read SMS via voip.ms |
2017-07-09 |
https://github.com/michaelkourlas/voipms-sms-client |
| 1944. Vocable Trainer |
at.hgz.vocabletrainer |
Vocable trainer with text field input und multiple choice test. |
Oct 1, 2017 |
https://github.com/hgzojer/vocabletrainer |
| 1945. VocableTrainer Beta |
vocabletrainer.heinecke.aron.vocabletrainer |
Learn vocables of foreign languages |
2018-03-19 |
https://github.com/0xpr03/VocableTrainer-Android |
| 1946. Vocabulary Trainer |
de.trilobytese.vocab |
Lern quick and easily your own vocabulary words |
May 24, 2017 |
https://github.com/svengerhardt/android-vocabulary-trainer |
| 1947. Voice Message Board |
net.mm2d.android.vmb |
Enter the text in the voice, and displays the text in large letters. |
Oct 12, 2018 |
https://github.com/ohmae/VoiceMessageBoard |
| 1948. Voice Notify |
com.pilot51.voicenotify |
Spoken notifications |
2018-04-24 |
https://github.com/pilot51/voicenotify |
| 1949. Voicer |
com.emmanuelmess.voicer |
Voicer dictates you the text you wish. |
Mar 30, 2017 |
https://github.com/EmmanuelMess/Voicer |
| 1950. Voice |
de.ph1b.audiobook |
Simple audiobook player |
2017-10-26 |
https://github.com/PaulWoitaschek/Voice |
| 1951. Volume Notification |
net.hyx.app.volumenotification |
Instantly adjust all sound volumes from the notification area. |
Jul 22, 2017 |
https://github.com/seht/volumenotification |
| 1952. Vuze Remote |
com.vuze.android.remote |
Manage BitTorrent clients |
2017-02-10 |
https://github.com/vuze/vuze-remote-for-android |
| 1953. WALLETH |
org.walleth |
Ethereum wallet |
2018-04-17 |
https://github.com/walleth/walleth |
| 1954. WCA Scores - Rubik's Cube |
com.adrastel.niviel |
Retrieve easily your records from the World Cube Association! |
Sep 11, 2018 |
https://github.com/HerelDev/Niviel |
| 1955. WEX (ex. BTC-e) client |
com.QuarkLabs.BTCeClient |
Simple and lightweight client for WEX (ex. BTC-e) cryptoexchange |
Dec 15, 2017 |
https://github.com/0xnm/BTC-e-client-for-Android |
| 1956. WEX Assist |
com.btc_e_assist |
Open-source app for the WEX that allows you stay tuned in any place. |
Sep 17, 2017 |
https://github.com/alexandersjn/btc-e-assist |
| 1957. WEX.nz Trader Client Free (ex BTC-e.com) |
com.zlab.btcmonitorfree |
WEX.nz Trader Client Free - Android client for Exchange WEX.nz. Fast, stylish. |
Apr 8, 2018 |
https://github.com/ZorgeR/BTC-e.com-monitor-FREE |
| 1958. WK for WaniKani |
tr.xip.wanikani |
A beautiful unofficial client app for the kanji learning website wanikani.com |
Nov 29, 2017 |
https://github.com/xiprox/WaniKani-for-Android |
| 1959. WPGen |
net.glsk.wpgen |
Wallpaper generator |
2018-02-16 |
https://github.com/glesik/wpgen |
| 1960. WSDOT |
gov.wa.wsdot.android.wsdot |
Official WSDOT traffic and travel information for the state of Washington. |
Sep 17, 2018 |
https://github.com/waynedyck/wsdot-android-app |
| 1961. WTF‽ (The MirOS Project) |
de.naturalnet.mirwtfapp |
Offline acronym translator |
2017-08-08 |
https://edugit.org/nik/MirWTFApp.git |
| 1962. Wah Yan College, Kowloon (WYK) |
college.wyk.app |
The official Android app of Wah Yan College, Kowloon (WYK). |
Feb 18, 2017 |
https://github.com/WYKCode/WYK-Android |
| 1963. Waistline |
com.waist.line |
Free calorie counter and weight tracker |
2018-05-21 |
https://github.com/davidhealey/waistline |
| 1964. WakeOnLan GCM |
jp.klab.wakeonlangcm |
\WakeOnLan GCM\ enables to wake up a PC on the LAN from remote web browser. |
Jun 21, 2018 |
https://github.com/mkttanabe/WakeOnLanGCM |
| 1965. Walk to Circle |
com.evgenii.walktocircle |
This app is made for walking and discovering places around you. |
Sep 21, 2018 |
https://github.com/evgenyneu/walk-to-circle-android |
| 1966. Wall by Ivan Botty |
com.botty.wall |
Find cool wallpapers ! |
Aug 22, 2017 |
https://github.com/BottyIvan/Wall |
| 1967. WarmShowers |
fi.bitrite.android.ws |
Hospitality for touring bicyclists through Warmshowers.org! |
Jul 17, 2018 |
https://github.com/swojo/wsandroid |
| 1968. WatApp |
org.smajko.watapp |
Takes symptoms, information and picture (optional) to analyze a skin condition |
May 30, 2017 |
https://github.com/smajko/what_are_those_app |
| 1969. Watch Later |
com.lambdasoup.watchlater |
Add videos to your Watch Later list |
Apr 8, 2018 |
https://github.com/lambdasoup/watchlater |
| 1970. Watcher |
io.github.umren.watcher |
Movie recommendation engine |
Jun 30, 2017 |
https://github.com/umren/Watcher |
| 1971. Waterloo GRT Bus - MonTransit |
org.mtransit.android.ca_grand_river_transit_bus |
Grand River Transit buses for MonTransit.\nReal-time & Offline Schedule. News. |
Oct 16, 2018 |
https://github.com/mtransitapps/ca-grand-river-transit-bus-android |
| 1972. WaveUp |
com.jarsilio.android.waveup |
Turn the display on by waving |
2018-05-25 |
https://gitlab.com/juanitobananas/wave-up/tree/HEAD |
| 1973. Weather Station |
com.kresshy.weatherstation |
This application could connect to a Weather station and display the weather data |
Apr 11, 2017 |
https://github.com/Kresshy/Weather-Station |
| 1974. Weather notification |
ru.gelin.android.weather.notification |
Weather info in notification bar |
2017-09-06 |
https://bitbucket.org/gelin/weather-notification/src |
| 1975. Weather |
de.baumann.weather |
Get weather information from several webservices |
2017-08-15 |
https://github.com/scoute-dich/Weather |
| 1976. Weather |
org.secuso.privacyfriendlyweather |
Get weather information and forecast |
2018-03-19 |
https://github.com/SecUSo/privacy-friendly-weather |
| 1977. Web Opac |
de.geeksfactory.opacclient |
Convenient access to 1,000+ public and academic libraries |
2018-05-16 |
https://github.com/opacapp/opacclient |
| 1978. Web2PDF |
org.dyndns.warenix.web2pdf |
Convert any web page at your fingertips |
Jun 29, 2018 |
https://github.com/warenix/Web2PDF |
| 1979. WebApps |
com.tobykurien.webapps |
Sandbox for webapps |
2018-05-23 |
https://github.com/tobykurien/webapps |
| 1980. WebCams |
cz.yetanotherview.webcamviewer.app |
With this application you can easily view your favorite webcams |
Oct 19, 2018 |
https://github.com/makbn/WebCamViewer |
| 1981. WebRadio |
starcom.snd |
Play radio channels from web and add custom channels |
2018-02-11 |
https://github.com/Starcommander/StreamRadio/ |
| 1982. Webkey (ROOT REQUIRED) |
com.webkey |
You can control your phone from any browser: type, click, GPS, screenshot, etc. |
Aug 3, 2018 |
https://github.com/LeonardKoenig/webkey |
| 1983. WeeChat Android |
com.ubergeek42.WeechatAndroid |
Connect to remote WeeChat IRC sessions |
2018-03-23 |
https://github.com/ubergeek42/weechat-android |
| 1984. Welland Transit Bus - MonTransit |
org.mtransit.android.ca_welland_transit_bus |
Welland Transit Bus for MonTransit.\nSchedule… |
Sep 14, 2018 |
https://github.com/mtransitapps/ca-welland-transit-bus-android |
| 1985. Werewolf |
org.faudroids.werewolf |
Don't have cards to play Werewolf? Don't worry, there is an app for that ;) |
May 9, 2018 |
https://github.com/FauDroids/Werewolf |
| 1986. Werewolf |
org.secuso.privacyfriendlycardgameone |
Play Werewolf with your friends |
2018-05-18 |
https://github.com/SecUSo/privacy-friendly-werewolf |
| 1987. West Coast Express Train - MonTransit |
org.mtransit.android.ca_west_coast_express_train |
West Coast Express train for MonTransit.\nSchedule. Alerts. News. |
Sep 3, 2018 |
https://github.com/mtransitapps/ca-west-coast-express-train-android |
| 1988. West Coast Express TrainBus - MonTransit |
org.mtransit.android.ca_west_coast_express_bus |
West Coast Express TrainBus for MonTransit.\nSchedule. Alerts. News. |
Sep 22, 2018 |
https://github.com/mtransitapps/ca-west-coast-express-bus-android |
| 1989. WhackJob |
tkj.games.whackjob |
Whack your way to the highest score in this game of political whack-a-mole. |
Mar 2, 2017 |
https://github.com/pot8oe/WhackJob |
| 1990. What's up ? |
com.dancing_koala.whathaveyoubeenupto |
Having trouble remembering what you did yesterday ? This app may help you ! |
Jul 30, 2017 |
https://github.com/dancing-koala/whybut |
| 1991. WhatAnime - 以图搜番 |
pw.janyo.whatanime |
Upload your interest but is not clear source of lycopene drama shot to WhatAnime, screenshots help you find the source, or even accurate to frame. |
Sep 2, 2018 |
https://github.com/JanYoStudio/WhatAnime |
| 1992. WhatsNext - Series and Animes |
br.com.adley.whatsnextseries |
Find out when the next episode of your favorite tv show will launch! |
Sep 24, 2018 |
https://github.com/adleywd/WhatsNextSeries |
| 1993. WhereAreTheEyes |
org.daylightingsociety.wherearetheeyes |
Build a map of surveillance cameras with other activists |
2017-09-27 |
https://github.com/DaylightingSociety/WhereAreTheEyes |
| 1994. WhereYouGo |
menion.android.whereyougo |
Whereigo client |
2017-05-10 |
https://github.com/biylda/WhereYouGo |
| 1995. Whistler Transit System Bus - MonTransit |
org.mtransit.android.ca_whistler_transit_system_bus |
Whistler Transit System buses for MonTransit.\nSchedule. Real time. News. |
Oct 2, 2018 |
https://github.com/mtransitapps/ca-whistler-transit-system-bus-android |
| 1996. Whitaker's Words |
com.ids1024.whitakerswords |
Latin Morphological Analyzer and Dictionary |
Aug 7, 2018 |
https://github.com/ids1024/whitakers-words-android |
| 1997. Whitehorse Transit Bus - MonTransit |
org.mtransit.android.ca_whitehorse_transit_bus |
Whitehorse Transit Bus for MonTransit.\nSchedule… |
Jul 28, 2018 |
https://github.com/mtransitapps/ca-whitehorse-transit-bus-android |
| 1998. Who Has My Stuff? |
de.freewarepoint.whohasmystuff |
Manager for lent items |
2018-03-19 |
https://github.com/stovocor/whohasmystuff |
| 1999. WiFON |
com.croconaut.ratemebuddy |
Chat, send files or play Tic Tac Toe with your friends -- without Internet! |
Feb 21, 2018 |
https://github.com/croconaut/wifon |
| 2000. WiFi Automatic |
de.j4velin.wifiAutoOff |
Turn off WiFi automatically |
2018-03-23 |
https://github.com/j4velin/WiFi-Auto-Off |
| 2001. WiFi Barcode |
de.ub0r.android.wifibarcode |
Share WiFi settings with barcodes! |
May 13, 2018 |
https://github.com/felixb/WifiBarcode |
| 2002. WiFi Storage |
com.lica.wifistorage |
FTP File Explorer |
Jul 26, 2018 |
https://github.com/xiaosea/WiFiStorage |
| 2003. WiFiAnalyzer |
com.vrem.wifianalyzer |
Optimize your WiFi network |
2018-04-15 |
https://github.com/VREMSoftwareDevelopment/WifiAnalyzer |
| 2004. WiFiDirect |
anuj.wifidirect |
Share files through wifi bi-directional. |
Jun 15, 2017 |
https://github.com/percy-g2/wifi-direct-demo |
| 2005. WiGLE WiFi Wardriving |
net.wigle.wigleandroid |
Network stumbling and WiGLE.net database access for Android |
Oct 16, 2018 |
https://github.com/AtomicJo/wigle-wifi-wardriving |
| 2006. Wifi Remote Play |
net.sourceforge.wifiremoteplay |
Media remote control |
2017-05-15 |
https://sourceforge.net/p/wifiremoteplay/android_native |
| 2007. Wikipedia |
org.wikipedia |
Official Wikipedia app for Android. |
2018-04-19 |
https://github.com/wikimedia/apps-android-wikipedia |
| 2008. Winesaps |
ru.mitrakov.self.rush |
Winesaps – Online Multiplayer Competitive PvP Game |
Sep 4, 2018 |
https://github.com/mitrakov/applerush |
| 2009. Winnipeg Transit Bus - MonTransit |
org.mtransit.android.ca_winnipeg_transit_bus |
Winnipeg Transit buses for MonTransit.\nSchedule. Real-Time. News. |
Sep 26, 2018 |
https://github.com/mtransitapps/ca-winnipeg-transit-bus-android |
| 2010. WireGuard |
com.wireguard.android |
Next generation secure VPN network tunnel |
2018-06-04 |
https://git.zx2c4.com/wireguard-android/ |
| 2011. Wireless Valencia |
eu.javimar.wirelessvlc |
Wireless Free Public Networks of the City of Valencia, Spain. Home of the Fallas |
Jun 9, 2017 |
https://github.com/javimar/WirelessVLC |
| 2012. WiseRadar |
wiseguys.radar |
See Canadian Weather Radar Imagery on your Android Device |
Dec 12, 2017 |
https://github.com/GrahamBlanshard/WiseRadar |
| 2013. Word Power Made Easy |
org.developfreedom.wordpowermadeeasy |
Build your vocabualary |
2017-11-14 |
https://github.com/shubhamchaudhary/wordpowermadeeasy |
| 2014. Work Time Tracker |
com.firebirdberlin.tinytimetracker |
... tracks your daily working time. |
Sep 7, 2017 |
https://github.com/firebirdberlin/tinytimetracker |
| 2015. Workpage |
jajimenez.workpage |
Simple task manager |
Oct 10, 2018 |
https://github.com/jajimenez/workpage |
| 2016. World Clock |
ch.corten.aha.worldclock |
Display local time and weather conditions |
2017-08-07 |
https://github.com/arminha/worldclockwidget |
| 2017. World Scribe |
com.averi.worldscribe |
A mobile encyclopedia for fictional world-building |
Aug 25, 2018 |
https://github.com/MarquisLP/WorldScribe |
| 2018. World Weather |
com.haringeymobile.ukweather |
View weather forecast |
2017-01-27 |
https://github.com/Kestutis-Z/World-Weather |
| 2019. Wrong PIN Shutdown |
org.nuntius35.wrongpinshutdown |
Shutdown device on wrong PIN |
2017-11-28 |
https://gitlab.com/nuntius35/wps |
| 2020. XCSoar |
org.xcsoar |
Tactical glide computer and maps |
2018-03-05 |
https://github.com/XCSoar/XCSoar |
| 2021. XPrivacyLua |
eu.faircode.xlua |
Really simple to use privacy manager for Marshmallow (6.0) and later |
2018-05-07 |
https://github.com/M66B/XPrivacyLua |
| 2022. Xabber |
com.xabber.androiddev |
Instant messaging client |
2017-05-15 |
https://github.com/redsolution/xabber-android |
| 2023. Xposed Downloader |
org.xposeddownloader |
Download Xposed Framework zip |
2017-10-11 |
https://github.com/daktak/xposed_downloader |
| 2024. Xposed Installer |
de.robv.android.xposed.installer |
Installer of Xposed framework |
2018-04-08 |
https://github.com/rovo89/XposedInstaller |
| 2025. Xposed One Tap Video Download |
com.phantom.onetapvideodownload |
Download videos from applications with One Tap |
Oct 8, 2018 |
https://github.com/automation-daemon/OneTapVideoDownload |
| 2026. Yalp Store |
com.github.yeriomin.yalpstore |
Download apks from Google Play Store |
2018-05-22 |
https://github.com/yeriomin/YalpStore |
| 2027. York Region YRT Viva Bus - MonTransit |
org.mtransit.android.ca_york_region_yrt_viva_bus |
York Region YRT Viva buses for MonTransit.\nSchedule. News. Service Alerts. |
Sep 24, 2018 |
https://github.com/mtransitapps/ca-york-region-yrt-viva-bus-android |
| 2028. You're a Winner! |
ca.rmen.youreawinner |
There's no way to lose! |
May 15, 2018 |
https://github.com/caarmen/youreawinner |
| 2029. Your local weather |
org.thosp.yourlocalweather |
Application displays current weather and location wherever you are. |
2018-06-04 |
https://github.com/thuryn/your-local-weather |
| 2030. Your system is up to date |
com.nagopy.android.yoursystemisuptodate |
Open the system update screen |
Jan 3, 2018 |
https://github.com/75py/YourSystemIsUpToDate |
| 2031. YourAndroidWebApp |
fr.coding.yourandroidwebapp |
Your Android WebApp : WebView to use easily your website(s) as an Application |
Sep 2, 2018 |
https://github.com/mtudury/yourandroidwebapp |
| 2032. YubiClip |
com.yubico.yubiclip |
Read YubiKey OTPs or static passwords over NFC from a YubiKey NEO. |
Sep 24, 2018 |
https://github.com/Yubico/yubiclip-android |
| 2033. Yubico Authenticator |
com.yubico.yubioath |
Generate OATH codes with YubiKey NEO over NFC |
2018-01-21 |
https://github.com/Yubico/yubioath-android |
| 2034. Yucata Envoy |
kaba.yucata.envoy |
Display how many games on Yucata are waiting for user to make a move |
2017-11-07 |
https://github.com/ka-ba/yucata.envoy |
| 2035. ZANavi |
com.zoffcc.applications.zanavi |
Car Navigation System |
2017-06-23 |
https://github.com/zoff99/zanavi |
| 2036. ZamCGs |
com.algorelpublic.zambia |
Zambia Consolidated Guidelines |
Oct 16, 2017 |
https://github.com/AlgoRepublic/zambia-android |
| 2037. Zandy |
com.gimranov.zandy.app |
Mobile access to your Zotero library |
Oct 10, 2017 |
https://github.com/avram/zandy |
| 2038. Zapp |
de.christinecoenen.code.zapp |
Collection of German public broadcasting live streams |
2018-05-22 |
https://github.com/cemrich/zapp |
| 2039. ZephyrLogger |
org.mcxa.zephyrlogger |
Log Zephyr heart rate monitor data |
2017-02-20 |
https://github.com/ianmcxa/ZephyrLogger |
| 2040. Zero |
ekylibre.zero |
Tracker d'interventions pour Ekylibre |
Mar 7, 2018 |
https://github.com/ekylibre/zero-android |
| 2041. Zoo Brno |
com.zoobrno |
Mobile applications zoos in Brno. |
Jun 11, 2018 |
https://github.com/marxsk/zobro |
| 2042. ZoumTarot |
org.zoumbox.tarot |
Comptez vite et bien vos points au Tarot ! |
Sep 10, 2018 |
https://github.com/athimel/zoumtarot |
| 2043. Zulip (Legacy) |
com.zulip.android |
Native Android app for the Zulip open source group chat software. |
May 24, 2017 |
https://github.com/saketkumar95/zulip-android |
| 2044. Zulip |
com.zulipmobile |
Powerful open-source group chat |
Oct 2, 2018 |
https://github.com/nashvail/zulip-mobile |
| 2045. [DEPRECATED] me@B - Bocconi app UNOFFICIAL |
com.thermatk.android.meatb |
Small fast UNOFFICIAL app for Bocconi students |
Jan 27, 2017 |
https://github.com/thermatk/MeAtB |
| 2046. [ROOT] Rashr - Flash Tool |
de.mkrtchyan.recoverytools |
Rashr - Flash directly from your device! |
Oct 24, 2017 |
https://github.com/Dzakus/Recovery-Tools |
| 2047. [XPOSED] Sensor Disabler |
com.mrchandler.disableprox |
Disables and modifies sensors on your device.\n\nREQUIRES XPOSED. |
Dec 24, 2017 |
https://github.com/wardellchandler/disableproxsensor |
| 2048. aFreeRDP |
com.freerdp.afreerdp |
FreeRDP is a free remote desktop protocol client |
2018-02-16 |
https://github.com/FreeRDP/FreeRDP |
| 2049. andFHEM |
li.klass.fhem |
Control your home |
Oct 13, 2018 |
https://github.com/klassm/andFHEM |
| 2050. andOTP |
org.shadowice.flocke.andotp |
Open-source two-factor authentication App |
2018-04-27 |
https://github.com/andOTP/andOTP |
| 2051. andRoc |
net.rocrail.androc |
Rocrail is a Model Railroad Control System that runs on Linux, OS X and Windows. |
Oct 3, 2018 |
https://github.com/prashant31191/andRoc |
| 2052. arXiv Papers |
com.rockbyte.arxiv |
Search, download and save arXiv scientific papers |
2018-05-16 |
https://github.com/lopespm/arxiv-papers-mobile |
| 2053. arXiv mobile |
com.commonsware.android.arXiv |
Client for arXiv.org |
2017-10-13 |
https://github.com/jdeslip/arxiv-mobile |
| 2054. aria2 |
net.sf.aria2 |
Best CLI BitTorrent client now on Android (not a remote control app!) |
Sep 7, 2017 |
https://github.com/Alexander--/aria2-android |
| 2055. bptf - TF2 Price Checker |
com.tlongdev.bktf |
The easiest way to price check your TF2 items wherever you are. |
Sep 29, 2018 |
https://github.com/Longi94/bptf |
| 2056. c't-SESAM |
de.pinyto.ctSESAM |
Password manager, compatible with Qt SESAM |
Sep 2, 2018 |
https://github.com/pinae/passwordGenerator-android |
| 2057. c-beam |
org.c_base.c_beam |
Android interface to the c-base onboard computer c-beam |
2018-04-24 |
https://github.com/c-base/c-beam-droid |
| 2058. c3nav |
de.c3nav.droid |
Navigation in C3 events |
2018-01-26 |
https://github.com/c3nav/c3nav-android/ |
| 2059. crond |
it.faerb.crond |
Schedules scripts |
2017-06-22 |
https://github.com/faerbit/android-crond |
| 2060. dandelion* |
com.github.dfa.diaspora_android |
Client for the diaspora* social network |
2018-04-10 |
https://github.com/Diaspora-for-Android/dandelion |
| 2061. dayra |
abanoubm.dayra |
smart attendance tracker app |
Apr 29, 2018 |
https://github.com/abanoubmilad/dayra |
| 2062. debDroid |
de.mangelow.debdroid |
Search for debian packages |
2017-03-03 |
https://github.com/scheich/debDroid |
| 2063. dotjpg |
tm.alashow.dotjpg |
dotjpg - Suratlary aňsat paýlaş! |
Jul 30, 2017 |
https://github.com/alashow/dotjpg |
| 2064. eLearn Utilities |
edu.cswcss.eLearning |
Digitalised learning developed for students, by students. |
Nov 10, 2017 |
https://github.com/Happypig375/InnoTech-eLearning |
| 2065. eXo |
org.exoplatform |
Connect to your eXo Platform social intranet on the go! |
Sep 25, 2018 |
https://github.com/extrememicro/mobile-android |
| 2066. exo Chambly-Richelieu-Carignan Bus - MonTransit |
org.mtransit.android.ca_chambly_richelieu_carignan_citcrc_bus |
exo Chambly-Richelieu-Carignan buses for MonTransit\nSchedules. News. |
Sep 3, 2018 |
https://github.com/mtransitapps/ca-chambly-richelieu-carignan-citcrc-bus-android |
| 2067. exo Haut-St-Laurent Bus - MonTransit |
org.mtransit.android.ca_haut_st_laurent_cithsl_bus |
exo Haut-Saint-Laurent bus for MonTransit\nSchedules. News. |
Aug 20, 2018 |
https://github.com/mtransitapps/ca-haut-st-laurent-cithsl-bus-android |
| 2068. exo L'Assomption Bus - MonTransit |
org.mtransit.android.ca_l_assomption_mrclasso_bus |
exo L'Assomption buses for MonTransit\nSchedule… |
Aug 20, 2018 |
https://github.com/mtransitapps/ca-l-assomption-mrclasso-bus-android |
| 2069. exo La Presqu'Île Bus - MonTransit |
org.mtransit.android.ca_la_presqu_ile_citpi_bus |
exo La Presqu'Île buses for MonTransit.\nSchedule. News. |
Sep 3, 2018 |
https://github.com/mtransitapps/ca-la-presqu-ile-citpi-bus-android |
| 2070. exo Laurentides Bus - MonTransit |
org.mtransit.android.ca_laurentides_citla_bus |
exo Laurentides buses for MonTransits\nSchedule. News. |
Sep 13, 2018 |
https://github.com/mtransitapps/ca-laurentides-citla-bus-android |
| 2071. exo Le Richelain Bus - MonTransit |
org.mtransit.android.ca_le_richelain_citlr_bus |
exo Le Richelain buses for MonTransit.\nSchedule. News. |
Aug 20, 2018 |
https://github.com/mtransitapps/ca-le-richelain-citlr-bus-android |
| 2072. exo Oka Express Bus - MonTransit |
org.mtransit.android.ca_deux_montagnes_mrcdm_bus |
exo Oka Express bus for MonTransit\nSchedule… |
Jul 5, 2018 |
https://github.com/mtransitapps/ca-deux-montagnes-mrcdm-bus-android |
| 2073. exo Roussillon Bus - MonTransit |
org.mtransit.android.ca_roussillon_citrous_bus |
exo Roussillon buses for MonTransit.\nSchedules. News. |
Aug 19, 2018 |
https://github.com/mtransitapps/ca-roussillon-citrous-bus-android |
| 2074. exo Sainte-Julie Bus - MonTransit |
org.mtransit.android.ca_ste_julie_omitsju_bus |
exo Sainte-Julie buses for MonTransit\nSchedules. News. |
Aug 19, 2018 |
https://github.com/mtransitapps/ca-ste-julie-omitsju-bus-android |
| 2075. exo Sorel-Varennes Bus - MonTransit |
org.mtransit.android.ca_sorel_varennes_citsv_bus |
exo Sorel-Varennes buses for MonTransit\nSchedules. News. |
Aug 20, 2018 |
https://github.com/mtransitapps/ca-sorel-varennes-citsv-bus-android |
| 2076. exo Sud-Ouest Bus - MonTransit |
org.mtransit.android.ca_sud_ouest_citso_bus |
exo Sud-Ouest buses for MonTransit.\nSchedules. News. |
Aug 20, 2018 |
https://github.com/mtransitapps/ca-sud-ouest-citso-bus-android |
| 2077. exo Terrebonne-Mascouche Bus - MonTransit |
org.mtransit.android.ca_les_moulins_mrclm_bus |
exo Terrebonne-Mascouche buses for MonTransit\nSchedule. News. |
Sep 6, 2018 |
https://github.com/mtransitapps/ca-les-moulins-mrclm-bus-android |
| 2078. exo Vallée du Richelieu Bus - MonTransit |
org.mtransit.android.ca_richelieu_citvr_bus |
exo Vallée du Richelieu buses for MonTransit.\nSchedules. News. |
Aug 30, 2018 |
https://github.com/mtransitapps/ca-richelieu-citvr-bus-android |
| 2079. eyeRS |
com.github.eyers |
An easy to use visual and interactive open source cataloging application |
Nov 27, 2017 |
https://github.com/eyeRS/eyeRS |
| 2080. fieldTask |
org.smap.smapTask.android |
App for completing assessments on an Android phone. |
Aug 1, 2018 |
https://github.com/smap-consulting/fieldTask |
| 2081. getChromium |
com.anddevw.getchromium |
Installs the latest build of Chromium |
2018-01-26 |
https://github.com/andDevW/getChromium |
| 2082. iNaturalist |
org.inaturalist.android |
Observe and identify plants and animals with your friends |
Oct 6, 2018 |
https://github.com/simmam/simmam_inaturalist |
| 2083. jAlcoMeter |
fi.tuska.jalkametri |
Ever wonder how much you drink? Install jAlcoMeter and find out! |
Nov 1, 2017 |
https://github.com/thaapasa/jalkametri-android |
| 2084. k4android |
de.k4ever.k4android |
client for k4ever cash system |
2017-01-11 |
https://gitlab.tubit.tu-berlin.de/freitagsrunde/k4ever-android-2 |
| 2085. kalTax (PH BIR Tax Calculator) |
com.ymsoftlabs.caltax |
Philippine BIR Tax Calculator |
Jan 6, 2018 |
https://github.com/julznc/calTax |
| 2086. konashi inspector |
com.uxxu.konashi.inspector.android |
konashi 2 の全機能を Android から簡単に操作できるアプリです。 |
Jun 29, 2017 |
https://github.com/YUKAI/KonashiInspectorForAndroid |
| 2087. la/u/ncher |
com.angryburg.uapp |
The official app for danger/u/, dangeru.us |
2018-03-31 |
https://github.com/nilesr/United4 |
| 2088. lichess • Free Online Chess |
org.lichess.mobileapp |
The one free online Chess game. No hidden costs, no ads! |
Sep 23, 2018 |
https://github.com/garawaa/lichobile |
| 2089. mUzima |
com.muzima |
Adaptable platform with primary implementations in online/offline health space |
Jul 16, 2018 |
https://github.com/vijayakumarn/muzima-android |
| 2090. mensaDD |
com.pasta.mensadd |
School cafeteria app for Dresdner universities and (high)! |
May 2, 2018 |
https://github.com/julianctni/mensaDD |
| 2091. meteroid |
de.chaosdorf.meteroid |
Client for Mete |
2018-02-13 |
https://github.com/chaosdorf/meteroid |
| 2092. minedmonero |
com.vgorcum.minedmonero |
Copanion app for monero miners on supported pools |
2018-02-28 |
https://gitlab.com/mvgorcum/minedmonero/tree/HEAD |
| 2093. mjuzik |
com.mjuzik |
Open Source Curated Music app build on React Native. |
Feb 11, 2017 |
https://github.com/arjunkomath/mjuzik |
| 2094. moVirt |
org.ovirt.mobile.movirt |
Free and opensource mobile client for monitoring/managing the oVirt/RHEV. |
Feb 20, 2018 |
https://github.com/zyx0225/moVirt |
| 2095. monerujo: Monero Wallet |
com.m2049r.xmrwallet |
The Android Monero Wallet |
Oct 13, 2018 |
https://github.com/m2049r/xmrwallet |
| 2096. mpv-android |
is.xyz.mpv |
Video player for Android based on libmpv. |
Apr 29, 2018 |
https://github.com/jeeb/mpv-android |
| 2097. myPoli - RPG Goal & Habit Tracker - Smart Calendar |
io.ipoli.android |
Stay focused & motivated by turning your ToDos, Habits & Goals into a game! |
Oct 18, 2018 |
https://github.com/iPoli/iPoli-android |
| 2098. myRivers |
com.epimorphics.android.myrivers |
myRivers is a simple way of browsing detailed river pollution reports in the UK |
Dec 8, 2017 |
https://github.com/alessio-b-zak/myRivers |
| 2099. myTTR |
com.jmelzer.myttr |
myTTR - Tischtennis Statistiken mit Anbindung an mytischtennis.de und click-tt |
Oct 7, 2018 |
https://github.com/chokdee/myTTR |
| 2100. nO mooRe |
net.bplaced.therefactory.nomoore |
One Room that doesn't change,\nbut time does ...\nMade in 48h for Ludum Dare 37. |
Sep 1, 2018 |
https://github.com/cdetamble/nomoore |
| 2101. nRF Toolbox for BLE |
no.nordicsemi.android.nrftoolbox |
Explore your Bluetooth low energy devices with nRF Toolbox. |
Jan 5, 2018 |
https://github.com/frostmournex/nRFToolbox |
| 2102. nitroxCalc |
fr.cap_rel.fr.sagc_plongee.fr.nitroxCalc |
Nitrox Calculator for Diving |
2018-05-28 |
https://framagit.org/erics/nitroxCalc |
| 2103. nusic |
info.schnatterer.nusic |
Informs about new music of artists stored on the device |
2018-05-27 |
https://github.com/schnatterer/nusic |
| 2104. oandbackup |
dk.jens.backup |
Backup manager |
2018-03-19 |
https://github.com/jensstein/oandbackup |
| 2105. openHAB Beta |
org.openhab.habdroid.beta |
Vendor and technology agnostic open source home automation |
2018-05-31 |
https://github.com/openhab/openhab-android |
| 2106. openHAB |
org.openhab.habdroid |
openHAB client for Android |
2018-04-21 |
https://github.com/openhab/openhab-android |
| 2107. openScale |
com.health.openscale |
Log your weight, body fat, water and muscle percentage |
2018-05-23 |
https://github.com/oliexdev/openScale |
| 2108. org.fdroid.fdroid.ota_1001050 |
org.fdroid.fdroid.ota_1001050.zip |
F-Droid installer for devices with Privileged Extension built-in |
2018-03-26 |
https://gitlab.com/fdroid/fdroidclient |
| 2109. org.fdroid.fdroid.privileged.ota_2070 |
org.fdroid.fdroid.privileged.ota_2070.zip |
Services to allow F-Droid to securely install and update apps |
2017-10-20 |
https://gitlab.com/fdroid/privileged-extension |
| 2110. ownCloud Bookmarks |
org.schabi.nxbookmarks.owncloud |
A front end for the Nextcloud Bookmark app |
2017-11-14 |
https://github.com/theScrabi/OCBookmarks |
| 2111. ownCloud |
com.owncloud.android |
Synchronization client |
2018-04-14 |
https://github.com/owncloud/android |
| 2112. pMetro |
com.utyf.pmetro |
Calculate shortest metro routes in Russia |
2018-03-23 |
https://github.com/Utyff/pMetro |
| 2113. pOT-Droid |
com.mde.potdroid |
Companion app for mods.de forum |
2017-05-06 |
https://github.com/janoliver/pOT-Droid |
| 2114. packlist |
com.nbossard.packlist |
Manage packing lists |
2018-02-16 |
https://github.com/nbossard/packlist |
| 2115. pixelflood |
de.lihotzki.pixelflood |
Pixelflut server |
2018-02-16 |
https://github.com/lukaslihotzki/pixelflood |
| 2116. podplayer |
com.mamewo.podplayer0 |
A podcast player. |
Jan 6, 2017 |
https://github.com/mamewotoko/podplayer |
| 2117. pretixdroid |
eu.pretix.pretixdroid |
Validates tickets generated by pretix |
2018-03-05 |
https://github.com/pretix/pretixdroid |
| 2118. primitive ftpd |
org.primftpd |
FTP server |
2018-04-14 |
https://github.com/wolpi/prim-ftpd |
| 2119. privacyIDEA Authenticator |
it.netknights.piauthenticator |
OTP Authenticator for two factor authentication with privacyIDEA |
Jul 17, 2018 |
https://github.com/privacyidea/privacyidea-authenticator |
| 2120. p≡p pretty Easy privacy |
pep.android.k9 |
Read and write encrypted e-mails |
2017-09-11 |
|
| 2121. sesam |
de.larcado.sesam |
Hash based password manager |
2018-05-18 |
https://gitlab.com/larcado/sesam/tree/HEAD |
| 2122. sg for SteamGifts |
net.mabako.steamgifts |
SteamGifts client |
2018-03-31 |
https://github.com/SteamGifts/SteamGifts |
| 2123. simple Temperature Converter |
wetsch.simpletemperatureconverter |
converts temperature between fahrenheit, celsius and kelvin |
Aug 2, 2017 |
https://github.com/CorruptCube/android-temp-converter |
| 2124. strings.xml editor |
com.nohkumado.intstringsynchro |
Helper app to manage translations of app-ressource files |
Dec 20, 2017 |
https://github.com/nohkumado/intstringsynchro |
| 2125. strongSwan VPN Client |
org.strongswan.android |
An easy to use IKEv2/IPsec-based VPN client. |
Oct 17, 2018 |
https://github.com/aquto/strongswan |
| 2126. taz.app |
de.thecode.android.tazreader |
Daily the latest edition of \daily newspaper. |
Oct 17, 2018 |
https://github.com/die-tageszeitung/tazapp-android |
| 2127. twitlatte |
com.github.moko256.twitlatte |
Twitter, Mastodon and Pleroma client |
2018-06-04 |
https://github.com/moko256/twitlatte |
| 2128. uNote |
app.varlorg.unote |
Lightweight and minimalist notepad |
2018-06-02 |
https://gitlab.com/Varlorg/uNote/tree/HEAD |
| 2129. visor - low vision magnifier |
de.visorapp.visor |
Visor is a magnifying glass for your Android device. |
Jul 1, 2018 |
https://github.com/kloener/visor-android |
| 2130. wShell |
ru.meefik.wshell |
Web-based terminal emulator for Android |
Jan 4, 2018 |
https://github.com/RoiSoleil/wshell |
| 2131. wallabag |
fr.gaulupeau.apps.InThePoche |
Read-it-later client |
2017-10-23 |
https://github.com/wallabag/android-app |
| 2132. welle.io DAB+ SDR |
io.welle.welle |
A DAB/DAB+ software receiver (SDR) for RTL-SDR (RTL2832U) |
Mar 3, 2018 |
https://github.com/twoofseven/welle.io |
| 2133. xkcdViewer |
net.bytten.xkcdviewer |
Application for viewing xkcd comics with hover text, search by title and more. |
Jan 21, 2017 |
https://github.com/akzfowl/XkcdViewer |
| 2134. yaxim |
org.yaxim.androidclient |
XMPP (Instant Messaging) client |
2017-03-30 |
https://github.com/ge0rg/yaxim |
| 2135. Ω Resist |
com.reactor |
Challenge your friends with this fun and addictive reaction! |
Apr 7, 2017 |
https://github.com/anhldbk/reactor |
| 2136. 물 한잔 해요 - 물 마시기 |
com.skydoves.waterdays |
Create a smart hydration habits with \I'm a glass of water! |
Sep 22, 2017 |
https://github.com/skydoves/WaterDrink |
| 2137. μMath+ |
com.mkulesh.micromath.plus |
Computer algebra system |
2018-03-23 |
https://github.com/mkulesh/microMathematics |
| 2138. μlogger |
net.fabiszewski.ulogger |
Log position to your own server |
2018-05-25 |
https://github.com/bfabiszewski/ulogger-android |
| 2139. 華文News |
com.ccjeng.news |
Taiwan Gangxing Mahua Wen news RSS news reader |
Aug 11, 2018 |
https://github.com/ccjeng/News |
| 2140. הר\י - ההסתדרות הרפואית בישראל |
com.medicine.ima |
IMA app is designed for doctors and the general public |
Aug 10, 2018 |
https://github.com/androidfirstgroup/Medic |
| 2141. 多云 |
com.napsterwan.cloudweather |
Simple weather application, you deserve |
Jun 15, 2017 |
https://github.com/Napsterwan/CloudWeather |
| 2142. צבע אדום - התרעות בזמן אמת |
com.red.alert |
אפליקציה התנדבותית המאפשרת לך לקבל התרעה בזמן אמת על אזעקת צבע אדום באזורך! |
Aug 10, 2018 |
https://github.com/eladnava/redalert-android |
| 2143. لوح مفاتيح القرآن الكريم |
com.djalel.android.qurankeyboard |
Pad Arabic keys with quick search in the Holy Quran and copies of its verses when you enter the text |
Sep 26, 2018 |
https://github.com/cdjalel/QuranKeyboard |
| 2144. 博客园-IT新闻 |
com.misscellapp.news |
IT News |
May 12, 2017 |
https://github.com/chenjishi/ITNews |
| 2145. 리니지M 조기경보기 |
com.stolineage.lineagewatcher |
리니지M 물약소진을 감지하여 진동 or 진동 + 리니지M종료! 당신의 소중한 경험치를 지키세요. |
Jun 30, 2017 |
https://github.com/includex/LineageWatcher |
| 2146. سخن |
com.nouribygi.sokhan |
Persian poetry collection |
Feb 26, 2017 |
https://github.com/nouribygi/Sokhan |
| 2147. 국민밥 |
net.sproutlab.kmufood |
국민대학교 학생들에 의한! 학생들을 위한! 학생의! 학식 어플리케이션! |
Sep 24, 2018 |
https://github.com/sprout-lab/kmufood-android |
| 2148. 快红包 |
xyz.monkeytong.hongbao |
A help when you invincible WeChat grab a red envelope Android applications. Automatically detect and open envelopes, faster than you can imagine. |
Apr 14, 2018 |
https://github.com/supengchao/HongbaoPlugin |
| 2149. 光谷社区 - guanggoo.com 第三方客户端 |
org.mazhuang.guanggoo |
Optical Valley Community (guanggoo.com) third-party Android client. |
Apr 29, 2018 |
https://github.com/mzlogin/guanggoo-android |
| 2150. 木棉手札 2.0 (大安高工學生助理) |
kesshou.android.daanx |
Daan Engineering student assistant\nFollow us special powder\nhttps://m.facebook.com/dtf0215/ |
Jul 24, 2018 |
https://github.com/Kesshou/Kesshou-Android |
| 2151. Περί Βουλής |
gr.mobap |
Πολυμεσική εφαρμογή για το Ελληνικό Κοινοβούλιο σε κινητές συσκευές |
May 18, 2018 |
https://github.com/anagnostou74/Parliament |
| 2152. 西电图卦 |
club.xdnice.com.tugua |
图说天下奇闻，挖掘校园八卦。 |
Jan 5, 2017 |
https://github.com/Domonlee/Tugua |
| 2153. 扇贝单词 |
com.shanbay.words |
Root, examples, notes and native pronunciation, scientific plan of arrangement, the daily punch, scallop word can make you stick more than 1000 days |
Jul 31, 2018 |
https://github.com/AndyGu/ShanBay |
| 2154. 台灣環境通 - 輻射、水庫、空氣品質、紫外線 |
com.npes87184.enviromenttw |
一個 APP 輕鬆掌握台灣輻射、水庫資源、紫外線以及空氣品質資訊 |
Feb 25, 2017 |
https://github.com/npes87184/EnvironmentTW |
| 2155. Афиша к.Тирасполь |
com.fallgamlet.dnestrcinema |
Приложение (стороннее) для просмотра расписания сеансов в кинотеатре \Тирасполь|May 14, 2017 |
https://github.com/fallGamlet/DnestrCinema |
|
| 2156. বাংলা হাদিস (Bangla Hadith) |
com.hadithbd.banglahadith |
Application for Hadith in Bangla & other Islamic Books (Bangla/English/Arabic) |
Nov 18, 2017 |
https://github.com/Apptitive/BanglaHadith |
| 2157. 경북대학교 강의계획서 |
com.hwang.sy_knu |
KNU 경대 경북대 경북대학교 수업시간 및 강의계획서 조회 어플 |
Jul 23, 2017 |
https://github.com/capollux/syknu |
| 2158. مثنوی معنوی |
com.nouribygi.masnavi |
متن صحیح مثنوی معنوی |
Jan 23, 2017 |
https://github.com/nouribygi/Masnavi |
| 2159. 虎扑步行街 |
com.bxj |
虎扑 步行街 论坛 浏览APP |
Oct 28, 2017 |
https://github.com/wudizhuo/BXJ |
| 2160. 同文輸入法 |
com.osfans.trime |
基於開源的RIME／中州韻輸入法引擎， 旨在保護漢語各地方言母語， 音碼形碼通用的輸入法平臺 |
Feb 9, 2017 |
https://github.com/Bambooin/trime |
| 2161. 배달의민족 |
com.sampleapp |
대한민국 1등 배달앱, 배달의민족! \n세상은 넓고 맛집은 역시 배달의민족 |
Oct 16, 2018 |
https://github.com/d-a-n/react-native-modal-picker |
| 2162. אזעקה |
net.iexos.musicalarm |
Alarm clock with two stages |
Nov 4, 2017 |
https://github.com/iexos/BipolAlarm |
| 2163. 自由香港楷書 |
hk.collaction.freehkkai |
只需在 App 內用慣常的輸入法輸入中文字，就可以看到「自由香港楷書」(該字根據香港教育局出版《常用字字形表》2007年版定義) 的參考寫法。 |
Feb 14, 2018 |
https://github.com/collaction/freehkkai-android |
| 2164. Сохрани лес |
com.nextgis.safeforest |
Сообщите о пожарах, незаконных рубках и свалках специалистам и помогите лесу! |
Jan 24, 2018 |
https://github.com/nextgis/mobile.forestviolate.user.pd |
| 2165. Активный гражданин |
ru.mos.polls |
Твой город – твое решение! Электронные голосования Правительства Москвы. |
Sep 26, 2018 |
https://github.com/active-citizen/android.java |
| 2166. 随手一记（备忘通知） |
com.github.xiaofei_dev.suspensionnotification |
A reminder reminder that sends high-frequency view information to the notification bar. |
Sep 4, 2018 |
https://github.com/xiaofei-dev/SuspendNotification |
| 2167. 內容農場檢查器（預覽版） |
hk.collaction.contentfarmblocker |
Dangxia content farm sites, you and I are responsible for, download \content farm inspector 'Android App! ! |
Jun 5, 2018 |
https://github.com/collaction/ContentFarmBlockerAndroid |
| 2168. ぼくのかんがえたさいきょうの2chまとめ |
com.niusounds.matomeviewer |
Past and future, you want wiped out before you born all ads. |
Nov 27, 2017 |
https://github.com/niusounds/2chmatome |
| 2169. 育て方、難しさがまるわかり！家庭菜園のミカタ |
jp.pules.kateisaiennomikata |
家庭菜園で簡単な野菜を育てませんか？家庭菜園のミカタが野菜作りを教えます。 |
Apr 2, 2018 |
https://github.com/watanabefg/kateisaiennomikata |